Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2193.11143114360640.0
Kwal_23.57891133115146230.0
Scas_704.381161116845700.0
YIL048W (NEO1)1151116145620.0
ADL079C1166118444630.0
KLLA0C08393g1148116644400.0
CAGL0L00715g1144116443890.0
Scas_89.127125813601e-180
KLLA0A04015g1343105011721e-139
YAL026C (DRS2)1355106811341e-134
Kwal_26.70701315107411141e-131
CAGL0G06270g1328108711081e-130
ADR350W1311106210451e-122
YER166W (DNF1)15718888892e-99
Scas_636.1615549608802e-98
CAGL0L11814g15768888732e-97
CAGL0G08085g15788898681e-96
Scas_576.815918898644e-96
YDR093W (DNF2)16128858352e-92
KLLA0C17644g15765146006e-63
AGR120C15475155926e-62
CAGL0H04477g16264705552e-57
Kwal_23.355615973945382e-55
KLLA0E01650g15503535372e-55
YMR162C (DNF3)16564925293e-54
Scas_669.316384385096e-52
AFL191W15753575016e-51
Scas_505.410253503495e-33
KLLA0B08217g14397022647e-23
AFR567W14497142631e-22
Scas_665.3014396202405e-20
Kwal_23.316011007342387e-20
CAGL0A00517g11227832324e-19
YDR038C (ENA5)10917822299e-19
YDR039C (ENA2)10917822281e-18
YDR040C (ENA1)10917042272e-18
Kwal_47.1754712408182272e-18
CAGL0M11308g14525582262e-18
CAGL0K12034g10877192191e-17
AFL011W12427262192e-17
Kwal_14.14989397752111e-16
KLLA0F20658g10827002101e-16
Kwal_26.920714696302102e-16
CAGL0I04312g9517702064e-16
AGL097C10967782047e-16
CAGL0J01870g9467292031e-15
YOR291W14725562003e-15
YGL167C (PMR1)9507721983e-15
AEL301W9576691922e-14
KLLA0E14630g10827151903e-14
Scas_707.48*7417641894e-14
KLLA0A08910g12804001886e-14
YGL006W (PMC1)11733601709e-12
KLLA0A03157g9387111619e-11
CAGL0L01419g12144281546e-10
AFR354C12102901412e-08
KLLA0A09031g8994791304e-07
KLLA0E22352g12064341198e-06
AGL085C9092711181e-05
Scas_583.14*8754271116e-05
YPL036W (PMA2)9472221091e-04
YEL031W (SPF1)12154251091e-04
Scas_688.19132711091e-04
Kwal_47.175228993411027e-04
YGL008C (PMA1)9181521000.001
CAGL0A00495g902271970.003
Scas_710.41904271940.007
KLLA0F07447g97590920.014
Scas_297.1800194910.017
Scas_227.0d307114850.049
Scas_569.0d468118850.074
Kwal_55.2157598948850.078
KLLA0D04092g115241830.14
AGL041C123398800.32
Scas_615.994276751.3
YDR270W (CCC2)100452741.6
YBR295W (PCA1)121652732.4
CAGL0M08602g101268713.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2193.1
         (1143 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        2340   0.0  
Kwal_23.5789                                                         1785   0.0  
Scas_704.38                                                          1764   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  1761   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  1723   0.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  1714   0.0  
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  1695   0.0  
Scas_89.1                                                             528   e-180
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   456   e-139
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   441   e-134
Kwal_26.7070                                                          433   e-131
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   431   e-130
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   407   e-122
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   347   2e-99
Scas_636.16                                                           343   2e-98
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   340   2e-97
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   338   1e-96
Scas_576.8                                                            337   4e-96
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   326   2e-92
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   235   6e-63
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   232   6e-62
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   218   2e-57
Kwal_23.3556                                                          211   2e-55
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   211   2e-55
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   208   3e-54
Scas_669.3                                                            200   6e-52
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   197   6e-51
Scas_505.4                                                            139   5e-33
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   106   7e-23
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   105   1e-22
Scas_665.30                                                            97   5e-20
Kwal_23.3160                                                           96   7e-20
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    94   4e-19
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    93   9e-19
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    92   1e-18
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    92   2e-18
Kwal_47.17547                                                          92   2e-18
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    92   2e-18
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    89   1e-17
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    89   2e-17
Kwal_14.1498                                                           86   1e-16
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    86   1e-16
Kwal_26.9207                                                           86   2e-16
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    84   4e-16
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    83   7e-16
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    83   1e-15
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    82   3e-15
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    81   3e-15
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    79   2e-14
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    78   3e-14
Scas_707.48*                                                           77   4e-14
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    77   6e-14
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    70   9e-12
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    67   9e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    64   6e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    59   2e-08
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    55   4e-07
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    50   8e-06
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    50   1e-05
Scas_583.14*                                                           47   6e-05
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    47   1e-04
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    47   1e-04
Scas_688.1                                                             47   1e-04
Kwal_47.17522                                                          44   7e-04
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    43   0.001
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    42   0.003
Scas_710.41                                                            41   0.007
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    40   0.014
Scas_297.1                                                             40   0.017
Scas_227.0d                                                            37   0.049
Scas_569.0d                                                            37   0.074
Kwal_55.21575                                                          37   0.078
KLLA0D04092g complement(344666..348124) some similarities with s...    37   0.14 
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    35   0.32 
Scas_615.9                                                             33   1.3  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    33   1.6  
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    33   2.4  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    32   3.4  

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 2340 bits (6064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1131/1143 (98%), Positives = 1131/1143 (98%)

Query: 1    MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQINNSLNTSGENFEMRT 60
            MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQINNSLNTSGENFEMRT
Sbjct: 1    MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQINNSLNTSGENFEMRT 60

Query: 61   IDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQQGSNQSPWSKF 120
            IDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQQGSNQSPWSKF
Sbjct: 61   IDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQQGSNQSPWSKF 120

Query: 121  IRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPIT 180
            IRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPIT
Sbjct: 121  IRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPIT 180

Query: 181  FIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQR 240
            FIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQR
Sbjct: 181  FIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQR 240

Query: 241  RQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKT 300
            RQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKT
Sbjct: 241  RQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKT 300

Query: 301  DQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSV 360
            DQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSV
Sbjct: 301  DQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSV 360

Query: 361  DNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFV 420
            DNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFV
Sbjct: 361  DNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFV 420

Query: 421  LSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTI 480
            LSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTI
Sbjct: 421  LSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTI 480

Query: 481  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVXXX 540
            VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELV   
Sbjct: 481  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVSSS 540

Query: 541  XXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVG 600
                     AKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVG
Sbjct: 541  TTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVG 600

Query: 601  LSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADT 660
            LSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADT
Sbjct: 601  LSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADT 660

Query: 661  VMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETM 720
            VMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETM
Sbjct: 661  VMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETM 720

Query: 721  SSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISA 780
            SSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISA
Sbjct: 721  SSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISA 780

Query: 781  KLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVD 840
            KLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVD
Sbjct: 781  KLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVD 840

Query: 841  LPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQAS 900
            LPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQAS
Sbjct: 841  LPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQAS 900

Query: 901  LAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIAL 960
            LAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIAL
Sbjct: 901  LAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIAL 960

Query: 961  YQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILS 1020
            YQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILS
Sbjct: 961  YQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILS 1020

Query: 1021 LFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTF 1080
            LFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTF
Sbjct: 1021 LFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTF 1080

Query: 1081 LIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPVWAAKAIHRKINPPNYAKVQQF 1140
            LIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPVWAAKAIHRKINPPNYAKVQQF
Sbjct: 1081 LIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPVWAAKAIHRKINPPNYAKVQQF 1140

Query: 1141 STI 1143
            STI
Sbjct: 1141 STI 1143

>Kwal_23.5789
          Length = 1133

 Score = 1785 bits (4623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 875/1151 (76%), Positives = 990/1151 (86%), Gaps = 33/1151 (2%)

Query: 1    MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQINNSLNTSGENFEMRT 60
            MSFSPPPGSNK  ++   NN  +S D  D Q EDSLDAALESLQI+   + + E+FEM +
Sbjct: 1    MSFSPPPGSNK--ESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAREDFEMTS 58

Query: 61   IDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLI---GTTQEPWSNN------QQG 111
            +                  N+S KN   S   DT+PLI    T    WS++      +  
Sbjct: 59   LRS----------------NESQKNARQS---DTEPLINNGATAPNSWSHDPRHDSDRST 99

Query: 112  SNQSP-WSKFIRLIKTPTTTDLSKYRSTNSSIELTD-QHVEREIHPDTTPIYDKNKYPSN 169
            ++ SP WS+  + +++  +  +S Y++T++SI+L D Q ++REIHP TTP+YD+ KY  N
Sbjct: 100  ASGSPFWSRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPN 159

Query: 170  AISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVT 229
            AISNAKYNP+TFIP ILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVL VT
Sbjct: 160  AISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVT 219

Query: 230  MSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQS 289
            MSKEA+DDIQRR+RD+ESNNELYEVL+K+QLVPSKDLKVGDLIKI KG R PADLVLLQS
Sbjct: 220  MSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQS 279

Query: 290  SEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLT 349
            SEPSGE FIKTDQLDGETDWKLR+AC LTQ+LS DDLL +ISITAS PEKSI+ FLGKLT
Sbjct: 280  SEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLT 339

Query: 350  YKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINS 409
            + +  S  LSVDNTMWANTV AS G+ I CVVYTG DTRQAMNT+MSSVKTGLLELEINS
Sbjct: 340  FGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINS 399

Query: 410  LSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQ 469
            LSKILCACVF+LS+ LVAFAGF N DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYA Q
Sbjct: 400  LSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQ 459

Query: 470  IEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIV 529
            IEHD+TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKKLHLGTVSYTMDTMDIV
Sbjct: 460  IEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIV 519

Query: 530  TDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDE 589
            TDYV+ +             +KKDLP RVRDLV+TLA+CH VTPTFEDGELTYQAASPDE
Sbjct: 520  TDYVRAM-SDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDE 578

Query: 590  IAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG 649
            IAIVKFTESVGL+LF+RDRHS++L H  S TNFEYDIL VFPFNSD KRMGI+++DK K 
Sbjct: 579  IAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKD 638

Query: 650  EHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDA 709
            E+WF+QKGAD VM++IVQ NDWL+EE GN+AREGLRTLVIGRK+LS K  + F K+Y DA
Sbjct: 639  EYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698

Query: 710  SLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769
            SL MLNR+ TMS+VI KHLEH+LE+LGLTGVEDKLQ DVKSSIELLRNAG+KIWMLTGDK
Sbjct: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758

Query: 770  VETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTY 829
            VETARCVSISAKL+SRGQYVHTVTK+++PEGAL  LE LKIN +SCLLIDGESLG++L Y
Sbjct: 759  VETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEY 818

Query: 830  YKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGV 889
            Y+Q+FF+IVV+LPAVIACRCTPQQKADVA  IRE+TGKRVCCIGDGGNDVSMIQ ADVGV
Sbjct: 819  YRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGV 878

Query: 890  GIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVY 949
            GIVGKEGKQASLAADFS+TQFCHL+KLLLWHGRNSYKRSAKLAQFVIHRGL+ISVCQAVY
Sbjct: 879  GIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938

Query: 950  SVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKELTAGTSLS 1009
            S+ SKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK YPELYKELTAG SLS
Sbjct: 939  SISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLS 998

Query: 1010 YKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELIMVALEIYTWN 1069
            YKTFFVWV+LSLFQGC IQG+SQ FTSLDE+DFK+LVALSFT L++NELIMVA+EIYTWN
Sbjct: 999  YKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWN 1058

Query: 1070 KTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPVWAAKAIHRKI 1129
            KTMV++E+VTFLI+V SVP L EYFDLT++S+  +Y KL  IL++S+ PVWAAKA+HR++
Sbjct: 1059 KTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALHRRL 1118

Query: 1130 NPPNYAKVQQF 1140
            NPP+YAKVQQF
Sbjct: 1119 NPPSYAKVQQF 1129

>Scas_704.38
          Length = 1161

 Score = 1764 bits (4570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 853/1168 (73%), Positives = 985/1168 (84%), Gaps = 32/1168 (2%)

Query: 1    MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQIN----NSLNTSGENF 56
            M FSP    ++  Q  +S   R+S DSFDLQFEDS DA L+++++N    N  NT   N 
Sbjct: 1    MPFSPSLNPDR--QKSNSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTRNQNNTLPNNQ 58

Query: 57   EMRTIDQDGDDT--QSFKHSRVSSLNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQQGS-- 112
             +     +  D   +SF+   +++ N    ++  SS  D QPL+  +    ++N  GS  
Sbjct: 59   NINKASSENKDKLQESFEMKSLNARNGGLGHSRNSSNGDRQPLMHDS----ASNPDGSPY 114

Query: 113  -------------NQSPWSKFIRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTP 159
                         + + +S +I  +K        K+  T  S+EL D+H+EREIHP TTP
Sbjct: 115  KYTNVSESALNLHSNNRFSNWITKLKMVGAQKWKKFH-TMGSVELDDRHMEREIHPSTTP 173

Query: 160  IYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYI 219
            +YD+N+YP N ISNAKYN  TFIP +LYEQFKFF+NLYFL+VALSQAIPALRIGYLSSY+
Sbjct: 174  VYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYV 233

Query: 220  VPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTR 279
            VPLAFVL VTMSKEAMDDIQRR+RD ESN+ELY VLN+++LVPSKDLKVGDLIKI KG R
Sbjct: 234  VPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDR 293

Query: 280  IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEK 339
            +PADLVLLQSSEPSGE+FIKTDQLDGETDWKLR+A +LTQNL+  DL+NK+SITAS+PEK
Sbjct: 294  LPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEK 353

Query: 340  SIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVK 399
            +IH FLGK+TYKD+SSN LS+DNT+WANTVLAS G CIGCVVYTG DTRQAMNTT ++VK
Sbjct: 354  AIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVK 413

Query: 400  TGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNL 459
            TGLLELEINS+SKILCA VF LSI+LV FAGF N DWY+D+MRYLILFSTIIPVSLRVNL
Sbjct: 414  TGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNL 473

Query: 460  DLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTV 519
            DL KSVYA QIEHD TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLGTV
Sbjct: 474  DLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTV 533

Query: 520  SYTMDTMDIVTDYVQELVXXXXXX----XXXXXXAKKDLPNRVRDLVVTLAICHNVTPTF 575
            SYT +T+DIV+DYV  LV                ++KDL  RVRD+VVTLAICHNVTPTF
Sbjct: 534  SYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTF 593

Query: 576  EDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSD 635
            ED ELTYQAASPDEIAIVKFTESVGLSLFKRDRHS+SL H HS +   Y+ILQVFPFNSD
Sbjct: 594  EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSD 653

Query: 636  TKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLS 695
            +KRMGIIV+D+ K E+WFMQKGADTVMARIV++NDWL+EE GNMAREGLRTLV+GRKKLS
Sbjct: 654  SKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLS 713

Query: 696  PKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELL 755
               Y+QF+K+Y DASLSM+NRD+ M++VI K+LE++LELLGLTGVEDKLQNDVKSSIELL
Sbjct: 714  RNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELL 773

Query: 756  RNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSC 815
            RNAG+KIWMLTGDKVETARCVSISAKLISRGQYVH +TKL++PEGALN LEYLK+NK +C
Sbjct: 774  RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGAC 833

Query: 816  LLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDG 875
            LLIDGESLGMFL YYK+EFFD+V+ LP V+ACRCTPQQKADVAL+IRE TGKRVCCIGDG
Sbjct: 834  LLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDG 893

Query: 876  GNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFV 935
            GNDVSMIQCADVGVGIVGKEGKQASLAADFS+T+FCHLT+LLLWHGRNSYKRSAKLAQF+
Sbjct: 894  GNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFI 953

Query: 936  IHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIY 995
            +HRGL+I++CQAVYS+CSKFEPI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTKIY
Sbjct: 954  MHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIY 1013

Query: 996  PELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVI 1055
            PELYK+LT G SLSYKTFFVW  LSLFQGC IQG SQ F+SL EVDF K+VA+ FTAL++
Sbjct: 1014 PELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALIL 1073

Query: 1056 NELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVS 1115
            NELIMVALEIYTWNK MV TEI+TFL YV+SVPFL EYFDL ++  L FY +L+FIL VS
Sbjct: 1074 NELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVS 1133

Query: 1116 VFPVWAAKAIHRKINPPNYAKVQQFSTI 1143
            VFPVWAAKAIHR+++PP+YAKVQ+FST+
Sbjct: 1134 VFPVWAAKAIHRRLHPPSYAKVQEFSTV 1161

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 1761 bits (4562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 865/1161 (74%), Positives = 993/1161 (85%), Gaps = 38/1161 (3%)

Query: 6    PPG--SNKLNQAPSSNNGRS-SIDSFDLQFEDSLDAALESLQINNS------LNTSG--E 54
            PP   S+K N   S+NN  + S+DSFDL  +DS DAAL+SLQINN+       NT G  E
Sbjct: 4    PPSFKSHKQNLFNSNNNQHANSVDSFDLHLDDSFDAALDSLQINNNPEPLSKHNTVGDRE 63

Query: 55   NFEMRTIDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQQGSNQ 114
            +FEMRT+D    D  +F        N S+ +   SS  DT PL+   +    +N + +N 
Sbjct: 64   SFEMRTVD----DLDNFS-------NHSSDSHRKSSNTDTHPLMYDNRLSQDDNFKFTNI 112

Query: 115  SP---------WSKFIRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNK 165
            +          +SK +  +K   T + SK+    S IEL+DQH+EREIHPDTTP+YD+N+
Sbjct: 113  ASSPPSSSNNIFSKALSYLKVSNTKNWSKF---GSPIELSDQHIEREIHPDTTPVYDRNR 169

Query: 166  YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
            Y SN +SNAKYN +TF+P +LYEQFKFF+NLYFL+VALSQA+PALRIGYLSSYIVPLAFV
Sbjct: 170  YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229

Query: 226  LMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLV 285
            L VTM+KEA+DDIQRR+RD+ESNNELY V+ + + +PSKDLKVGDLIK+HKG RIPADLV
Sbjct: 230  LTVTMAKEAIDDIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLV 289

Query: 286  LLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFL 345
            LLQSSEPSGESFIKTDQLDGETDWKLRVAC LTQNLS +DL+N+ISITAS+PEKSIH+FL
Sbjct: 290  LLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFL 349

Query: 346  GKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLEL 405
            GK+TYKDS+SN LSVDNT+WANTVLAS G CI CVVYTG DTRQAMNTT + VKTGLLEL
Sbjct: 350  GKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLEL 409

Query: 406  EINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV 465
            EINS+SKILCACVF LSI+LVAFAGF N DWY+DI+RYLILFSTIIPVSLRVNLDL KSV
Sbjct: 410  EINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSV 469

Query: 466  YARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDT 525
            YA QIEHD TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLGTVSYT +T
Sbjct: 470  YAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSET 529

Query: 526  MDIVTDYVQELVXXXXXXXXXXXXA----KKDLPNRVRDLVVTLAICHNVTPTFEDGELT 581
            +DIV+DYVQ LV            A    +KD+  RVRD+++TLAICHNVTPTFED ELT
Sbjct: 530  LDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELT 589

Query: 582  YQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGI 641
            YQAASPDEIAIVKFTESVGLSLFKRDRHS+SL H+HS     Y+ILQVFPFNSD+KRMGI
Sbjct: 590  YQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGI 649

Query: 642  IVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQ 701
            IV D+   E+WFMQKGADTVM++IV+SNDWL+EE GNMAREGLRTLVIGRKKL+ K YEQ
Sbjct: 650  IVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQ 709

Query: 702  FRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVK 761
            F+KEY+DASLSMLNRD+ MS VI K+LEH+LELLGLTGVEDKLQ DVKSSIELLRNAG+K
Sbjct: 710  FQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 769

Query: 762  IWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGE 821
            IWMLTGDKVETARCVSISAKLISRGQYVHT+TK++RPEGA N LEYLKIN+++CLLIDGE
Sbjct: 770  IWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGE 829

Query: 822  SLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSM 881
            SLGMFL +Y+QEFFD+VV LP VIACRCTPQQKADVAL+IR++TGKRVCCIGDGGNDVSM
Sbjct: 830  SLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSM 889

Query: 882  IQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLI 941
            IQCADVGVGIVGKEGKQASLAADFS+TQFCHLT+LLLWHGRNSYKRSAKLAQFV+HRGLI
Sbjct: 890  IQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLI 949

Query: 942  ISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKE 1001
            I++CQAVYS+CS FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDI+ESLTKIYPELYKE
Sbjct: 950  IAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKE 1009

Query: 1002 LTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELIMV 1061
            LT G SLSYKTFFVWV+LSLFQG  IQ  SQ FTSL + DF ++VA+SFTALV+NELIMV
Sbjct: 1010 LTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMV 1069

Query: 1062 ALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPVWA 1121
            ALEIYTWNKTM++TEI T L Y+VSVPFL +YFDL +++ + +YA L+ IL +S+FPVW 
Sbjct: 1070 ALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWT 1129

Query: 1122 AKAIHRKINPPNYAKVQQFST 1142
            AKAI+R+++PP+YAKVQ+F+T
Sbjct: 1130 AKAIYRRLHPPSYAKVQEFAT 1150

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 1723 bits (4463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 858/1184 (72%), Positives = 976/1184 (82%), Gaps = 59/1184 (4%)

Query: 1    MSFSPPP--------------GSNKLNQAPSSNNG-----RSSIDSFDLQFEDSLDAALE 41
            MSF+PPP              GS++  Q   S+       R S+DSF+L+F+DSLDAALE
Sbjct: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE 60

Query: 42   SLQINNSLN-------TSGENFEMRTIDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDT 94
            SLQI  S +          E+FE++++ +  D      HS    L +          +DT
Sbjct: 61   SLQIKRSASHERHSGIRGAEDFELKSMGRVDDG----GHSPSGVLTN----------QDT 106

Query: 95   QPLIGTTQEPWSNNQQGSNQSPW----SKFIRL---------IKTPTTTDLSKYRSTNSS 141
            QPLI  +Q+ W   Q    +S W    S + RL            P     + Y ST+S 
Sbjct: 107  QPLI--SQDSWDYGQVKRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHS- 163

Query: 142  IELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLV 201
            IELTDQHV+REIH DTTPIYDK KYP+NAISNAKYN ITF+PI+LYEQFKFFFNLYFLLV
Sbjct: 164  IELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLV 223

Query: 202  ALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLV 261
            +LSQ+IPALRIGYLSSYIVPLAFVL+VTMSKEAMDDIQRR+RD+E+NNELYEVLN +QLV
Sbjct: 224  SLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLV 283

Query: 262  PSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL 321
            PSK+L+VGDL+K+HK +RIPAD++LLQSSEPSGE+F+KTDQLDGETDWKLRVA SLTQNL
Sbjct: 284  PSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL 343

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVV 381
            + D++L K+ ITAS+PEKSIH F GKLTYK SS+  LSVDNT+WANTVLAS G+C+ CV+
Sbjct: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSA-PLSVDNTLWANTVLASSGTCVACVI 402

Query: 382  YTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIM 441
            YTGTDTRQAMNT+ SSVKTGLLELEINSLSKILC CVF LSI+LV   G  +  WYVDIM
Sbjct: 403  YTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIM 462

Query: 442  RYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKT 501
            RYLILFSTIIPVSLRVNLDLGKSVYARQIE D +IPDTIVRTSTIPEDLGRIEYLLSDKT
Sbjct: 463  RYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKT 522

Query: 502  GTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELV--XXXXXXXXXXXXAKKDLPNRVR 559
            GTLTQNDMQL+K+HLGTVSYTM+TMD+VTDY+Q L               ++K++  RVR
Sbjct: 523  GTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVR 582

Query: 560  DLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSA 619
            DLVVTLA CHNVTP FED EL YQAASPDEIAIVKFTE VGLSLFKRDRHS++LFH++S 
Sbjct: 583  DLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSG 642

Query: 620  TNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNM 679
             N +YDIL VFPF SDTKRMGIIV D+ K E WF+QKGADTVM++IVQSNDWL+EEV NM
Sbjct: 643  VNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNM 702

Query: 680  AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTG 739
            AREGLRTLVI RKKLS + YEQF KEY DASLSMLNRDE M+ V+K+HLEHNLELLGLTG
Sbjct: 703  AREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTG 762

Query: 740  VEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPE 799
            VEDKLQ DVK+SIELLRNAGVKIWMLTGDKVETARCV +SAKLISRGQYVHT+TKL+R +
Sbjct: 763  VEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRD 822

Query: 800  GALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVAL 859
            GAL+ LEYLK N++SCLLIDG+SL +++++Y+ EFF+IV+ LP VIACRCTPQQKADVAL
Sbjct: 823  GALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVAL 882

Query: 860  LIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLW 919
            LIRE+TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+S+TQFCHLTKLLLW
Sbjct: 883  LIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLW 942

Query: 920  HGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVF 979
            HGRNSYKRSAKL+QFVIHRGL+ISVCQAVYS+ S  +PIALYQGWLMVGYATCYTMAPVF
Sbjct: 943  HGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVF 1002

Query: 980  SLTLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDE 1039
            SLTLDHDIDESLTK YPELYKELT G SLSYKTFFVWVILSLFQG  IQG SQ F  +  
Sbjct: 1003 SLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGS 1062

Query: 1040 VDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFV 1099
              FKK+VALSFTALVINELIMVALEIYTWNKTM I+EIVTF IYV+S+P L EYFDLT +
Sbjct: 1063 EVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSM 1122

Query: 1100 SQLPFYAKLIFILAVSVFPVWAAKAIHRKINPPNYAKVQQFSTI 1143
              LPF+ +L  IL VS+FPVWAAK IHR++ PP++AKVQQFS +
Sbjct: 1123 LALPFFIQLTIILTVSIFPVWAAKTIHRRLKPPSHAKVQQFSAV 1166

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 1714 bits (4440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 841/1166 (72%), Positives = 968/1166 (83%), Gaps = 41/1166 (3%)

Query: 1    MSFSPPPGSNKLNQAPSSNNGRSSI---DSFDLQFEDSLDAALESLQI-----NNSLNTS 52
            MSFSPPPGS   N+   SN  ++     DSFDLQFEDSLDAALESLQ+         +T 
Sbjct: 1    MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV 60

Query: 53   GENFEMRTIDQDGDDTQSFKHSRVSS---LNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQ 109
             E+FEM+++   GD      HS   +   + + + N  + S  D             N Q
Sbjct: 61   FEDFEMKSMH--GDHQTGMLHSDADTAPLITNHSNNGRMLSNSD------------RNAQ 106

Query: 110  QGSNQSPWSK--------FIRLIKTPTTTDLSKYRSTNS----SIELTDQHVEREIHPDT 157
              +N + WSK        F +    P++  LS Y STNS     IEL D +VEREIHP T
Sbjct: 107  NTNNITVWSKAKSWFEHSFTKAKSKPSS--LSVYSSTNSVDGNKIELNDHNVEREIHPAT 164

Query: 158  TPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSS 217
            TPIYD+ KYPSN ISNAKYNP TFIP+ILYEQFKFFFNLYFL+VALSQAIP LRIGYLSS
Sbjct: 165  TPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSS 224

Query: 218  YIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKG 277
            YIVPLAFVL VTMSKEAMDDI RR+RD+E+NNELYEV+NK   +PSKDLKVGD+IK+ KG
Sbjct: 225  YIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKG 284

Query: 278  TRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSP 337
             R+PAD+V+LQ++EP+GESFIKTDQLDGETDWKLR+ACSLTQ+L+ +DLLN I+ITAS+P
Sbjct: 285  ARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAP 344

Query: 338  EKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSS 397
            E SIH FLGK+TYKDS+S+ LSVDNTMW NTVLAS  +CI C+VYTG +TRQA+NTT S 
Sbjct: 345  EHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSK 404

Query: 398  VKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRV 457
             KTGLLELEIN LSKILCACVF+LSI+LVAFAGF N DWYVDIMRYLILFSTIIPVSLRV
Sbjct: 405  AKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRV 464

Query: 458  NLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG 517
            NLDLGKSVYA +IEHD  I DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG
Sbjct: 465  NLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLG 524

Query: 518  TVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFED 577
            TVSYT +TMDIVTD++Q +              +K++ +RV DLV TLAICHNVTPTFED
Sbjct: 525  TVSYTNETMDIVTDFIQSM--NSRTSNSTPTTTRKNISDRVIDLVTTLAICHNVTPTFED 582

Query: 578  GELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTK 637
            GELTYQAASPDEIAIVKFTESVGLSLF+RDRHS+SLFH HS    EYDI  +FPFNSD+K
Sbjct: 583  GELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSK 642

Query: 638  RMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPK 697
            RMG+I++DK+K E+WF+QKGADTVM+ IV  NDWL+EE  NMA EGLRTLVIGRKKLS  
Sbjct: 643  RMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTN 702

Query: 698  SYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRN 757
             +EQF KEY +ASL+M++R+  M +V++K LE++LELLGLTGVEDKLQ DVKSSIELLRN
Sbjct: 703  LFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRN 762

Query: 758  AGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLL 817
            AG+KIWMLTGDKVETARCVSISAKLISRGQYVHTVTK+++PEGAL+ LEYL++N++SCLL
Sbjct: 763  AGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLL 822

Query: 818  IDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGN 877
            IDGESLG++L Y+  EFFDIVV+LP V+ACRCTPQQKADVA+ IR+ TGKRVCCIGDGGN
Sbjct: 823  IDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGN 882

Query: 878  DVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIH 937
            DVSMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLTKLLLWHGRNSYK SAKL+QFVIH
Sbjct: 883  DVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIH 942

Query: 938  RGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPE 997
            RGLIISVCQAVYS+CS FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLT +YPE
Sbjct: 943  RGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPE 1002

Query: 998  LYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINE 1057
            LYKELT G SLS+KTFFVWV LS+FQGC IQ  SQ+FTSL++ DF K+VA+SFTALV+NE
Sbjct: 1003 LYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNE 1062

Query: 1058 LIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVF 1117
            LIMV LEI TWNK M ITE+VT LIY+ S+PFL EYFDL++VS   F  +++ IL +SV 
Sbjct: 1063 LIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFPLRVLVILVISVV 1122

Query: 1118 PVWAAKAIHRKINPPNYAKVQQFSTI 1143
            PVWAAK+I+R++NPPNYAKVQQFS +
Sbjct: 1123 PVWAAKSIYRRLNPPNYAKVQQFSMV 1148

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 1695 bits (4389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 832/1164 (71%), Positives = 958/1164 (82%), Gaps = 52/1164 (4%)

Query: 12   LNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQIN--------NSLNTSG--------EN 55
            ++ +P + N R+S+ S D  FE+S D AL++++IN        NSLN S         EN
Sbjct: 1    MSASPHNLNSRNSV-SLD-SFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDEN 58

Query: 56   FEMRTIDQDGDDTQSFKH--------SRVSSLNDS-AKNTHLSSGRD----TQPLIGTTQ 102
            FEMR++ +D +   +  H        S  S+LN    K  ++S  R     T   IG   
Sbjct: 59   FEMRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVGL 118

Query: 103  EPWSNNQQGSNQSPWSKFIRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYD 162
            + W  N + +  S W  +                  ++S+ L D+H ERE+HP TT +YD
Sbjct: 119  KKWFVNVKTAISSGWKDY------------------STSVALGDEHTEREVHPGTTQVYD 160

Query: 163  KNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPL 222
            ++++PSN +SNAKYN +TF+P +LYEQFKFFFNLYFLLVALSQAIPALRIGYLSSY+VPL
Sbjct: 161  RHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPL 220

Query: 223  AFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPA 282
            AFVL VTM+KEA DDIQRR+RD+ESN ELYEVL + + V SKDLKVGDLIKI KG R+PA
Sbjct: 221  AFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPA 280

Query: 283  DLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIH 342
            DL+LLQSSEPSGE+FIKTDQLDGETDWKLR+AC+LTQNL+ DDLL KI+ITAS+PEKSIH
Sbjct: 281  DLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIH 340

Query: 343  RFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGL 402
             FLG++TYKD++++ L++DNT+WANTVLAS G CIGCV+YTG DTRQAMNTT + VKTGL
Sbjct: 341  SFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGL 400

Query: 403  LELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLG 462
            LELEIN +SKILCACVF+LSI+LV FAG  N DWYVDIMRYLILFSTIIPVSLRVNLDL 
Sbjct: 401  LELEINDISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLA 460

Query: 463  KSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYT 522
            KSVYA QIEHD TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT
Sbjct: 461  KSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYT 520

Query: 523  MDTMDIVTDYVQELVXXXXXXXXX---XXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGE 579
             +T DIV+DY+Q ++                +KD    V DL+ TLAICHNVTPTFED E
Sbjct: 521  TETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDE 580

Query: 580  LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRM 639
            LTYQAASPDEIAIVKFTESVGLSLFKRDRHS+SL H+HS T   YD+L +FPFNSDTKRM
Sbjct: 581  LTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRM 640

Query: 640  GIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSY 699
            GIIVYDK K ++WF+QKGADTVM RIV +NDWL+EE GNMAREGLRTLVIGRKKL+ K Y
Sbjct: 641  GIIVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIY 700

Query: 700  EQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAG 759
            EQF+KEY + S SM NR++ M++ I K+LEH+LELLGLTGVEDKLQ DVKSSIELLRNAG
Sbjct: 701  EQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAG 760

Query: 760  VKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLID 819
            +KIWMLTGDKVETARCVSISAKLISRGQYVH VTKLS+PEGA N LEYLK+NK++CLLID
Sbjct: 761  IKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLID 820

Query: 820  GESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDV 879
            GESLGMFL YY+QEFFD+VV LP VIACRCTPQQKADVAL+IRE+TGKRVCCIGDGGNDV
Sbjct: 821  GESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDV 880

Query: 880  SMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRG 939
            SMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLT+LLLWHGRNSYKRSAKLAQFV+HRG
Sbjct: 881  SMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRG 940

Query: 940  LIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELY 999
            LII++CQAV+SVCS+FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK+YPELY
Sbjct: 941  LIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELY 1000

Query: 1000 KELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELI 1059
            K+LT G SLSYKTFFVWV LS +QG  IQG SQ FTSL E+DF K+VA+ FTAL+ NELI
Sbjct: 1001 KDLTEGKSLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELI 1060

Query: 1060 MVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPV 1119
            MVALEIYTWNKTM+ITEIVT  IYV SVPFL EYFDL ++S L F  +LI IL VS+FPV
Sbjct: 1061 MVALEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPV 1120

Query: 1120 WAAKAIHRKINPPNYAKVQQFSTI 1143
            W  KAI+R++N P+YAKVQ+FST+
Sbjct: 1121 WLTKAIYRRLNLPSYAKVQEFSTV 1144

>Scas_89.1
          Length = 271

 Score =  528 bits (1360), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 253/258 (98%), Positives = 255/258 (98%)

Query: 698 SYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRN 757
           SY++F KEYHDASLSMLN DETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRN
Sbjct: 1   SYDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRN 60

Query: 758 AGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLL 817
           AGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLL
Sbjct: 61  AGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLL 120

Query: 818 IDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGN 877
           IDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGN
Sbjct: 121 IDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGN 180

Query: 878 DVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIH 937
           DVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIH
Sbjct: 181 DVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIH 240

Query: 938 RGLIISVCQAVYSVCSKF 955
           RGLIISVCQAVYSVCSK 
Sbjct: 241 RGLIISVCQAVYSVCSKL 258

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  456 bits (1172), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 340/1050 (32%), Positives = 524/1050 (49%), Gaps = 84/1050 (8%)

Query: 166  YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +      + I  L  V
Sbjct: 202  YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261

Query: 226  LMVTMSKEAMDDIQRRQRDKESNNELYEVLNK--AQLVPSK--DLKVGDLIKIHKGTRIP 281
            L+V+  KE+++D++R   DKE N+ L +VL++   + V  K  D+ VGD+I++     IP
Sbjct: 262  LIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIP 321

Query: 282  ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKI--SITASSPEK 339
            ADL++L SSEP G  +I+T  LDGET+ K++ A   T N   +  L K+   + +  P  
Sbjct: 322  ADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNS 381

Query: 340  SIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVK 399
            S++ + G +T  + S+  LS D  +     L +     G +V+TG +T+   N T + +K
Sbjct: 382  SLYTYEGTMTL-NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIK 440

Query: 400  TGLLELEINSLSKILCACVFVLSIVLVAFAGFGN-----KD-----------------WY 437
               +E  IN   +IL   +F + IVL   +  GN     +D                 ++
Sbjct: 441  RTAVERVINM--QILA--LFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFF 496

Query: 438  VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTIPEDLG 491
             DI+ + ILFS ++P+SL V +++ K   A  I       H+ +   T+VRTS++ E+LG
Sbjct: 497  KDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELG 556

Query: 492  RIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTM----DTMDIVTDYVQELVXXXXXXXXXX 547
            +IEY+ SDKTGTLT+N M+ K + +    Y      D    V D ++             
Sbjct: 557  QIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKM 616

Query: 548  XXAKKDLPNRVRDLVVTLAICHNVTP-TFEDGELTYQAASPDEIAIVKFTESVGLSLFKR 606
               + D    V + +  LA CH V P T  DG + YQAASPDE A+V+    +G     R
Sbjct: 617  TDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIR 676

Query: 607  DRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIV 666
              +SVS+    S    EY +L +  FNS  KRM  I +    G      KGADTV+   +
Sbjct: 677  RPNSVSISTPFSE-QLEYQLLNICEFNSTRKRMSAI-FRMPDGSIKLFCKGADTVILERL 734

Query: 667  QS--NDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMS 721
             S  N ++   + ++   A EGLRTL I  + +  K YE++ K Y  AS +M +R E + 
Sbjct: 735  DSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELD 794

Query: 722  SVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAK 781
                + +EH+L  LG T +EDKLQ  V  +I  L+ AG+K+W+LTGD+ ETA  + +S +
Sbjct: 795  RA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCR 853

Query: 782  LISRGQYVHTVTKLSRP------EGALNALEYLKINK----SSCLLIDGESLGMFLTY-Y 830
            L+S    +  V + ++       +  LNA+E  +I++    S  L+IDG+SLG  L    
Sbjct: 854  LLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDL 913

Query: 831  KQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVG 890
            + +F  I     AVI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVG
Sbjct: 914  EDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 973

Query: 891  IVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYS 950
            I G EG QA+ +ADF++ QF  L KLL+ HG  SY+R +    +  ++ + + + Q  Y 
Sbjct: 974  ISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYV 1033

Query: 951  VCSKFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLS 1009
              + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK    G   S
Sbjct: 1034 FANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFS 1093

Query: 1010 YKTFFVWVILSLFQGCAIQGISQYFTSL--------DEVDFKKLVALSFTALVINELIMV 1061
               F+ WV+   +    +   S  F           +  D        +T  +I  L   
Sbjct: 1094 VTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKA 1153

Query: 1062 ALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPF------YAKLIFILAVS 1115
            AL    W K  ++    + +I+++  PF S  F    VS+  +      Y    F L   
Sbjct: 1154 ALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCI 1213

Query: 1116 VFPVWAA------KAIHRKINPPNYAKVQQ 1139
            V PV+A       K   R  +P +Y  VQ+
Sbjct: 1214 VLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  441 bits (1134), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 333/1068 (31%), Positives = 521/1068 (48%), Gaps = 89/1068 (8%)

Query: 151  REIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPAL 210
            R IH + +       Y  N IS  KYN  TF+P  L+++F  + NL+FL  +  Q +P +
Sbjct: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242

Query: 211  RIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ--LVPSK--DL 266
                  + I  L  VL+V+  KE ++DI+R   DKE NN   E+ ++A    V  +  D+
Sbjct: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302

Query: 267  KVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKL---RVACSLTQNLST 323
            +VGD+I++     IPAD ++L SSEP G  +I+T  LDGET+ K+   RV  +   ++ T
Sbjct: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362

Query: 324  DDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYT 383
               +N   + +  P  S++ + G +T  D     LS D  +     L +     G V++T
Sbjct: 363  LKNMNG-KVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVIFT 420

Query: 384  GTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGN---------- 433
            G +T+   N T + +K   +E  IN   +I+   +F + IVL+  +  GN          
Sbjct: 421  GHETKLLRNATATPIKRTAVEKIINR--QIIR--LFTVLIVLILISSIGNVIMSTADAKH 476

Query: 434  ------------KDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHD------AT 475
                          ++ D + + ILFS ++P+SL V ++L K   A  I  D       T
Sbjct: 477  LSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKT 536

Query: 476  IPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQE 535
               T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  T  V++
Sbjct: 537  DTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVED 596

Query: 536  LVXXXXXXXXXXXXAKKDLPNR----VRDLVVTLAICHNVTPTFE-DGELTYQAASPDEI 590
             +               D  +     + D +  LA CH V P F+ DG + YQAASPDE 
Sbjct: 597  GIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEG 656

Query: 591  AIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGE 650
            A+V+    +G     R  +SV++  + +    EY +L +  FNS  KRM  I +    G 
Sbjct: 657  ALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAI-FRFPDGS 715

Query: 651  HWFMQKGADTVMARIV--QSNDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQFRKE 705
                 KGADTV+   +  ++N +++  + ++   A EGLRTL +  + +S   YE++   
Sbjct: 716  IKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSI 775

Query: 706  YHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWML 765
            Y++A+ ++ NR E +       +E NL L+G T +EDKLQ+ V  +I  L+ AG+KIW+L
Sbjct: 776  YNEAATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVL 834

Query: 766  TGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKIN------------KS 813
            TGD+ ETA  + +S +L+S    +  + + +R +   N LE  KIN            KS
Sbjct: 835  TGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKS 892

Query: 814  SCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGKRVCCI 872
              L+IDG+SLG  L    +++   V  L  AVI CR +P QKA V  +++  +   +  I
Sbjct: 893  LALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAI 952

Query: 873  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLA 932
              G NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+R +   
Sbjct: 953  ASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAI 1012

Query: 933  QFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESL 991
             +  ++   + + Q  Y   + F   ++ + W M  Y   +T+ P F +   D  +   L
Sbjct: 1013 LYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRL 1072

Query: 992  TKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAI----QGISQYFTSLDE----VDFK 1043
             + YP+LYK    G   S   F+ W+I   F    +      I +Y  +L+      D  
Sbjct: 1073 LERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHW 1132

Query: 1044 KLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLP 1103
                  +T  VI  L   AL    W K  +I    + L +++  P  +  F    +S+  
Sbjct: 1133 SWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREY 1192

Query: 1104 F------YAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQQ 1139
            +      Y   +F L + V P++A       K   R   P  Y  +Q+
Sbjct: 1193 YGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQE 1240

>Kwal_26.7070
          Length = 1315

 Score =  433 bits (1114), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 328/1074 (30%), Positives = 522/1074 (48%), Gaps = 91/1074 (8%)

Query: 146  DQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQ 205
            D+   R+I+ +         + SN IS  KYN  TFIP  L+++F  + NL+FL  +  Q
Sbjct: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236

Query: 206  AIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKA----QLV 261
             +P +      + I  L  VL+V+  KE ++D++R Q D E N+   +V ++      L 
Sbjct: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296

Query: 262  PSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA-CSLTQN 320
               ++ VGD+IK++    IPAD++++ SSEP G  +I+T  LDGET+ K++ A    ++ 
Sbjct: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356

Query: 321  LSTDDLLN-KISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGC 379
            +  DDL   +  + +  P  S++ + G +   +  + +LS +  +     L +     G 
Sbjct: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNL-NGKNISLSPEQMVLRGATLRNTAWIYGL 415

Query: 380  VVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGN------ 433
            VV+TG +T+   N T + +K   +E  IN    +    +F + IVL   +  GN      
Sbjct: 416  VVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTS 471

Query: 434  ----------------KDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIP 477
                              ++ DI+ Y ILFS ++P+SL V +++ K   A  I  D  + 
Sbjct: 472  DAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531

Query: 478  D------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTM----DTMD 527
            D      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y      D   
Sbjct: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAA 591

Query: 528  IVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTF-EDGELTYQAAS 586
               D ++                +    + + D +  LA CH V P F EDG + YQAAS
Sbjct: 592  TTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAAS 651

Query: 587  PDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDK 646
            PDE A+V+   S+G     R  +SVS+  +      EY +L +  FNS  KRM  I +  
Sbjct: 652  PDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAI-FRL 710

Query: 647  VKGEHWFMQKGADTVMARIVQS--NDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQ 701
              GE     KGADTV+   +++  N +++  + ++   A EGLRTL +  + ++   Y +
Sbjct: 711  PNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAE 770

Query: 702  FRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVK 761
            ++  Y  AS ++ +R + +     + +E +L LLG T +EDKLQ+ V  +I  L++AG+K
Sbjct: 771  WKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829

Query: 762  IWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKI----------N 811
            +W+LTGD+ ETA  + +S +L+S    +  + +  +     N  E LK            
Sbjct: 830  VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889

Query: 812  KSSCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGKRVC 870
             S  L+IDG+SLG  L    +++   +  L  AVI CR +P QKA V  +++  T   + 
Sbjct: 890  NSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949

Query: 871  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAK 930
             IGDG NDVSMIQ A VGVGI G EG QA+ +ADF++ QF +L KLLL HG  SY+R ++
Sbjct: 950  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQ 1009

Query: 931  LAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 989
               +  ++ + + + Q  Y   + +   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 1010 AILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSS 1069

Query: 990  SLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYF--------TSLDEVD 1041
             L   YP+LYK    G   S + F+ WVI   +        S  F        +  +  D
Sbjct: 1070 RLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETAD 1129

Query: 1042 FKKLVALSFTALVINELIMVALEIYTWNK-------TMVITEIVTFLIYVVSVPFLS--- 1091
                    +T  VI  +   AL    W K         ++  +V F IY   +P  +   
Sbjct: 1130 HWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSK 1189

Query: 1092 EYFDLTFVSQLPFYAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQQ 1139
            EY+ +  VS +  Y    F L   V P +A       K   R   P +Y  VQ+
Sbjct: 1190 EYYGV--VSHV--YGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQE 1239

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  431 bits (1108), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 328/1087 (30%), Positives = 523/1087 (48%), Gaps = 91/1087 (8%)

Query: 132  LSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFK 191
             +KY    ++ +  D    REIH       ++  Y  N IS  KYN  TF+P  L+++F 
Sbjct: 147  FNKYLLRKNTSDGQDSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFS 206

Query: 192  FFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNEL 251
             + NL+FL  +  Q +P +      + I  L  VL+V+  KE+++D++R   D E NN  
Sbjct: 207  KYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSK 266

Query: 252  YEVLNKAQ--LVPSK--DLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGET 307
             E+  +A+   +  +  D+KVGD+I+++    IPAD+++L SSEP G  +I+T  LDGET
Sbjct: 267  AEIYFEAEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGET 326

Query: 308  DWKLRVACSLTQNLSTDDLLNKIS--ITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMW 365
            + K++ A + T  +     L  I   I++  P  S++ + G L   + +   LS +  + 
Sbjct: 327  NLKIKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEM-NGTKIPLSPEQMIL 385

Query: 366  ANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVL 425
                L + G   G V++TG +T+   N T + +K   +E  IN    +    +F + +VL
Sbjct: 386  RGATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVIN----MQIIALFTVLVVL 441

Query: 426  VAFAGFGN----------------------KDWYVDIMRYLILFSTIIPVSLRVNLDLGK 463
            +  +  GN                        ++ D + + ILFS ++P+SL V ++L K
Sbjct: 442  ILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIK 501

Query: 464  SVYARQIEHD------ATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG 517
               A  I  D       T   T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   + 
Sbjct: 502  YYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIA 561

Query: 518  TVSYTM----DTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTP 573
               Y      D      D + E+                D    + + +  LA CH V P
Sbjct: 562  GRCYAEHIPEDKAATFEDGI-EVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIP 620

Query: 574  TFE-DGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPF 632
             F+ DG + YQAASPDE A+V+    +G     R  +SV++         EY +L +  F
Sbjct: 621  EFQADGSIKYQAASPDEGALVEGGALLGYKFLIRKPNSVTILINEEEER-EYQLLNICEF 679

Query: 633  NSDTKRMGIIVY---DKVKGEHWFMQKGADTV-MARIVQS-NDWLD---EEVGNMAREGL 684
            NS  KRM  I     D +K     + KGAD+V + R+ ++ N ++D     + + A EGL
Sbjct: 680  NSTRKRMSAIFRFPDDSIK----LLCKGADSVILERLSETGNFYVDATTRHLEDYATEGL 735

Query: 685  RTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKL 744
            RTL +  K +    Y  + K+Y DA+ ++ +R E + +V ++ +E  L L+G T +EDKL
Sbjct: 736  RTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKL 794

Query: 745  QNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP------ 798
            Q  V  +I  L+ AG+KIW+LTGDK ETA  + +S +L+S    +  +++ ++       
Sbjct: 795  QEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNM 854

Query: 799  EGALNALEYLKINKSS----CLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQ 853
            E  L AL    +++       L+IDG SL   L    +++F  +  +  AVI CR +P Q
Sbjct: 855  EEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQ 914

Query: 854  KADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHL 913
            KA V  +++  T   +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD SV QF  L
Sbjct: 915  KALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFL 974

Query: 914  TKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCY 973
             KLLL HG  SY+R +    +  ++   + + Q  Y   + F   ++ + W M  Y   +
Sbjct: 975  KKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFF 1034

Query: 974  TMAPVFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQ 1032
            T+ P F +   D  ++  L + YP+LYK    G   S   F+ W++   +    +   + 
Sbjct: 1035 TVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTI 1094

Query: 1033 YFTSL--------DEVDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYV 1084
             F           +  D        +T+ VI  L   AL    W K  +     +   ++
Sbjct: 1095 LFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWL 1154

Query: 1085 VSVPFLSEYFDLTFVSQLPF------YAKLIFILAVSVFPVWAA------KAIHRKINPP 1132
            +  P     F    +S+  F      Y    F L + V P +A       K   R   P 
Sbjct: 1155 IFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPE 1214

Query: 1133 NYAKVQQ 1139
            +Y  +Q+
Sbjct: 1215 SYHLIQE 1221

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  407 bits (1045), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 328/1062 (30%), Positives = 517/1062 (48%), Gaps = 107/1062 (10%)

Query: 166  YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +      + I  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 226  LMVTMSKEAMDDIQRRQRDKESNNELYEVLNK--AQLVPSK--DLKVGDLIKIHKGTRIP 281
            L+V+  KE+++D++R   DKE N+   +V +    Q +  K  D+ VGD+I++     IP
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 282  ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKI--SITASSPEK 339
            ADL++L SSEP G  +I+T  LDGET+ K++ A   T  +     L+ +   I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 340  SIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVK 399
            S++ + G +   ++    LS D  +     L +     G V++TG +T+   N T + +K
Sbjct: 374  SLYTYEGTMILHNNRI-PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 400  TGLLELEINSLSKILCACVFVLSIVLVAFAGFGN-------KD---------------WY 437
               +E  IN    +    +F + I L   + FGN       K+               ++
Sbjct: 433  RTAVERVIN----LQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFF 488

Query: 438  VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTIPEDLG 491
             +I+ + ILFS ++P+SL V +++ K   A  I       H+ +   T+VRTS++ E+LG
Sbjct: 489  KNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELG 548

Query: 492  RIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTM---DTMDIVTDYVQELVXXXXXXXXXXX 548
            +IEY+ SDKTGTLTQN M+ K   +    Y     +  D   D   E+            
Sbjct: 549  QIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELL 608

Query: 549  XAKKDLPNRVRDLVVT-LAICHNVTPTF-EDGELTYQAASPDEIAIVKFTESVGLSLFKR 606
                     + D  +T L+ICH V P F E+G + YQAASPDE A+V+    +G     R
Sbjct: 609  HTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIR 668

Query: 607  DRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTV-MARI 665
              +SV++  +       Y++L +  FNS  KRM  I +         + KGADTV + R+
Sbjct: 669  KPNSVTILREDITEEVVYELLNICEFNSTRKRMSAI-FRFPDNSIRLLCKGADTVILERL 727

Query: 666  VQ-SNDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMS 721
               SN ++   + ++   A EGLRTL I  + +    YE++ K Y  A+ +M NR E + 
Sbjct: 728  AATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELD 787

Query: 722  SVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAK 781
             V  + +E  L LLG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + +S K
Sbjct: 788  KV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCK 846

Query: 782  LISRGQYVHTVTKLSRPEGALNALEYLK-INKSS---------CLLIDGESLGMFLTYYK 831
            L+S    +  V + ++     N ++ L+ IN             L+IDG+SLG  L    
Sbjct: 847  LLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDL 906

Query: 832  QEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVG 890
            +EF   +  +  AVI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVG
Sbjct: 907  EEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVG 966

Query: 891  IVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYS 950
            I G EG QA+ +ADF++ QF +L KLLL HG  SY+R ++   +  ++ + + + Q  Y 
Sbjct: 967  ISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYV 1026

Query: 951  VCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKELTAGTSLSY 1010
            + + F   ++ + W +  Y    T AP          + S       L        ++  
Sbjct: 1027 LYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERS------GLLNRDAQSCTVGQ 1080

Query: 1011 KTFFVWVILSLFQGCAIQGISQYFTSLDE--VDFKKLVALSFTALVINELIM-VALE--- 1064
            K  F W   ++F+G AI G    + ++D   +D++   A +      +  +  VA++   
Sbjct: 1081 KGQF-WPA-TIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTS 1138

Query: 1065 -IYTWNKTMVITE-----------------IVTFLIYVVSVPFLS---EYFDLTFVSQLP 1103
             I+   K  +IT                  ++ F IY   +P L+   EY+ +  VS + 
Sbjct: 1139 IIFVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGI--VSHV- 1195

Query: 1104 FYAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQQ 1139
             Y    F     V PV A       K   R   P +Y  VQ+
Sbjct: 1196 -YGSFTFWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQE 1236

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  347 bits (889), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 249/888 (28%), Positives = 432/888 (48%), Gaps = 134/888 (15%)

Query: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321
            K +KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R  + C+ T   
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSS-----SNALSVDNTMWANTVLASVGSC 376
            S D    K  I +  P  +++ + G + +++ +     +  ++++N +     L +    
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIV------------ 424
            +G V++TG DT+  +N+ ++  K   +  E+N    I    +F+L  V            
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578

Query: 425  --------LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638

Query: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY--------- 521
             +  +      ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698

Query: 522  ---TMDTMDIVTD----------------------------YVQELVXXXXXXXXXXXXA 550
                   +D+ T+                            Y +E+             A
Sbjct: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758

Query: 551  KKDLPNRV-RDLVVTLAICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFK 605
              ++  R     ++ LA+CH+V     P     +L  +A SPDE A+V     VG S   
Sbjct: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817

Query: 606  RDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG-------EHWFMQKGA 658
            + +    L  +      E++IL +  FNS  KRM  IV  K+ G           + KGA
Sbjct: 818  KTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIV--KIPGLNPGDEPRALLICKGA 873

Query: 659  DTVM-ARIVQSNDWLDEEV--------GNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDA 709
            D+++ +R+ + +    E +           A EGLRTL I +++LS   YE++ ++Y  A
Sbjct: 874  DSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIA 933

Query: 710  SLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769
            + S+ NR++ +  V+   +E  L LLG T +ED+LQ+ V   IELL  AG+K+W+LTGDK
Sbjct: 934  AASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDK 992

Query: 770  VETARCVSISAKLISRGQYVHTVTKL--------SRPEGALNAL------EYLKINKSS- 814
            VETA  +  S  L++    +  +           S P   ++AL      EY  +  S  
Sbjct: 993  VETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEE 1052

Query: 815  ----------------CLLIDGESL--GMFLTYYKQEFFDIVVDLPAVIACRCTPQQKAD 856
                             ++IDG++L   ++    +++F  +  +  AV+ CR +P QKA 
Sbjct: 1053 EIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAA 1112

Query: 857  VALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKL 916
            V  L+++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D+++ QF +L +L
Sbjct: 1113 VVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARL 1172

Query: 917  LLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMA 976
            +L HGR SYKR A++     ++ +I ++    Y + + F+   LY+   M+ Y   +T  
Sbjct: 1173 VLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL 1232

Query: 977  PVFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023
            PV  L  LD D++++++ + P+LY+        + + F  +++  L+Q
Sbjct: 1233 PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQ 1280

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 104/238 (43%), Gaps = 22/238 (9%)

Query: 26  DSFDLQFEDSLDAALESLQINNSLNTSGENFEMRTIDQDGDDTQSFKHSRVSSLNDSAKN 85
           D+ +  F D  +    S Q    LN     F+   +D D  +     H+      D  K 
Sbjct: 65  DAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEP----HTNY----DGMKR 116

Query: 86  THLSSGRDTQ--PLIGTTQE-PWSNNQQGSNQSPWSKFIRLIKTPTTTDLSK-YRSTNSS 141
             + + R+ +  P++G ++   W+   + +  +P+  F +    P   + ++  R+   +
Sbjct: 117 FRMGTKRNKKGNPIMGRSKTLKWA---RKNIPNPFEDFTKDDIDPGAINRAQELRTVYYN 173

Query: 142 IELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLV 201
           + L    ++ E +P         +YP N I   KY P+TF+P  +  QF  F N+YFL++
Sbjct: 174 MPLPKDMIDEEGNPIM-------QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVL 226

Query: 202 ALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ 259
            +  A     +       VPL  ++++T  K+A++D +R   D E NN    +L   +
Sbjct: 227 IILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVE 284

>Scas_636.16
          Length = 1554

 Score =  343 bits (880), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 267/960 (27%), Positives = 459/960 (47%), Gaps = 149/960 (15%)

Query: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL-- 321
            K+++VGD+++IH    IPAD++LL +S+  G  +++T  LDGE++ K+R +   T  +  
Sbjct: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDS-----SSNALSVDNTMWANTVLASVGSC 376
            S D    K  + +  P  +++ + G L + DS      +  ++++N +     L +    
Sbjct: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVA--------- 427
            +G VV+TG DT+  +N  ++  K   +  E+N    +L   VF+  + L+A         
Sbjct: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLFILCLIAGVANGAYYR 555

Query: 428  -------------FAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDA 474
                          AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615

Query: 475  TIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYT------ 522
             + +  +      ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY       
Sbjct: 616  LLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEA 675

Query: 523  ---------MDT--------------MDIVTDYVQELVXXXXXXXXXXXXAKKDLPN--- 556
                     +DT               +I+ D ++++               K+      
Sbjct: 676  LAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLL 735

Query: 557  ---------RVRDLVVTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLSLF 604
                     R +  ++ LA+CH+V   P   D  +L   A SPDE A+V     +G S  
Sbjct: 736  GNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFI 795

Query: 605  KRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVY-----DKVKGEHWFMQKGAD 659
             + +    L  +      E+ IL +  FNS  KRM  IV      +K +     + KGAD
Sbjct: 796  GKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGAD 853

Query: 660  TVM-ARIVQSNDWLDE--------EVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDAS 710
            +V+ +R+ +   + DE         +   A EGLRTL +G++++S   Y+++ ++Y+ A+
Sbjct: 854  SVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAA 913

Query: 711  LSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKV 770
             S+  R+E +  V    +E +L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGDKV
Sbjct: 914  ASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 972

Query: 771  ETARCVSISAKLISRGQYVHTVTKLSR--------PEGALNAL--EYL--KINKSS---- 814
            ETA  +  S  L++    +  +             P   +NAL  +YL  K N +     
Sbjct: 973  ETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEE 1032

Query: 815  ---------------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVIACRCTPQQKADV 857
                            ++IDGE+L + LT    K++F  +  +  AV+ CR +P QKA V
Sbjct: 1033 LAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1092

Query: 858  ALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLL 917
              L+++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+++ QF ++T+L+
Sbjct: 1093 VKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1152

Query: 918  LWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAP 977
            L HG+  YKR A++     ++ +I ++    Y V + F+   L++   +  Y   +T  P
Sbjct: 1153 LVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP 1212

Query: 978  VFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTS 1036
            V  L  LD D+  +++ I P+LY+        + +T F+W    +F G     I  +F  
Sbjct: 1213 VIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWY---MFDGIYQSVICYFFPY 1268

Query: 1037 LD------------EVDFKKLVALSFTALVINEL-IMVALEIYTWNKTMVITEIVTFLIY 1083
            L              +D +  V +  T + +      V +E Y W+        ++ ++Y
Sbjct: 1269 LIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVY 1328

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 7/126 (5%)

Query: 134 KYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFF 193
           ++R+   ++ L D+     ++ D  PI +   YP N I   KY P+TF P  +  QF  F
Sbjct: 143 EFRTIYHNMPLPDEM----LYEDGLPIME---YPRNKIRTTKYTPLTFFPKNVMLQFNNF 195

Query: 194 FNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYE 253
            N+YFL++ +  A     +       VPL  ++++T  K+A++D +R   D E NN    
Sbjct: 196 ANIYFLIMIILGAFQIFGVTNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTH 255

Query: 254 VLNKAQ 259
           +L   +
Sbjct: 256 ILQGPE 261

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  340 bits (873), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 256/888 (28%), Positives = 432/888 (48%), Gaps = 134/888 (15%)

Query: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA--CSLTQNL 321
            K +KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R A  CS     
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-----SVDNTMWANTVLASVGSC 376
            S D    +  I +  P  +++ + G L +KDS++N L     +++N +     L +    
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIV------------ 424
            +G VV+TG DT+  +N  ++  K   +  E+N    I    +F+L  +            
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 425  --------LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVS----YT---- 522
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VS    YT    
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694

Query: 523  ---------------------MDTMDIVTDYVQELVXXXXXXXXXXXXAKK----DLPNR 557
                                     D++ + ++ L               K    D   R
Sbjct: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754

Query: 558  VRDL--------VVTLAICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFK 605
              D+        ++ LA+CH+V    +PT    +L  +A SPDE A+V     +G     
Sbjct: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813

Query: 606  RDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG-------EHWFMQKGA 658
            + +  + +  Q      E++IL +  FNS  KRM  I+  K+ G           + KGA
Sbjct: 814  KTKTGMVVEIQ--GIQKEFEILNILEFNSARKRMSCII--KIPGATPNDEPRALLICKGA 869

Query: 659  DTVM-----ARIVQSNDWLDEEVG----NMAREGLRTLVIGRKKLSPKSYEQFRKEYHDA 709
            D+V+      +  ++++ L E+        A EGLRTL + +++L+   Y ++   Y  A
Sbjct: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929

Query: 710  SLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769
            + S+ NR+E +  ++   +E +L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGDK
Sbjct: 930  AASLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDK 988

Query: 770  VETARCVSISAKLISR-----------------GQYVHTV-----TKLSRPEGALNALEY 807
            VETA  +  S  L++                  G+  H V     +K  R +  L+  E 
Sbjct: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEM 1048

Query: 808  LKINKSS---------CLLIDGESLGMFLTY--YKQEFFDIVVDLPAVIACRCTPQQKAD 856
               N             ++IDG++L + LT    K++F  +  +  AV+ CR +P QKA 
Sbjct: 1049 ELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAA 1108

Query: 857  VALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKL 916
            V  L++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D+++ QF +LT+L
Sbjct: 1109 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRL 1168

Query: 917  LLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMA 976
            LL HGR SYKR +++     ++ +I ++    Y + + F+   L++   ++ Y   +T  
Sbjct: 1169 LLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSI 1228

Query: 977  PVFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023
            PV  L  LD D++++++ + P+LY+        +   F  ++   L+Q
Sbjct: 1229 PVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQ 1276

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 114/270 (42%), Gaps = 32/270 (11%)

Query: 2   SFSPPPGSNKLNQAPSSNNGRSS----------IDSFDLQFEDSLDAALESLQINNSLNT 51
           +F    G N +N + S+ NG +S          ++  +    D  D  + S+Q    L  
Sbjct: 20  AFEFEEGDNTVNNSSSNGNGHTSGSGNWNDGHKMEEKETTLADDTDIEISSIQPTPHLGG 79

Query: 52  SGEN-FEMRTIDQD--GDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLIGTTQEPWSNN 108
           +    F+   +D D   D ++  K  R+ +       +   +    + L       W+  
Sbjct: 80  AKTGMFDDVALDNDDHNDSSREMKRLRMGTRRVKGHKSQFGNMSRNKTL------KWA-- 131

Query: 109 QQGSNQSPWSKFIRLIKTP---TTTDLSKYRSTNSSIELTDQHVEREIHPDTTPIYDKNK 165
            + + ++P+  F R  +     +T    + R+   ++ L ++ ++ E +P         +
Sbjct: 132 -KKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIM-------E 183

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           YP N I   KY P++F P  L  QF+ F N+YFL++ +  A     +       VPL  +
Sbjct: 184 YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVI 243

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVL 255
           +++T  K+ ++D +R   D E NN    +L
Sbjct: 244 VIITAIKDGIEDSRRTILDLEVNNTRTHIL 273

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  338 bits (868), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 251/889 (28%), Positives = 439/889 (49%), Gaps = 137/889 (15%)

Query: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL-- 321
            K++KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R +   T ++  
Sbjct: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-----SVDNTMWANTVLASVGSC 376
            S D    +  I +  P  +++ + G   +     N L     +++N +     L +    
Sbjct: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAG-FGNK- 434
            +G V +TG DT+  +N  ++  K   +  E+N       A +FVL  +   + G + NK 
Sbjct: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585

Query: 435  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 586  PRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645

Query: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVS----YTMDTM 526
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VS    YT    
Sbjct: 646  YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 705

Query: 527  DIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDL------------------------- 561
             +      ++              ++++ N++++L                         
Sbjct: 706  GLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765

Query: 562  ------------VVTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLSLFKR 606
                        ++ LA+CH+V   P+ ED  +L  +A SPDE A+V     +G S  K+
Sbjct: 766  SGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKK 825

Query: 607  DRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEH-------WFMQKGAD 659
             +  + L  Q      E+ IL +  FNS  KRM  IV  K+ G+          + KGAD
Sbjct: 826  TKEGMVLEVQ--GIEKEFQILNILEFNSSRKRMSCIV--KIPGDDANGKPKALLICKGAD 881

Query: 660  TVM-ARIVQSNDWLDEE---------VGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDA 709
            +V+ +R+ ++   L+EE         +   A EGLRTL + +++LS + YE++ K+Y  A
Sbjct: 882  SVIYSRLDKTG--LNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIA 939

Query: 710  SLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769
            + ++++R+E +  V    +E +L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGDK
Sbjct: 940  AAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDK 998

Query: 770  VETARCVSISAKLISRGQYVHTVTKLSRPE------------------------GALNAL 805
            VETA  +  S  L++    +  V K + P+                        G   + 
Sbjct: 999  VETAINIGFSCNLLNNDMEL-LVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSE 1057

Query: 806  EYLKINKSS--------CLLIDGESLGMFLTY--YKQEFFDIVVDLPAVIACRCTPQQKA 855
            E LK  K+          ++IDGE+L   L+    K++F  +  +  +V+ CR +P QKA
Sbjct: 1058 EELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKA 1117

Query: 856  DVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTK 915
             V  L++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D+++ QF +LT+
Sbjct: 1118 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTR 1177

Query: 916  LLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTM 975
            LLL HG+  YKR A++     ++ +I ++    + + + ++   L++   +  Y   +T 
Sbjct: 1178 LLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTS 1237

Query: 976  APVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023
             PV  L + D D+ ++++ ++P+LY+        S   F  +++  L+Q
Sbjct: 1238 IPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQ 1286

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 3/100 (3%)

Query: 156 DTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYL 215
           D  P+ +   YP N I   KY P+TF+P  +  QF  F N+YFL++ +  A     +   
Sbjct: 189 DNKPLAN---YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNP 245

Query: 216 SSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVL 255
               VPL  ++++T  K+ ++D +R   D E NN    VL
Sbjct: 246 GFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVL 285

>Scas_576.8
          Length = 1591

 Score =  337 bits (864), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 253/889 (28%), Positives = 430/889 (48%), Gaps = 132/889 (14%)

Query: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321
            K++KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R  + CS +   
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-----SVDNTMWANTVLASVGSC 376
            S D    K  + +  P  +++ + G + + DS    L     +++N +     L +    
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEIN---SLSKILCACVFVLSIVLVAF----- 428
            +G VV+TG DT+  +N+  +  K   +  E+N   SL+ +    +  +S ++        
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKH 594

Query: 429  ------------AGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
                        AG  + + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 595  PRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 654

Query: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVS----YT---- 522
             +  +      ++  I +D+G+IEY+ SDKTGTLTQN M+ KK  +  +S    YT    
Sbjct: 655  YNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALA 714

Query: 523  ------------------------MDTM-DIVTD-------YVQELVXXXXXXXXXXXXA 550
                                     DTM + + +       Y  ++             A
Sbjct: 715  GLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGA 774

Query: 551  KKDLPNRV-RDLVVTLAICHNV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLSLFKR 606
              D+  +     ++ LA+CH+V   P   D + L  +A SPDE A+V     VG S   +
Sbjct: 775  SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGK 834

Query: 607  DRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEH-------WFMQKGAD 659
             +    L  +      E+ IL    FNS  KRM  IV  K+ G +         + KGAD
Sbjct: 835  TK--TGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIV--KIPGANPDDEPRALLICKGAD 890

Query: 660  TVMARIVQSNDWLDEE---------VGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDAS 710
            +++   + + +  + E         +   A EGLRTL I +++LS   Y ++ K Y  A+
Sbjct: 891  SIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAA 950

Query: 711  LSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKV 770
             S+ NR+E + +V    +E  L LLG T +ED+LQ+ V  SI +L  AG+K+W+LTGDKV
Sbjct: 951  ASVTNREEQLEAV-SDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKV 1009

Query: 771  ETARCVSISAKLI----------SRGQYVHT------------VTKLSRPEGALNA--LE 806
            ETA  +  S  L+          + G  V              +TK  R +  L    +E
Sbjct: 1010 ETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEME 1069

Query: 807  YLKINKSS-------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVIACRCTPQQKADV 857
                 K+         ++IDGE+L + L     +++F  +  +  AV+ CR +P QKA V
Sbjct: 1070 LADAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAV 1129

Query: 858  ALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLL 917
              L+          IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+++ QF +LT+L+
Sbjct: 1130 VKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLV 1189

Query: 918  LWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAP 977
            L HGR SY+R A++     ++ +I ++    Y + + F+   L++   ++ Y   +T  P
Sbjct: 1190 LVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLP 1249

Query: 978  V-FSLTLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGC 1025
            V F   +D D+ ++++ + P+LY+        +   F  +++  L+Q C
Sbjct: 1250 VIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSC 1298

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 153 IHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRI 212
           +  D  PI D   YP N I   KY+P+ F P  +  QF+ F N+YFL++ +  A     +
Sbjct: 191 VDEDGKPITD---YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGV 247

Query: 213 GYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVL 255
                  VPL  ++++T  K+A++D +R   D E NN    +L
Sbjct: 248 TNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHIL 290

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  326 bits (835), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 258/885 (29%), Positives = 437/885 (49%), Gaps = 139/885 (15%)

Query: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321
            K++KVGD++++H    IPAD++LL +S+  G  +++T  LDGET+ K+R  + CS     
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSN-----ALSVDNTMWANTVLASVGSC 376
            S D    K  + +  P  +++ + G   ++D+ +       ++++N +     L +    
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDW 436
            +G V++TG DT+  +N  ++  K   +  E+N  S IL    FVL  +L   AG  N  +
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619

Query: 437  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEH 472
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679

Query: 473  DATIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVS----YT 522
            D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VS    YT
Sbjct: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739

Query: 523  --------MDTMDIVTDYVQE----------LVXXXXXXXXXXXXAKKDLPNRVRDLV-- 562
                       +D+ ++  +E          ++              +DL    +++V  
Sbjct: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799

Query: 563  -----------------VTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLS 602
                             + LA+CH+V   P  +D  +L  +A SPDE A+V     +G S
Sbjct: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859

Query: 603  LFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG-------EHWFMQ 655
                 +    L  +      E+ +L V  FNS  KRM  I+  K+ G       +   + 
Sbjct: 860  FVGSSKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCII--KIPGSTPKDEPKALLIC 915

Query: 656  KGADTVM-ARI--VQSNDWLDEEVG----NMAREGLRTLVIGRKKLSPKSYEQFRKEYHD 708
            KGAD+V+ +R+   Q++  L E+        A EGLRTL + +++L+   YE++ K Y  
Sbjct: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975

Query: 709  ASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGD 768
            A+ S+ NR+E +  V    +E  L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGD
Sbjct: 976  AAASVTNREEELDKVTDV-IERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGD 1034

Query: 769  KVETARCVSISAKLISR----------GQYV------------HTVTKLSRPE-GALNAL 805
            KVETA  +  S  +++           G+ V            + VTK  R + G   + 
Sbjct: 1035 KVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSE 1094

Query: 806  EYLKINKSS--------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVIACRCTPQQKA 855
            E LK  K           ++IDG++L + L     +++F  +  +  AV+ CR +P QKA
Sbjct: 1095 EELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKA 1154

Query: 856  DVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTK 915
             V  L+++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+++ QF ++T+
Sbjct: 1155 AVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTR 1214

Query: 916  LLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTM 975
            L+L HG+  YKR A++     ++ +I ++    Y + + F+   L++   +  Y   +T 
Sbjct: 1215 LVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTS 1274

Query: 976  APVFSLT-LDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVIL 1019
             PV  L  LD D+ ++++ + P+LY+        + +T F+W +L
Sbjct: 1275 VPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYML 1318

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           YP N I   KY P+TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVLN 256
           +++T  K+ ++D +R   D E NN    +L+
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  235 bits (600), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 276/514 (53%), Gaps = 55/514 (10%)

Query: 560  DLVVTLAICHNV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQ 616
            + ++ LA+CH V      +D E + ++A SPDE A+V     +G S   R ++ V +  Q
Sbjct: 814  NFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQ 873

Query: 617  HSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEH-------WFMQKGADTVM-ARIVQS 668
                  EY +L V  FNS  KRM  I+  K+  E+         + KGAD+++ +R+ ++
Sbjct: 874  --GVQKEYRLLNVLEFNSTRKRMSCIL--KIPSENPNEEPRALLICKGADSIIYSRLSKN 929

Query: 669  ND--WLDE---EVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSV 723
            ND   L++    +   A EGLRTL I +++LS K Y+++ +++  A+ ++++R++ M  V
Sbjct: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989

Query: 724  IKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLI 783
                +E  L LLG T +ED+LQ+ V  SI  L  AG+K+W+LTGDKVETA  +  S  L+
Sbjct: 990  ADV-IERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLL 1048

Query: 784  SRGQYVHTVTKL--------SRP------------------EGALNALEYLK-----INK 812
            +    +  +           S+P                   G+   LE  K        
Sbjct: 1049 NNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTG 1108

Query: 813  SSCLLIDGESLGMFLTY--YKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVC 870
            +  ++IDG++L + L     K+EF  +     AV+ CR +P QKA V  L++        
Sbjct: 1109 NFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTL 1168

Query: 871  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAK 930
             IGDG NDV+MIQ AD+GVGI G+EG+QA +++D+++ QF +LT+L+L HGR SYKR A+
Sbjct: 1169 AIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAE 1228

Query: 931  LAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 989
            +     ++ +I ++    Y V + ++   L++   +  +   +T  PV  L  LD D+++
Sbjct: 1229 MIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVND 1288

Query: 990  SLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023
             ++ + P+LY+     +  +   F++++  +++Q
Sbjct: 1289 IVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQ 1322

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 149/291 (51%), Gaps = 33/291 (11%)

Query: 264 KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321
           K + VGD++++H    IPAD++LL SS+  G  +++T  LDGET+ K+R  + CS     
Sbjct: 444 KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 322 STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSN-----ALSVDNTMWANTVLASVGSC 376
           S +    K  + +  P  +++ + G L + D  +       ++++N +     L +    
Sbjct: 504 SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563

Query: 377 IGCVVYTGTDTRQAMNTTMSSVKTGLLELEIN-------SLSKILCACVFVLSIV----- 424
           +G VV+TG DT+  +N  ++  K   +  E+N       +L  +LC    +++ V     
Sbjct: 564 MGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTD 623

Query: 425 --------LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
                     + AG    +  V     LIL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 624 NTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVAL 683

Query: 477 PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY 521
            +  +      ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY
Sbjct: 684 YNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 734

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 110/258 (42%), Gaps = 33/258 (12%)

Query: 54  ENFEMRTIDQDG-DDTQSFKHS--------RVSSLNDSAKNTHLSSGRDTQPL----IGT 100
           E FE  + +  G DD +S+ ++         V   ++  K+  LSS  D++ +     GT
Sbjct: 100 EEFEEISFETTGADDQRSYVNTPIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGT 159

Query: 101 TQEPWSNNQQGSNQS-PWSKFIRLIKTPTTTDLSKYRSTNSSIELTDQ-----HVEREIH 154
            ++       G  ++  W+K  +    P   D +     +SS +  D+     H +RE  
Sbjct: 160 RRDKKGKPAMGRAKTLRWTK--KNFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETR 217

Query: 155 ------PDTTPIYDKNK-----YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVAL 203
                 P    I D++      YP N I   KY P+TF P  +  QFK   N+YFL++ +
Sbjct: 218 TIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLII 277

Query: 204 SQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPS 263
                   +       VPL  ++++T  K+A++D +R   D E NN    +L   + V  
Sbjct: 278 MGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNV 337

Query: 264 KDLKVGDLIKIHKG-TRI 280
            + KV    K  K  TR+
Sbjct: 338 SNDKVSLWRKFKKANTRV 355

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  232 bits (592), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 165/515 (32%), Positives = 267/515 (51%), Gaps = 52/515 (10%)

Query: 558  VRDLVVTLAICHNVTPTFEDG---ELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLF 614
            V   +++LA+CH+V          +L  +A SPDE A+V+    +G S   R ++ V + 
Sbjct: 774  VEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVIIE 833

Query: 615  HQHSATNFEYDILQVFPFNSDTKRMGIIVY-----DKVKGEHWFMQKGADTVM-ARIVQS 668
             Q      E+ IL V  FNS  KRM  IV      +  K +   + KGAD+V+ +R+ +S
Sbjct: 834  IQ--GVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRS 891

Query: 669  -ND--WLDE---EVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSS 722
             ND   L+     +   A EGLRTL + ++++    Y  + +    A+ S+ NR+E +  
Sbjct: 892  RNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALER 951

Query: 723  VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 782
            V    +E  L LLG T +ED+LQ+ V  SI +L +AG+K+W+LTGDKVETA  +  S  L
Sbjct: 952  VADA-IERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNL 1010

Query: 783  I----------SRGQYV---------------------HTVTKLSRPEGALNALEYLKIN 811
            +          S G+ V                     H   K S  E A    ++    
Sbjct: 1011 LGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTPPQ 1070

Query: 812  KSSCLLIDGESLGMFL--TYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRV 869
             +  ++IDG++L + L     +++F  +  +  AV+ CR +P QKA V  L++E      
Sbjct: 1071 SAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVT 1130

Query: 870  CCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSA 929
              IGDG NDV+MIQ ADVG+GI G+EG+QA ++AD+++ QF +LT+L+L HGR SYKR A
Sbjct: 1131 LAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYKRLA 1190

Query: 930  KLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDID 988
            ++     ++ +  ++    + +CS ++   L++   ++ Y   +T  PV  L  +D D  
Sbjct: 1191 EMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQDAS 1250

Query: 989  ESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023
            + L+ + P+LYK     T  +   F+ +    ++Q
Sbjct: 1251 DVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQ 1285

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 150/295 (50%), Gaps = 41/295 (13%)

Query: 264 KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321
           KD++VGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R  + CS     
Sbjct: 406 KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 322 STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-----SVDNTMWANTVLASVGSC 376
           S D    K  + +  P  +++ + G   + DS +  +     +++N +     L +    
Sbjct: 466 SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 377 IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDW 436
           +G V++TGTDT+  +N  ++  K   +  E+N  S IL    FV   VL   AG  N  +
Sbjct: 526 MGIVMFTGTDTKIMLNAGVTPTKRSRISRELN-YSVILN---FVFLFVLCLAAGLVNGIY 581

Query: 437 Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEH 472
           Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582 YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 473 DATIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY 521
           D  + +  +      RT  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY
Sbjct: 642 DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 696

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           YP N I   KY P++F+P  L  QFK   N+YFLL+     +    +   +   +PL  +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ 259
           +++T  K+A +D +R   D E NN    +L+  +
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHILHGVE 296

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  218 bits (555), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 159/470 (33%), Positives = 240/470 (51%), Gaps = 28/470 (5%)

Query: 674  EEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLE 733
            E++ + + EGLRTL+   K +S + +EQ+R  YH+A  S+  R + +  V    +E  L 
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEV-GAQIEDELY 1021

Query: 734  LLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVT 793
            LLG T +EDKLQ  V  +IE +R AG+K+WMLTGDK ETA  +  S KLI    Y   V 
Sbjct: 1022 LLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH--DYSTVVI 1079

Query: 794  KLSRPEG---ALNAL--EYLKINKSSCLL-IDGESLGMFL--TYYKQEFFDIVVDLPAVI 845
              +  E     +NA+  E    N + C++ IDG +L MF         F ++     +V+
Sbjct: 1080 LTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVV 1139

Query: 846  ACRCTPQQKADVALLIREITGKRVC--CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 903
             CR +P QKA +   IR  T K +    IGDG ND++MIQ AD+GVGI GKEG QAS +A
Sbjct: 1140 CCRASPAQKALMVSNIRN-TDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSA 1198

Query: 904  DFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQG 963
            D+S+ QF  + KLLL HGR +Y R+AK      ++ L   + Q +Y   + F   +LY+ 
Sbjct: 1199 DYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEP 1258

Query: 964  WLMVGYATCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLF 1022
            W +  Y T +T  PV  + + + D+        PELY       + ++  F  WV L   
Sbjct: 1259 WSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTA 1318

Query: 1023 QGCAI---QGISQYFTSLDEVDFKKLVALSFTALV--IN-ELIMVALEIYTWNK-TMVIT 1075
                I     ++   TSL +     L  ++F+A V  IN +   + +    W   T VI 
Sbjct: 1319 NALIITFLNIVAWGETSLSDNTLYPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVIL 1378

Query: 1076 EIVTFLIYVVSVPFLSE---YFDLTFVSQLPFYAKLIFI---LAVSVFPV 1119
                +L++  ++P L+     +D+T+     F   + F    L ++V P+
Sbjct: 1379 SCGGWLVWCCALPILNRSDGIYDVTYGLYHHFGRDITFWCTSLILAVLPI 1428

 Score =  181 bits (458), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 132/440 (30%), Positives = 215/440 (48%), Gaps = 73/440 (16%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           Y +N I++++Y  I+F P  LY QF    N+YF +VA+ Q IP        + IVPL   
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVL--------------NKAQLVPS-------- 263
           + ++M++EA DD +R + DKE NN+L +VL              N AQ   +        
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESISNL 242

Query: 264 ---------------------KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQ 302
                                KD++VGD + + +   +PAD+++L S   + E FI+T  
Sbjct: 243 YFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMA 302

Query: 303 LDGETDWKLRVACSLTQNL--STDDLLN-KISITASSPEKSIHRFLGKLTYKDSSSNA-- 357
           LDGET+ K +V       L  S   L N    +T   P   ++ F G L     SS+   
Sbjct: 303 LDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKK 362

Query: 358 --LSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMS-SVKTGLLELEINSLSKIL 414
             L  DN ++  +++ +  +C+G V++TG +++  MN   +   K   L+ +IN +   +
Sbjct: 363 YPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFM 422

Query: 415 C---ACVFVLS----IVLVAFAGFGNKDWYV---------DIMRYLILFSTIIPVSLRVN 458
               AC+ + S     + +      NK WY+          IM ++I+++TIIP+SL V 
Sbjct: 423 VFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAGTAPTIMSFIIMYNTIIPLSLYVT 482

Query: 459 LDLGKSVYARQIEHDATI----PDT--IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLK 512
           ++L K   +R +E D  +     DT   VRT+TI E+LG++ Y+ SDKTGTLT N M  +
Sbjct: 483 MELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFR 542

Query: 513 KLHLGTVSYTMDTMDIVTDY 532
           KL     S+  +    ++++
Sbjct: 543 KLSFCGTSWVHNATQDISEF 562

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 22/157 (14%)

Query: 557 RVRDLVVTLAICHNVTPTF------EDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 610
           + +  +++LAICH   P        ED  + YQ++SPDE+A+V     +G  ++ R+ + 
Sbjct: 674 KAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANI 733

Query: 611 VSL------FHQHSATNFE-YDILQVFPFNSDTKRMGIIV-YDKVKGEHWFMQKGADTVM 662
           ++L      F +     FE ++IL++  FNS  KRM +IV   + K       KGAD V+
Sbjct: 734 LTLKTFPDGFDE--LPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVI 791

Query: 663 ARIVQSN----DWLDEEVGNMA--REGLRTLVIGRKK 693
              + +     D LD+   N    ++    LVI  +K
Sbjct: 792 LERLHNKEMALDMLDQVENNTKYRKDAEAELVIQHRK 828

>Kwal_23.3556
          Length = 1597

 Score =  211 bits (538), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/394 (34%), Positives = 209/394 (53%), Gaps = 16/394 (4%)

Query: 674  EEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLE 733
            + + + +  GLRTL+   K +  + YE++ K+YH A  S+ NR E M SV  + +E +L 
Sbjct: 962  QAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSV-GELVETSLH 1020

Query: 734  LLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVT 793
            LLG T +EDKLQ  V  +I+ +R AG+K+WMLTGDK ETA  +  S  LI    Y   V 
Sbjct: 1021 LLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIH--DYSTVVI 1078

Query: 794  KLSRPEGALNAL-----EYLKINKSSCLL-IDGESLGMFLT--YYKQEFFDIVVDLPAVI 845
              ++ E   + L     E  + N + C++ IDG +L  F +       F ++     +VI
Sbjct: 1079 LSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSVI 1138

Query: 846  ACRCTPQQKADVALLIREITGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD 904
             CR +P QKA +   IR    K V   IGDG ND++MIQ AD+GVGI GKEG QAS ++D
Sbjct: 1139 CCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSD 1198

Query: 905  FSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGW 964
            +S+ QF  L KLLL HGR +Y R+ K      ++ L+  + Q +Y   + F   +LY+ W
Sbjct: 1199 YSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPW 1258

Query: 965  LMVGYATCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023
             +  + T +T  PV  + + + D+        PELY       S + + F  W+ L+   
Sbjct: 1259 SLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALN 1318

Query: 1024 GCAIQGISQYF---TSLDEVDFKKLVALSFTALV 1054
               I  ++      +SL +     +  ++FTA++
Sbjct: 1319 SLIITFLNWKIWAVSSLSDNTVYPIGVINFTAII 1352

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 123/458 (26%), Positives = 203/458 (44%), Gaps = 109/458 (23%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           Y SN I++++Y   TF+P  LY QF    N YF LVA+ Q IP        + IVPL   
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 226 LMVTMSKEAMDDIQ-----RRQRDKESN---------------NELYEVLNKAQLVPS-- 263
           + ++MS+EA DD +     R + DK +                N LY +    Q   S  
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTS 227

Query: 264 ----------------------------------------KDLKVGDLIKIHKGTRIPAD 283
                                                   KD+KVGD + + +   +PAD
Sbjct: 228 MLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPAD 287

Query: 284 LVLLQSSEPSGESFIKTDQLDGETDWK-----------LRVACSLTQNLSTDDLLNKISI 332
           +++L  S+   E F++T  LDGET+ K           ++ A  LT+         K  +
Sbjct: 288 MLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTE--------FKAKV 339

Query: 333 TASSPEKSIHRFLGKLT-YKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAM 391
           T   P   +H F G L    ++    +  D+ ++  +++ +  + +G VV+TG +T+  M
Sbjct: 340 TVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRM 399

Query: 392 NTTMS-SVKTGLLELEINSLSKILCACVFVLSIVLVAFAGF---------GNKDWYV--- 438
           N   +  +K   L+  IN +  +L     V S+ L +  G           N+ WY+   
Sbjct: 400 NAIKNPRIKAPKLQRAINLI--VLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNS 457

Query: 439 ------DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTI 486
                  +M ++I+++T+IP+SL V +++ K++ ++ +E      H  T      RT+TI
Sbjct: 458 DAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATI 517

Query: 487 PEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMD 524
            E+LG++ Y+ SDKTGTLT N M  + L +   S+  D
Sbjct: 518 LEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHD 555

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 66/131 (50%), Gaps = 11/131 (8%)

Query: 557 RVRDLVVTLAICHNVTPTFEDGE-----LTYQAASPDEIAIVKFTESVGLSLFKRDRHSV 611
           +V   +++LA+CH   P    G      + YQA+SPDE+A+V     +G ++  R+   +
Sbjct: 664 KVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVL 723

Query: 612 SLFHQHSATNFE-----YDILQVFPFNSDTKRMGIIV-YDKVKGEHWFMQKGADTVMARI 665
           ++    +  + E     Y+IL    F+S  KRM ++V     +     + KGAD V+   
Sbjct: 724 TIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICKGADNVILER 783

Query: 666 VQSNDWLDEEV 676
           + ++D  ++++
Sbjct: 784 LHNSDLANQKI 794

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  211 bits (537), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 193/353 (54%), Gaps = 13/353 (3%)

Query: 676  VGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELL 735
            +   + EGLRTL+   K +  + Y+ +  +YH+A  S+ NR   ++ V   H+E +LELL
Sbjct: 944  IDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEV-GGHIETDLELL 1002

Query: 736  GLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTK- 794
            G T +EDKLQ  V  +I+ +R AG+K+WMLTGDK ETA  +  + KLI     V  + K 
Sbjct: 1003 GATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYSTVVILKKN 1062

Query: 795  ----LSRPEGALNALEYLKINKSSCLL-IDGESLGMFLT--YYKQEFFDIVVDLPAVIAC 847
                +S+       L+  KI  + C+L IDG SL +F         F ++     +VI C
Sbjct: 1063 DDNLISKMTALGEELDTGKI--AHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSVICC 1120

Query: 848  RCTPQQKADVALLIREITGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 906
            R +P QKA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS ++D+S
Sbjct: 1121 RASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYS 1180

Query: 907  VTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLM 966
            + QF +L KLL  HGR +Y R++K      ++ ++  + Q +Y   + F   +LY+ W +
Sbjct: 1181 IAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSL 1240

Query: 967  VGYATCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVI 1018
              + T +T  PV  + + + D+        PELY       + + K F VW++
Sbjct: 1241 SMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNLKIFLVWML 1293

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 153/290 (52%), Gaps = 39/290 (13%)

Query: 264 KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR-----VACSLT 318
           KDLKVG+ + ++    +PAD++LL +   + E+F++T  LDGET+ K +     +A  +T
Sbjct: 275 KDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT 334

Query: 319 QNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIG 378
              +T   ++  + T   P   ++ F G +   D     L  DN ++  ++L +  S +G
Sbjct: 335 S--ATGLSMHSATTTLEDPNNDLYNFEGTVEI-DGELYPLGSDNVVYRGSILRNTQSIVG 391

Query: 379 CVVYTGTDTRQAMNTTMS-SVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFG----- 432
            V++TG +T+  MN   +   K   L+ +IN    I+   VFV++  +  F+  G     
Sbjct: 392 IVIFTGEETKIRMNAIKNPRTKAPKLQGKINL---IVLFMVFVVA-AMAMFSYLGQHILK 447

Query: 433 ------NKDWYV---------DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI- 476
                 N+ WY+          IM ++I+++T+IP+SL V  ++ K++ ++ +E D  + 
Sbjct: 448 KNYVDNNRAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMY 507

Query: 477 ---PDTIV--RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY 521
               DT    RT+TI E+LG++ Y+ SDKTGTLT N M  +K  +   S+
Sbjct: 508 HIESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSW 557

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           Y  N I++++Y   +F+P  LY QF    N YFLLVA+ Q IP+       + IVPL+  
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVL 255
           L ++M++EA DD +R + DKE NN+  +VL
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVL 205

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 19/120 (15%)

Query: 557 RVRDLVVTLAICHNVTPT-FEDG--ELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSL 613
           R +  +++LA+CH   P    DG   + YQ++SPDE+A+V     +G  +  R+  ++S+
Sbjct: 668 RAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSI 727

Query: 614 ------FHQHSATNFEYDILQVFPFNSDTKRMGIIVY-----DKVKGEHWFMQKGADTVM 662
                 F        +Y++L+   F+S  KRM + V      D+V      + KGAD V+
Sbjct: 728 ATYPNGFDDQPIVE-DYEVLEYINFDSQRKRMSVAVKMPNDDDRV----LLICKGADNVI 782

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  208 bits (529), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 164/492 (33%), Positives = 244/492 (49%), Gaps = 46/492 (9%)

Query: 630  FPFNS---DTKRMGIIV-YDKVKGEHWFMQK---GADTVMARIVQSNDWLDEEVGNMARE 682
            FP N+   DT++ G+   YD    EH    +     + V+ R +Q+   +DE     + E
Sbjct: 979  FPNNNVPIDTRKEGLQHDYDTEILEHIGSDELILNEEYVIERTLQA---IDE----FSTE 1031

Query: 683  GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
            GLRTLV   K +    YE + K YH A  S+ +R   +       +E  L LLG+T +ED
Sbjct: 1032 GLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA-GAEIEDGLNLLGVTAIED 1090

Query: 743  KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEG-- 800
            KLQ+ V  +IE +R AG+K+WMLTGDK ETA  +  S  LI    Y   V   +  E   
Sbjct: 1091 KLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK--DYSTVVILTTTDENII 1148

Query: 801  -ALNAL--EYLKINKSSCLL-IDGESLGMFL--TYYKQEFFDIVVDLPAVIACRCTPQQK 854
              +NA+  E    N + C++ IDG ++ MF     Y   F ++     +VI CR +P QK
Sbjct: 1149 SKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQK 1208

Query: 855  ADVALLIREITGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHL 913
            A +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS  +D+S+ QF  L
Sbjct: 1209 ALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFL 1268

Query: 914  TKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCY 973
             KLL  HGR +Y R++K      ++ +     Q +Y   + F   +LY+ W +  + T +
Sbjct: 1269 LKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLF 1328

Query: 974  TMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILS-------LFQGC 1025
            T  PV  + + + D+        PELY         ++  F  WVIL+        F   
Sbjct: 1329 TSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNV 1388

Query: 1026 AIQGISQYFTSLDEVDFKKLVALSFTALVINELIMVA---LEIYTWNK---TMVITEIVT 1079
             + G+S    SL +     L  ++FTA+V   LI V    +E++  N    T V+     
Sbjct: 1389 VMWGMS----SLSDNTMYPLGLINFTAIV--ALINVKSQFVEMHNRNWLAFTSVVLSCGG 1442

Query: 1080 FLIYVVSVPFLS 1091
            +L++  ++P L+
Sbjct: 1443 WLVWCCALPILN 1454

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 125/454 (27%), Positives = 205/454 (45%), Gaps = 101/454 (22%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           Y  N I++++Y   +F+P  LY QF    N YF +VA+ Q IP        + I+PL   
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 226 LMVTMSKEAMDDIQRRQRDKE------------SNNELYEV------------------- 254
           + ++M++EA DD +R + DKE             NN+  EV                   
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPSSVVSSTAYLTKSAA 257

Query: 255 ----------------------LNKAQLVPSK-----------DLKVGDLIKIHKGTRIP 281
                                  N  +L+ +K            L+VGD + + +   +P
Sbjct: 258 AENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVP 317

Query: 282 ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL--STDDLLN-KISITASSPE 338
           ADL+LL     + E F++T  LDGET+ K +        L  +   L N    +T   P 
Sbjct: 318 ADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPN 377

Query: 339 KSIHRFLGKLTYKDSSSNA-----LSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNT 393
             ++ F G L  K+  ++      L  DN ++  ++L +  + +G V+++G +T+  MN 
Sbjct: 378 IDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNA 437

Query: 394 TMS-SVKTGLLELEINSLSKILCACVFVLS-IVLVAFAGF---------GNKDWYV---- 438
             +   K   L+ +IN    I+   VFV++ I L ++ G           NK WY+    
Sbjct: 438 LKNPRTKAPKLQRKIN---MIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQAD 494

Query: 439 -----DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTIP 487
                 IM ++I+++T+IP+SL V +++ K V ++ +E      H  T      RT+TI 
Sbjct: 495 AGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATIL 554

Query: 488 EDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY 521
           E+LG++ Y+ SDKTGTLT N M  +K  L   S+
Sbjct: 555 EELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 12/118 (10%)

Query: 557 RVRDLVVTLAICHNVTPTFEDGE------LTYQAASPDEIAIVKFTESVGLSLFKRDRHS 610
           + +   ++LA+CH+  P     E      + YQ++SPDE+A+V     +G  +  R+   
Sbjct: 727 KAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQI 786

Query: 611 VSLFHQHSATNFE-----YDILQVFPFNSDTKRMGIIV-YDKVKGEHWFMQKGADTVM 662
           +++       + E     Y+IL    FNS  KRM ++V       +   + KGAD V+
Sbjct: 787 LTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVI 844

>Scas_669.3
          Length = 1638

 Score =  200 bits (509), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 148/438 (33%), Positives = 224/438 (51%), Gaps = 26/438 (5%)

Query: 674  EEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLE 733
            + +   + EGLRTLV   K +  + Y+Q+   YHDA +S+ NR   ++ V  + +E +L+
Sbjct: 997  QAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV-GEEIEQDLQ 1055

Query: 734  LLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVT 793
            LLG T +EDKLQ  V  +IE +R AG+KIWMLTGDK ETA  +  S KLI       TV 
Sbjct: 1056 LLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYD---YSTVV 1112

Query: 794  KLSRPE----GALNAL--EYLKINKSSC-LLIDGESLGMFL--TYYKQEFFDIVVDLPAV 844
             L++ +      +NA+  E    N + C ++IDG +L MF         F ++     +V
Sbjct: 1113 ILAKGDENIISKMNAISQEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSV 1172

Query: 845  IACRCTPQQKADVALLIREITGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 903
            I CR +P QK+ +   IR      V   IGDG ND++MIQ AD+G+GI GKEG QAS  A
Sbjct: 1173 ICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTA 1232

Query: 904  DFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQG 963
            D+S+ QF  + KLLL HGR +Y R+AK       + +   + Q ++   + F   +LY+ 
Sbjct: 1233 DYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEP 1292

Query: 964  WLMVGYATCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLF 1022
            W +  + T +T  PV  + + + D+        PELY         +   F  WVI +  
Sbjct: 1293 WSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAA 1352

Query: 1023 QGCAIQGISQYF---TSLDEVDFKKLVALSFTALVINELIMVALEIYTWNK------TMV 1073
                I  ++      T+L +     L  ++FTA+V   L+ V  +    N       T V
Sbjct: 1353 YALLITFLNIIIWGETALSDHTMYPLGVINFTAIV--ALVNVKCQFIEMNNRNWVVFTSV 1410

Query: 1074 ITEIVTFLIYVVSVPFLS 1091
            I     +L++  ++P L+
Sbjct: 1411 ILSCGGWLVWCCALPILN 1428

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 129/447 (28%), Positives = 221/447 (49%), Gaps = 95/447 (21%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           Y +N I++++Y   +F P  LY QF    N+YF +VA+ Q IP        + IVPL   
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVLNK----------AQLVPSK----------- 264
           + ++M++EA DD +R + DKE NN+   +L K          AQL PS+           
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQL-PSRQNIDNLSNDSN 258

Query: 265 ----------------------------DLKVGDLIKIHKGTRIPADLVLLQSSEPSGES 296
                                       +L VGD + + +   +PAD+++L S   + E 
Sbjct: 259 TDYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNEC 318

Query: 297 FIKTDQLDGETDWKLR--------VACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKL 348
           F++T  LDGET+ K++        +ACS +   + + L     IT   P   ++ F G L
Sbjct: 319 FVETMALDGETNLKVKQPHPELNKLACSASGLANINAL-----ITVEDPNSDLYNFEGNL 373

Query: 349 TYKDSSSNAL-----SVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLL 403
              D+++N+L       DN  +  +++ +  + IG V+YTG +T+  MN  +++ +T   
Sbjct: 374 ELTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNA-LNNPRTKAP 432

Query: 404 ELEINSLSKILCACVFVLSIV-LVAFAGF---------GNKDWYV---------DIMRYL 444
           +L+ N ++ I+   VFV++++ L ++ G           N+ WY+          IM ++
Sbjct: 433 KLQKN-INIIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFI 491

Query: 445 ILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTIPEDLGRIEYLLS 498
           I+++TIIP+SL V +++ K++ ++ +E      H  T      RT+TI E+LG++ Y+ S
Sbjct: 492 IMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFS 551

Query: 499 DKTGTLTQNDMQLKKLHLGTVSYTMDT 525
           DKTGTLT N M  +K  +   S+   T
Sbjct: 552 DKTGTLTDNKMIFRKFSICGSSWLHST 578

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 82/179 (45%), Gaps = 27/179 (15%)

Query: 557 RVRDLVVTLAICHNVTPTF----EDGE--LTYQAASPDEIAIVKFTESVGLSLFKRDRHS 610
           + +  +++LA+CH   P      E GE  + YQ++SPDE+A+V     +G  +  ++   
Sbjct: 698 KAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADV 757

Query: 611 VSLFHQHSATNFE-------YDILQVFPFNSDTKRMGIIVYDKVKGEH---WFMQKGADT 660
           +++  +     FE       Y IL    FNS  KRM ++V  K   E      + KGAD 
Sbjct: 758 LTI--KTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLV--KTPDEPNKVLLICKGADN 813

Query: 661 VMARIVQSNDWLDEEVGNMAR------EGLRTLVI-GRKKLSPKSYEQFRKEYHDASLS 712
           ++   +Q  D   +++ ++ R      E    LVI  RK L   +Y+   +     SLS
Sbjct: 814 MILERLQDRDLAYQKMEDINRNTRERKELEAGLVIEQRKSLERMAYDDVPRNSFKTSLS 872

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  197 bits (501), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/357 (34%), Positives = 189/357 (52%), Gaps = 15/357 (4%)

Query: 682  EGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVE 741
            EGLRTL+   K +  + YE +   Y  A  +++NR E M +V  + +E +L LLG  G+E
Sbjct: 951  EGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV-GEIIERDLTLLGTIGIE 1009

Query: 742  DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGA 801
            DKLQ  V  +I+ LR AG+K+WMLTGDK ETA  +  S +LI    Y   +      E  
Sbjct: 1010 DKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVIILAPNDENM 1067

Query: 802  LNAL-----EYLKINKSSCLL-IDGESLGMF---LTYYKQEFFDIVVDLPAVIACRCTPQ 852
             + +     E    N + C++ IDG +L +F   LT     F ++     +VI CR +P 
Sbjct: 1068 ASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTL-FIELCTKTDSVICCRSSPS 1126

Query: 853  QKADVALLIREITGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFC 911
            QKA +   IR+   K V   IGDG ND++MIQ AD+GV I GKEG QAS ++D+S+ QF 
Sbjct: 1127 QKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFR 1186

Query: 912  HLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYAT 971
            +L KLLL HGR +Y R++K      ++  +  + Q ++ + + F   + Y+ W +  + T
Sbjct: 1187 YLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNT 1246

Query: 972  CYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAI 1027
             +T  PV  + + + D+        PELY       + +   F  W+ ++      I
Sbjct: 1247 LFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVII 1303

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 114/429 (26%), Positives = 209/429 (48%), Gaps = 76/429 (17%)

Query: 166 YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225
           Y  NAI++++Y+  +F+P  L  QF    N YF  +A+ Q +P        + IVPL+  
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 226 LMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ-------------------------- 259
           + +++++E  +D +R + D+E NN+L +VL +A                           
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQ 229

Query: 260 ------LVPS--KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKL 311
                 +V    KD++VG+ + +++   +PADL LL +   + E +++T  LDGET+ K 
Sbjct: 230 ANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKC 289

Query: 312 RVA----CSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSN----ALSVDNT 363
           +       S T+  S       ++ T   P   ++ F GK+  +  S      ++ +DN 
Sbjct: 290 KHVLPKIASQTRTASGLATFRGMT-TVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNV 348

Query: 364 MWANTVLASVGSCIGCVVYTGTDTRQAMNTTMS-SVKTGLLELEINSLSKILCACVFVLS 422
           ++  +++ +  + +G VV+TG +T+  MN   +  +K+  L+ +IN     L     +L 
Sbjct: 349 LFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQIN-----LIVLFMILV 403

Query: 423 IVLVAFAGFG------------NKDWYV---------DIMRYLILFSTIIPVSLRVNLDL 461
           + + +F  FG            ++ WY+          IM ++I+++T+IP+SL V +++
Sbjct: 404 VAIFSFLSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEI 463

Query: 462 GKSVYARQIE------HDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLH 515
            K + +R +E      H  T      RT+TI E+LG++ Y+ SDKTGTLT N M  +K  
Sbjct: 464 IKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFS 523

Query: 516 LGTVSYTMD 524
               ++  D
Sbjct: 524 FCGTAWEHD 532

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 557 RVRDLVVTLAICHNVTPTFEDG-------ELTYQAASPDEIAIVKFTESVGLSLFKRDRH 609
           R +  ++ LA+CH   P    G        + YQ++SPDE+A+V     +G  +  R+  
Sbjct: 649 RAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGD 708

Query: 610 SVSLFHQHSATNFE-------YDILQVFPFNSDTKRMGIIVYDKVKGEH-WFMQKGADTV 661
            +++  +     FE       Y++L    F+SD KRM ++V      E    + KGAD V
Sbjct: 709 ELTI--KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNV 766

Query: 662 MARIVQSND 670
           +   + ++D
Sbjct: 767 ILERLHNSD 775

>Scas_505.4
          Length = 1025

 Score =  139 bits (349), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 162/350 (46%), Gaps = 28/350 (8%)

Query: 815  CLLIDGESLGMFLTYYKQEFFDIVVDL----PAVIACRCTPQQKADVALLIREITGKRVC 870
             L+IDG+SL   L   + +  D ++ L     AV+ CR +P QKA V  +++  T   + 
Sbjct: 559  ALVIDGKSLSYAL---ESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLL 615

Query: 871  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAK 930
             IGDG NDVSMIQ A VGVGI G EG QA+ +AD +V QF  L KLLL HG  SY+R + 
Sbjct: 616  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISV 675

Query: 931  LAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 989
               +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 676  AILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSS 735

Query: 990  SLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQ-GISQYFTSLDEVDFKKLVA- 1047
             L + YP+LYK    G   S + F+ W++   +    +  G   ++     ++    VA 
Sbjct: 736  RLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVAD 795

Query: 1048 ------LSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQ 1101
                    +T+ ++  L   AL    W K  +     +F+ +++  P  +  F    +S+
Sbjct: 796  HWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISR 855

Query: 1102 LPF------YAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQQ 1139
              F      Y    F L + V PV+A       K   R   P +Y  VQ+
Sbjct: 856  EYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQE 905

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 151/299 (50%), Gaps = 11/299 (3%)

Query: 141 SIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLL 200
           ++  +D    REI+ +         Y  N IS  KYN  TF+P  L+++F  + NL+FL 
Sbjct: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271

Query: 201 VALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNK--A 258
            A  Q +P +      + +  L  VL+V+  KE+++DI+R   DKE NN   E+ ++   
Sbjct: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENG 331

Query: 259 QLVPSK--DLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACS 316
             +  +  D++ GD+I++     IPADL+++ SSEP G  +I+T  LDGET+ K++ A  
Sbjct: 332 DFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391

Query: 317 LTQNLSTDDLLN--KISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVG 374
            T  +     LN  K  + +  P  S++ + G L + +     LS +  +     L +  
Sbjct: 392 ETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI-PLSPEQMILRGATLRNTS 450

Query: 375 SCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGN 433
              G V++TG +T+   N T + +K   +E  IN    +    +F + IVLV  +  GN
Sbjct: 451 WMFGLVIFTGHETKLMRNATATPIKRTAVERVIN----LQIVALFGVLIVLVLISSLGN 505

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  106 bits (264), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 163/702 (23%), Positives = 300/702 (42%), Gaps = 117/702 (16%)

Query: 261  VPSKDLKVGDLIKIHKGTRI--PADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLT 318
            V S DL  GDL +I   + +  P D VL+     SG+  +    L GE+         ++
Sbjct: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGES-------VPVS 598

Query: 319  QNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIG 378
            +  +T+  + ++     S +  +  F+ K ++  + +  + V N           G  + 
Sbjct: 599  KYAATEATMAQLLQDFKSSQ--VSSFVSK-SFLFNGTKIIRVRNQ-------PGQGMALA 648

Query: 379  CVVYTG-TDTRQAMNTTM---SSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNK 434
             V+ TG + T+ ++  +M     V     E     +  +    +F  SI  + F   G  
Sbjct: 649  LVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLG-L 707

Query: 435  DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIE 494
            ++ V I+R L + + ++P +L   L +G S    +++       +  R +      G+++
Sbjct: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763

Query: 495  YLLSDKTGTLTQNDMQLKKLHLGT---VSYTMDTMDIVTDYVQELVXXXXXXXXXXXXAK 551
             +  DKTGTLT+  + +  +H       S  +   D++TD  + L              K
Sbjct: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFK 823

Query: 552  KDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESV---GLSLFK--- 605
                   ++ +V+L  CH++     DGEL      P ++ + +FT+     G   +K   
Sbjct: 824  ------AKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWKFKN 872

Query: 606  -RDRHSVS--LFHQHSATNF-EYD------ILQVFPFNSDTKRMGIIVYDKVKGEHWFMQ 655
              D+  +S  + H  S  NF E D      +++ F F S+ +RM +IV    +  +W   
Sbjct: 873  AEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFT 932

Query: 656  KGADTVMARIVQSNDW---LDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLS 712
            KGA  V+A I           E + +    G R +    K L PKS   + ++       
Sbjct: 933  KGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTL-PKSSWLYSQK------- 984

Query: 713  MLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVET 772
                      V ++ +E NLE LG    E+KL++  K++++ L+NA ++  M TGD V T
Sbjct: 985  ----------VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLT 1034

Query: 773  ARCVSISAKLISRGQ----YVHTVTKLSR---------PEGA-LNALEYLKIN---KSSC 815
            A  V   + LIS  +    +++   + SR          EG+ L+A+    +N   KS  
Sbjct: 1035 AVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYT 1094

Query: 816  LLIDGESLGMFLTYYKQEFFDIVVD-------LPAVIACRCTPQQKADVALLIREITGKR 868
            L I G+   +F   ++ +  +I+ D       +   I  R +P +K ++   ++++    
Sbjct: 1095 LAITGD---IFRILFRND--EILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNV 1149

Query: 869  VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 910
              C GDG ND   ++ A++G+ +   E   AS+AA F+   F
Sbjct: 1150 GFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 160/714 (22%), Positives = 291/714 (40%), Gaps = 132/714 (18%)

Query: 261  VPSKDLKVGDLIKIHKGTR--IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLT 318
            VPS DL  GD+ ++   +   +P D +L+     SG+  +    L GE+    +VA +  
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606

Query: 319  QNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIG 378
              L   D                        + D+  ++    + ++  T L  V +  G
Sbjct: 607  TMLQLLD-----------------------DFMDTQLSSFVSKSFLFNGTKLIRVRATAG 643

Query: 379  CVVYTGTDTRQAMNTTMSSV--------KTGL--LELEINSLSKILCACVFVLSIVLVAF 428
              +  G   R   +TT  S+         TG    E     +  I    +F  ++  + F
Sbjct: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703

Query: 429  AGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPE 488
               G  D    I+R L + + ++P +L  +L +G      +++       +  R +    
Sbjct: 704  LRLG-LDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV--- 759

Query: 489  DLGRIEYLLSDKTGTLTQNDMQLKKLHL-GTVSYTMDTMDIVTDYVQELVXXXXXXXXXX 547
              G+I+ +  DKTGTLT++ + +  +H+   +   M    +VTD V++L+          
Sbjct: 760  -GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTD-VKDLLQSLSLSDCV- 816

Query: 548  XXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTE---------- 597
              + +D+  + ++ +V+L  CH++     DGEL      P +  +V+FT+          
Sbjct: 817  --STRDM--KAKNFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETGNR 867

Query: 598  ---------SVGLSLFKRDRHSVSLFHQHSATNF-------EYDILQVFPFNSDTKRMGI 641
                       G ++ +  R + ++ H      F          I++ F F S+ +RM +
Sbjct: 868  KVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSV 927

Query: 642  IVYDKVKGEHWFMQ--KGADTVMARIVQSNDW-LDEE--VGNMAREGLRTLVIGRKKLSP 696
            IV  K   E+ FM   KGA  V+  +       LD E  + +    G R +    KKL+ 
Sbjct: 928  IV--KPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTR 985

Query: 697  KSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLR 756
            +S+   +K                  V ++ +E NLE LG    E+KL+   K ++E L 
Sbjct: 986  QSWLYSQK------------------VSREEIESNLEFLGFIIFENKLKGTTKETLESLH 1027

Query: 757  NAGVKIWMLTGDKVETARCVSISAKLISRGQ-YVHTVTKL-SRPEGAL----------NA 804
             A ++  M TGD V TA  V   A L+   + +V  +  + +  EG +          + 
Sbjct: 1028 RADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDT 1087

Query: 805  LEYLKINKSS------CLLIDGESLGMFLTYYKQEFFDIV--VDLPAVIACRCTPQQKAD 856
            L+ + +   S       L + GE   +     K +  +++  + L   I  R +P +K +
Sbjct: 1088 LDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHE 1147

Query: 857  VALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 910
            +   ++ I G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   F
Sbjct: 1148 LVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLF 1197

>Scas_665.30
          Length = 1439

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 141/620 (22%), Positives = 245/620 (39%), Gaps = 112/620 (18%)

Query: 417  CVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
             +F  SI  + F   G  D    I+R L + + ++P +L   L +G      +++     
Sbjct: 480  ALFGFSISCIQFIKIG-LDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIF 538

Query: 477  PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQEL 536
              +  R +      G+I+ L  DKTGTLT+N + +  + L  V  + ++     D VQ++
Sbjct: 539  CISPTRVNI----GGKIDILCFDKTGTLTENGLDVLGVQL-CVPSSHNSFQFA-DLVQDV 592

Query: 537  VXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT 596
                         + +D   R ++  ++L  CH++     D EL      P +  + +FT
Sbjct: 593  HKLFPKFSLNDCSSPRDY--RAKNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFT 645

Query: 597  ---------ESVGLSLFKRDRHSVSL----------FHQHSAT-----------NFEYDI 626
                     E    S ++  RH  +L           H +SA            NF   I
Sbjct: 646  KWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNF-LGI 704

Query: 627  LQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEEVGNMAREG 683
            ++ F F S+ +RM +IV    +  +W   KGA  V+ +I          +E +     +G
Sbjct: 705  IRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKG 764

Query: 684  LRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDK 743
             R +    + L   ++   +K                  V ++ +E N+E LG    E+K
Sbjct: 765  YRVIACAGRVLPRNTWLYSQK------------------VSREEVESNMEFLGFIIFENK 806

Query: 744  LQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLI-SRGQYVHTVTKLSRP---- 798
            L+ +   +++ L+ A ++  M TGD V TA  V     LI S+  YV ++ ++       
Sbjct: 807  LKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTS 866

Query: 799  ---------EGALNALEYLKINKSS----CLLIDGESLGMFLTYYKQEFFDIVVD----- 840
                     +  L++   L IN SS     L I G+   +F   +  E   I  D     
Sbjct: 867  IIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGD---IFRIIFGDENNSISEDYINTV 923

Query: 841  -LPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQA 899
             L   I  R +P +K ++   ++ +      C GDG ND   ++ ADVG+ +   E   A
Sbjct: 924  LLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---A 979

Query: 900  SLAADFSVTQF--------------CHLTKLLLWHGRNSYKRSAKLAQFVIH-RGLIISV 944
            S+AA F+   F              C +T    +   + Y     +   V++ RG  +  
Sbjct: 980  SVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGD 1039

Query: 945  CQAVYSVCSKFEPIALYQGW 964
             Q +Y       PIA++  W
Sbjct: 1040 FQFLYIDLLLIVPIAIFMSW 1059

>Kwal_23.3160
          Length = 1100

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 187/734 (25%), Positives = 294/734 (40%), Gaps = 178/734 (24%)

Query: 259 QLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACS 316
           + +PSK L  GDL  +  G  +PADL L++          +TD+  L GE+    + A  
Sbjct: 145 ETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESLPIAKEASQ 198

Query: 317 L---TQNLSTDDLLNKISITASSPEKS----------IHRFLGKLTYKDSSSNAL---SV 360
           +   T++    D LN ++  +S+  K           ++  +GK+       N+L     
Sbjct: 199 VYPATEDTPVGDRLN-LAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDE 257

Query: 361 DNTMWAN---TVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCAC 417
           + T WAN   T+ A++GS +G    TGT                 L  +++ L+ +L   
Sbjct: 258 NKTFWANAGITLAATIGSFLGTT--TGTP----------------LHRKLSKLAVLLFFI 299

Query: 418 VFVLSIVLVAFAGFG-NKDWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYARQIEHDAT 475
             V +IV++A   F  NK+    +  Y I  + ++IP SL V L +  SV A+ +     
Sbjct: 300 AVVFAIVVMATQKFVVNKE----VAIYAICVAVSMIPSSLVVVLTITMSVGAKIM----A 351

Query: 476 IPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG-----TVSYTMDTMDIVT 530
             + +VR     E LG +  + SDKTGTLTQ  M +K+  +      TVS + +  D  T
Sbjct: 352 TRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFD-PT 410

Query: 531 DYVQELVXXXXXXXXXXXXAK--------------KDLPNRVRDLV----VTLAICHNVT 572
           D   EL+             +                LP  +   +    +  A   N+ 
Sbjct: 411 DGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIA 470

Query: 573 PTFEDGELTYQAA--SPDEIAIVKFTESVGL---SLFKRDR------HSVSLFHQHSATN 621
             ++D E     A   P EIAI  F   + +   +L   D+         +L  + S+  
Sbjct: 471 HVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVE 530

Query: 622 FEYDILQVFPFNSDTKRM-GIIVYDKVKGEHWFMQKGADTVMARIVQ-SNDWL------- 672
             Y  +  FPF+S  KRM  + V       H    KGA     R++     WL       
Sbjct: 531 PHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVLDCCTKWLPDGCNES 587

Query: 673 --------DEE-----VGNMAREGLRTLVIGRKKLSP----KSYEQFRKEYHDASLSMLN 715
                   D+E     V  ++ EGLR L    K  +     K  E  RK          N
Sbjct: 588 DAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK----------N 637

Query: 716 RDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARC 775
           RD          +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ 
Sbjct: 638 RD---------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKA 688

Query: 776 VSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQ--- 832
           ++    ++ R  Y +       P+  +                  +S+ M    + Q   
Sbjct: 689 IAQEVGILPRNLYHY-------PKEVV------------------DSMVMTAAQFDQLTD 723

Query: 833 EFFDIVVDLPAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV 889
           E  D ++ LP VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+
Sbjct: 724 EEIDNLLLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGI 778

Query: 890 --GIVGKE-GKQAS 900
             GI G +  K AS
Sbjct: 779 AMGINGSDVAKDAS 792

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 175/783 (22%), Positives = 309/783 (39%), Gaps = 154/783 (19%)

Query: 237 DIQRRQRDKESNNELYEVLNKA--QLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSG 294
           ++Q +Q +++  +    V+  A   L+   +L VGDL+K+  G  +PAD VL++     G
Sbjct: 144 ELQFQQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVR-----G 198

Query: 295 ESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSS 354
           E       L GE++                  + K+ +  +    S H   G     D+S
Sbjct: 199 ECETDESALTGESN-----------------TIKKLPLADALEYHSAH---GGRDIGDTS 238

Query: 355 SNALS--VDNTMWANTVLAS---VGSCIGCVVYTGTDTRQAMNTTMSSVKTG----LLEL 405
           ++  S   D++   + +L S   V S +   + T          TM+S+K       L++
Sbjct: 239 ASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQM 298

Query: 406 EINSLSKILC--ACVFVLSIVLVAFAGF-------GNKDWYVDI---------MRYLILF 447
            ++ L+  +    CV  +++ +V FA +       G K  Y D+         M   I  
Sbjct: 299 RLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGK--YHDLPPAEKGSKFMDIFITA 356

Query: 448 STIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQN 507
            T+I V++   L L  ++         T    +VR     E +G    + SDKTGTLT+N
Sbjct: 357 ITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTEN 416

Query: 508 DMQLKKLHLGTVSYTMDTMDI----------VTDYVQELVXXXXXXXXXXXXAK--KDLP 555
            M + +  LG   +     D            +D ++ ++             K  KD P
Sbjct: 417 IMTVVRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKD-P 475

Query: 556 NR------------VRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSL 603
           N             +R +  TL       P  E+  L + A    E  I   TE+  LSL
Sbjct: 476 NNYNSIDDSQPRRLIRRITQTL---QKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSL 532

Query: 604 FKRDRH----SVSLFHQHSATNFEYD-ILQVFPFNSDTKRMGIIVYDKVKGEHWFMQ--- 655
            ++       ++  F  H       + I+Q+ PF S  K   I+V      E+   +   
Sbjct: 533 ARKSFGLKFGALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRL 592

Query: 656 --KGADTVMARIV---------------QSNDWLDEEVGNMAREGLRTLVIGRKKLSPKS 698
             KGA  ++A+                 +S D ++E++ ++A++ LR + +         
Sbjct: 593 YVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNE 652

Query: 699 YEQFRKEYHDASLSMLNRDETMSSVI----KKHLEHNLELLGLTGVEDKLQNDVKSSIEL 754
           +    KE  D      N  E ++  +    K HLE  L L  + G++D L+ +VK+S+  
Sbjct: 653 WPP--KELADPE----NSHEALAVKLIDPKKPHLE-GLTLDAIVGIQDPLRENVKNSVAQ 705

Query: 755 LRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSS 814
            + AGV + M+TGD + TA+ ++ +  ++S                         +N S+
Sbjct: 706 CQKAGVTVRMVTGDNLLTAKAIARNCGILSSKS----------------------LNDSA 743

Query: 815 CLLIDGESLGMFLTYYKQEFFDIVVDLPAV-IACRCTPQQKADVALLIREITGKRVCCIG 873
           C + +G +        ++        LP + +  R +P+ K  +   ++E+ G+ V   G
Sbjct: 744 CAM-EGPAFRKLSDSERKRI------LPKLRVLARSSPEDKKILVRALKEM-GEVVAVTG 795

Query: 874 DGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKL 931
           DG ND   ++ ADVG  +GI G E  + +         F  +   + W GR       K 
Sbjct: 796 DGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKW-GRCVAASIKKF 854

Query: 932 AQF 934
            QF
Sbjct: 855 IQF 857

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 180/782 (23%), Positives = 324/782 (41%), Gaps = 115/782 (14%)

Query: 179 ITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDI 238
           I +  ++L++       +  + +A+S A+     G + S+++ +  ++ +    +A   +
Sbjct: 60  IDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTM 119

Query: 239 QRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSE-PSGESF 297
              +     N  +     K++ + SKD+  GD+  +  G  IPADL L+++    + ES 
Sbjct: 120 NSLKNLSSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESL 178

Query: 298 IKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNA 357
           +  + L    D  L       +  S  D LN ++ ++S+  K   R  G +     +S  
Sbjct: 179 LTGESLPVSKDANL--VFGKEEETSVGDRLN-LAFSSSAVVKG--RAKGIVIKTALNSEI 233

Query: 358 LSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCAC 417
             +  ++  ++ L S       +  T   T++     + +     L  +++ L+ +L   
Sbjct: 234 GKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWI 293

Query: 418 VFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIP 477
             + +I+++A   F + D  V I    +  S +IP SL V L +  SV A  +       
Sbjct: 294 AVLFAIIVMASQKF-DVDKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVM----VSR 347

Query: 478 DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG-----TVSYTMDTMDIVTDY 532
           + IVR     E LG +  + SDKTGTLTQ  M  +++ +      T+S + D  +     
Sbjct: 348 NVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGN 407

Query: 533 V-------------QELVXXXXXXXXXXXXAKKDLPNRV-RDLV---VTLAICHNVTPTF 575
           V              E               +KDLP  +  DL    +  A   N+   F
Sbjct: 408 VSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVF 467

Query: 576 EDGELTYQAA--SPDEIAIVKFTESVGL---------SLFKRDRHSVSLFHQHS----AT 620
           +D       A   P EIAI  F   + L         S  + + +  S   QH+    + 
Sbjct: 468 KDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA 527

Query: 621 NFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGA-DTVMA-----------RIVQS 668
            FE+  +  FPF+S  KRM  + Y+     +    KGA +++++           +I   
Sbjct: 528 QFEH--IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPL 585

Query: 669 NDW----LDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVI 724
            D     + + V +++ EGLR L    K  +       + + +D  L  +  +   +   
Sbjct: 586 TDCDVETIRKNVYSLSNEGLRVLGFASKSFT-------KDQVNDDQLKNITSNRATA--- 635

Query: 725 KKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS 784
               E +L  LGL G+ D  +N+   +++    AG+ + MLTGD V TA+ ++    ++ 
Sbjct: 636 ----ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP 691

Query: 785 RGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAV 844
              Y                  Y +    S ++   +  G+     ++E  D+ V LP V
Sbjct: 692 TNLY-----------------HYSQEIVDSMVMTGSQFDGL----SEEEVDDLPV-LPLV 729

Query: 845 IACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQ 898
           IA RC+PQ K  +  AL  R    K+ C + GDG ND   ++ A+VG+  GI G +  K+
Sbjct: 730 IA-RCSPQTKVRMIEALHRR----KKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784

Query: 899 AS 900
           AS
Sbjct: 785 AS 786

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 180/782 (23%), Positives = 324/782 (41%), Gaps = 115/782 (14%)

Query: 179 ITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDI 238
           I +  ++L++       +  + +A+S A+     G + S+++ +  ++ +    +A   +
Sbjct: 60  IDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTM 119

Query: 239 QRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSE-PSGESF 297
              +     N  +     K++ + SKD+  GD+  +  G  IPADL L+++    + ES 
Sbjct: 120 NSLKNLSSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESL 178

Query: 298 IKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNA 357
           +  + L    D  L       +  S  D LN ++ ++S+  K   R  G +     +S  
Sbjct: 179 LTGESLPVSKDANL--VFGKEEETSVGDRLN-LAFSSSAVVKG--RAKGIVIKTALNSEI 233

Query: 358 LSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCAC 417
             +  ++  ++ L S       +  T   T++     + +     L  +++ L+ +L   
Sbjct: 234 GKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWI 293

Query: 418 VFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIP 477
             + +I+++A   F + D  V I    +  S +IP SL V L +  SV A  +       
Sbjct: 294 AVLFAIIVMASQKF-DVDKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVM----VSR 347

Query: 478 DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG-----TVSYTMDTMDIVTDY 532
           + IVR     E LG +  + SDKTGTLTQ  M  +++ +      T+S + D  +     
Sbjct: 348 NVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGN 407

Query: 533 V-------------QELVXXXXXXXXXXXXAKKDLPNRV-RDLV---VTLAICHNVTPTF 575
           V              E               +KDLP  +  DL    +  A   N+   F
Sbjct: 408 VSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVF 467

Query: 576 EDGELTYQAA--SPDEIAIVKFTESVGL---------SLFKRDRHSVSLFHQHS----AT 620
           +D       A   P EIAI  F   + L         S  + + +  S   QH+    + 
Sbjct: 468 KDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA 527

Query: 621 NFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGA-DTVMA-----------RIVQS 668
            FE+  +  FPF+S  KRM  + Y+     +    KGA +++++           +I   
Sbjct: 528 QFEH--IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPL 585

Query: 669 NDW----LDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVI 724
            D     + + V +++ EGLR L    K  +       + + +D  L  +  +   +   
Sbjct: 586 TDCDVETIRKNVYSLSNEGLRVLGFASKSFT-------KDQVNDDQLKNITSNRATA--- 635

Query: 725 KKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS 784
               E +L  LGL G+ D  +N+   +++    AG+ + MLTGD V TA+ ++    ++ 
Sbjct: 636 ----ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP 691

Query: 785 RGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAV 844
              Y                  Y +    S ++   +  G+     ++E  D+ V LP V
Sbjct: 692 TNLY-----------------HYSQEIVDSMVMTGSQFDGL----SEEEVDDLPV-LPLV 729

Query: 845 IACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQ 898
           IA RC+PQ K  +  AL  R    K+ C + GDG ND   ++ A+VG+  GI G +  K+
Sbjct: 730 IA-RCSPQTKVRMIEALHRR----KKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784

Query: 899 AS 900
           AS
Sbjct: 785 AS 786

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 171/704 (24%), Positives = 293/704 (41%), Gaps = 114/704 (16%)

Query: 257 KAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSE-PSGESFIKTDQLDGETDWKLRVAC 315
           K++ + SKD+  GD+  +  G  IPADL L+++    + ES +  + L    D  L    
Sbjct: 137 KSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGK 196

Query: 316 SLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGS 375
              +  S  D LN ++ ++S+  K   R  G +     +S    +  ++  ++ L S   
Sbjct: 197 E--EETSVGDRLN-LAFSSSAVVKG--RAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP 251

Query: 376 CIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKD 435
               +  T   T++     + +     L  +++ L+ +L     + +I+++A   F + D
Sbjct: 252 SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKF-DVD 310

Query: 436 WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEY 495
             V I    +  S +IP SL V L +  SV A  +       + IVR     E LG +  
Sbjct: 311 KRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVM----VSRNVIVRKLDSLEALGAVND 365

Query: 496 LLSDKTGTLTQNDMQLKKLHLG-----TVSYTMDTMDIVTDYV-------------QELV 537
           + SDKTGTLTQ  M  +++ +      T+S + D  +     V              E  
Sbjct: 366 ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425

Query: 538 XXXXXXXXXXXXAKKDLPNRV-RDLV---VTLAICHNVTPTFEDGELTYQAA--SPDEIA 591
                        +KDLP  +  DL    +  A   N+   F+D       A   P EIA
Sbjct: 426 DVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIA 485

Query: 592 IVKFTESVGL---------SLFKRDRHSVSLFHQHS----ATNFEYDILQVFPFNSDTKR 638
           I  F   + L         S  + + +  S   QH+    +  FE+  +  FPF+S  KR
Sbjct: 486 IQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEH--IAEFPFDSTVKR 543

Query: 639 MGIIVYDKVKGEHWFMQKGA-DTVMA-----------RIVQSNDW----LDEEVGNMARE 682
           M  + Y+     +    KGA +++++           +I    D     + + V +++ E
Sbjct: 544 MSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNE 603

Query: 683 GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
           GLR L    K  +       + + +D  L  +  +   +       E +L  LGL G+ D
Sbjct: 604 GLRVLGFASKSFT-------KDQVNDDQLKNITSNRATA-------ESDLVFLGLIGIYD 649

Query: 743 KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGAL 802
             +N+   +++    AG+ + MLTGD V TA+ ++    ++    Y              
Sbjct: 650 PPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY-------------- 695

Query: 803 NALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADV--ALL 860
               Y +    S ++   +  G+     ++E  D+ V LP VIA RC+PQ K  +  AL 
Sbjct: 696 ---HYSQEIVDSMVMTGSQFDGL----SEEEVDDLPV-LPLVIA-RCSPQTKVRMIEALH 746

Query: 861 IREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900
            R    K+ C + GDG ND   ++ A+VG+  GI G +  K+AS
Sbjct: 747 RR----KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEAS 786

>Kwal_47.17547
          Length = 1240

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 179/818 (21%), Positives = 314/818 (38%), Gaps = 137/818 (16%)

Query: 217 SYIVPLAFVLMVTMSKEAMDDIQ-RRQRDKESNNELYEVLNKAQ-LVPSKDLKVGDLIKI 274
           + ++ +  V++V  + +   ++Q  +  DK+++ E+  + N  + L+   D+ VGD++ +
Sbjct: 153 AIMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILVGDILSL 212

Query: 275 HKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLT----QNLSTDDLLNKI 330
             G  +PAD +L++ S    ES      L GE+    + A  +     + LS  D    I
Sbjct: 213 QTGDVVPADCILVKGSCECDES-----ALTGESATIKKAAIDVCYEKYKQLSATDA--AI 265

Query: 331 SITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQA 390
            I     EK     L                  +  + +L+ +G  +   V   +   + 
Sbjct: 266 DIGTPGAEKVPDPML------------------ISGSKLLSGLGRAVVTSVGVNSMHGRT 307

Query: 391 MNTTMSSVKTGLLELEINSLSKIL-----CACVFVLSIVLVAFAGFGNKDWYVD------ 439
           +       +T  L+  ++SL+  +      A + +  I+ + F     K   +       
Sbjct: 308 LMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQ 367

Query: 440 ----IMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEY 495
                M   I+  T+I V++   L L  ++              +VR     E +G    
Sbjct: 368 KGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATA 427

Query: 496 LLSDKTGTLTQNDMQLKKLHLGTV------------SYTMDTMDIVTDYVQELVXXXXXX 543
           + SDKTGTLT+N M + K  LG+             S T   + I  +  +EL       
Sbjct: 428 VCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIANECSEELKKDVLTN 487

Query: 544 XXXXXXAKKDLPN------------RVRDLVVTLAICHNVTPTFEDGELTYQAAS--PDE 589
                 A ++  N            + R  +   +  +         EL   AA+  P E
Sbjct: 488 ITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKELVENAAADQPKE 547

Query: 590 IAIVKFTESVGLSLFKRDRHSVSLFH---QHSATNFEYDILQVFPFNSDTKRMGIIVYDK 646
             +   TE+  L+  +++    +L H   +      E  I+Q+ PF S  K  GI+V  K
Sbjct: 548 PFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIE-KIVQIIPFESSRKWGGIVVKYK 606

Query: 647 VKGEHWFMQKGADTVMAR-------------IVQSNDWLDEE---VGNMAREGLRTLVIG 690
             G H F  KGA  ++ R             ++   D+ DEE   + N+A E LR + + 
Sbjct: 607 -NGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDF-DEESQTITNLAAEALRAISLA 664

Query: 691 RKKLS-----PKSYEQFRKEYHDASLSMLNRDETMSS----VIKKHLEHNLELLGLTGVE 741
            +        P S  Q   E   AS  +L  DE   S       + L   + L G+ G++
Sbjct: 665 HRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQ 724

Query: 742 DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGA 801
           D L+  V+ S+E  + AGV + M+TGD + TA  ++    ++S  Q          PE +
Sbjct: 725 DPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQA-------ENPESS 777

Query: 802 LNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAV-IACRCTPQQKADVALL 860
           +    + K++    + I                      LP + +  R +P+ K  +   
Sbjct: 778 MEGPRFRKLSNKERVRI----------------------LPNLRVLARSSPEDKRILVET 815

Query: 861 IREITGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSVTQFCHLTKLLL 918
           ++++ G  V   GDG ND   ++ ADVG  +GI G E  + +         F  +   + 
Sbjct: 816 LKKM-GDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIK 874

Query: 919 WHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFE 956
           W GR       K  QF +   +   V   V +V S  E
Sbjct: 875 W-GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEE 911

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 124/558 (22%), Positives = 219/558 (39%), Gaps = 117/558 (20%)

Query: 419  FVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPD 478
            F  SI  + F   G  D    I+R L + + ++P +L   L +G S    +++       
Sbjct: 694  FGFSISCINFIKLG-LDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCI 752

Query: 479  TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVS---------YTMDTMDIV 529
               R +      G+I+ +  DKTGTLT++ + +  + +   +            DT DI 
Sbjct: 753  APTRVNI----GGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIF 808

Query: 530  TDYVQELVXXXXXXXXXXXXAKKDLPN----RVRDLVVTLAICHNVTPTFEDGELTYQAA 585
              +                 + KD  N    + R+ +++L  CH++     DGEL     
Sbjct: 809  PKF-----------------SLKDCSNPDDYKRRNFLISLLTCHSLRVV--DGEL---LG 846

Query: 586  SPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYD-------------------- 625
             P +  + +FT       F+  +       +H   NF  +                    
Sbjct: 847  DPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFV 906

Query: 626  ---------ILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQ----SNDWL 672
                     I++ F F S+ +RM +IV    +  +W   KGA  V+  I       +D+ 
Sbjct: 907  QNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDY- 965

Query: 673  DEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNL 732
            D+ +      G R +    K L   ++   +K                  V ++ +E N+
Sbjct: 966  DDILNFYTHSGYRVIACAGKTLPKNTWLYSQK------------------VRREEVESNM 1007

Query: 733  ELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQ-YVHT 791
            E LG    ++KL++    ++  L+ A ++  M TGD V TA  V    +LI+  + YV T
Sbjct: 1008 EFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPT 1067

Query: 792  VT-------------KLSRPEGALNALEYLKINKSS---CLLIDGESLGMFLT---YYKQ 832
            V              ++S  E  L+      I+  S    L I GE   +  +    Y +
Sbjct: 1068 VAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSE 1127

Query: 833  EFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIV 892
            E+ + ++ L   I  R +P +K ++   ++++      C GDG ND   ++ ADVG+ + 
Sbjct: 1128 EYVNEIL-LKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLS 1185

Query: 893  GKEGKQASLAADFSVTQF 910
              E   AS+AA F+   F
Sbjct: 1186 EAE---ASVAAPFTSKIF 1200

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 180/719 (25%), Positives = 288/719 (40%), Gaps = 147/719 (20%)

Query: 258 AQLVPSKDLKVGDLIKIHKGTRIPADLVLL-QSSEPSGESFIKTDQL----------DGE 306
           +++V S D+  GDL+ +  G  IPADL L+ Q +  + E+ +  + L          D E
Sbjct: 134 SEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDE 193

Query: 307 TDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-SVDNT-M 364
           T    R+  + + +         I+I     +  ++  +GK+       N L S D    
Sbjct: 194 TPVGDRINLAFSSSTVVKGRAQGIAI-----KTGLNTEIGKIAKSLRGGNELISRDPAKT 248

Query: 365 WANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIV 424
           W      S    +G  + T   T               L  +++ L+ +L     V +IV
Sbjct: 249 WYQNAWISTKRTVGAFLGTTQGTP--------------LHRKLSKLAVLLFWIAVVFAIV 294

Query: 425 LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTS 484
           ++A   F + D  V I    +  S +IP SL V L +  SV A  +       + I+R  
Sbjct: 295 VMASQKF-DVDRGVAIYAVCVALS-MIPSSLVVVLTITMSVGAAVMASR----NVIIRKL 348

Query: 485 TIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTVSYT------------MDTMDIV 529
              E LG +  + SDKTGTLTQ  M  K++     GT+               ++ +  +
Sbjct: 349 DSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNL 408

Query: 530 TDYV---QELVXXXXXXXXXXXXAKKDLPNRVR----DLVVTLAICHNVTPTFEDGELTY 582
           + Y     E                K +P   +    D  +  A   N+   F D E   
Sbjct: 409 SPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKE 468

Query: 583 QAA--SPDEIAIVKFTESVGLSLF----KRD-------RHSVSLFHQHS-ATNFEYDILQ 628
             A   P EIAI  F   + L       +RD         SVSL  + + A N ++    
Sbjct: 469 WKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAA 528

Query: 629 VFPFNSDTKRMGII----------VYDKVKGE-------HWFMQKGADTVMARIVQSND- 670
            FPF+S  KRM  +          +Y K   E       HW+   G D   A ++   D 
Sbjct: 529 EFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWY---GRDPNTATVMTDADV 585

Query: 671 -WLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKK--H 727
             + E + +M+ EGLR L    K   PKS         D +      +E +  ++K+  +
Sbjct: 586 DTIKENIDSMSSEGLRVLAFANKSY-PKS---------DVN------EEKLQKILKERDY 629

Query: 728 LEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQ 787
            E  L  LGL G+ D  + +   +++    AG+ + MLTGD   TA+ ++    ++    
Sbjct: 630 AETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNL 689

Query: 788 YVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIAC 847
           Y ++              E + I     +++ G+    F    + E  ++ V LP VIA 
Sbjct: 690 YHYS-------------KEVVDI-----MVMTGKQ---FDNLSEDEIDNLPV-LPLVIA- 726

Query: 848 RCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900
           RC+PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 727 RCSPQTKVRMIEALHRRE----KFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 166/726 (22%), Positives = 291/726 (40%), Gaps = 134/726 (18%)

Query: 240 RRQRDKESNNELYEVLNKAQLVPS-KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFI 298
           R  R KE + E+  V N  + V S  DL VGDL+ +  G  +P D +L++      ES I
Sbjct: 175 RLNRKKE-DTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGI 233

Query: 299 KTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL 358
                 GE+D   +V+ +++  +         ++ A +P   I           SS N  
Sbjct: 234 T-----GESDTIKKVSLAMSLQVYR-------TVAADNPSADI----------GSSDNGH 271

Query: 359 S-VDNTMW--ANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILC 415
           S V + M    + +L+ +G  +   V   +   + M    S  +T  L+  +N+L+  + 
Sbjct: 272 SLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDIS 331

Query: 416 ----ACVFVLSIVL-VAFAGFGNKD-WYVDI------MRYLILFSTII-------PVSLR 456
                  F+L +VL + F  +  K   Y D+       R++ +F T +       P  L 
Sbjct: 332 IYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLP 391

Query: 457 VNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHL 516
           + + L  +    ++  D  +    VR     E +G    + SDKTGTLTQN M + K  L
Sbjct: 392 LAVTLALAFATTRMTKDGNL----VRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFL 447

Query: 517 GTVSYTMDTMD--------IVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAIC 568
           G+  +   + D        +  D  Q  +            A ++   +V D V+T    
Sbjct: 448 GSSHFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFEN--KQVADPVITENPY 505

Query: 569 H----NVTPTFEDGELTYQAASPDEIAIVKF-----TESVGLSLFKRDRHSVSLFHQHSA 619
           H    ++ P   + +  Y A     +   +F     TE+  LSL K    S+ L    + 
Sbjct: 506 HKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAK---GSLGLESLQAL 562

Query: 620 TNFEY-----DILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGA---------------D 659
            +  +      I+Q+ PF S  K  G++V   V G + F  KGA               D
Sbjct: 563 RDDPHHIGIASIVQMIPFESSRKWAGLVVR-LVDGNYRFFIKGASETIFKSCHYMRSSND 621

Query: 660 TVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLS-----PKSYEQFRKEYHDASLSML 714
            V+    Q +  +   + N+A + LRT+ +  K  +     P +  +   +   AS  +L
Sbjct: 622 DVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLL 681

Query: 715 NRDETMSSVIKK-----HLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769
             DE + +   +     +    L L G+ G+ D L+  VK S++  + +GV + M+TGD 
Sbjct: 682 LGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDN 741

Query: 770 VETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTY 829
           + T R ++ +  ++S  +Y      +  P                          +F   
Sbjct: 742 ITTGRAIARACGILSESEYADHECAMEGP--------------------------VFRKL 775

Query: 830 YKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVG- 888
            +++  D    L   +  R +P+ K     +++++  + V   GDG ND   +  ADVG 
Sbjct: 776 SRRQMMDAAPKLK--VLARSSPEDKRIFVDILKKMN-EVVAVTGDGTNDAPALTLADVGF 832

Query: 889 -VGIVG 893
            +GI G
Sbjct: 833 SMGISG 838

>Kwal_14.1498
          Length = 939

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 171/775 (22%), Positives = 318/775 (41%), Gaps = 163/775 (21%)

Query: 163 KNKYPSNAISNAKYNPITFIPIILYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-V 220
           + +Y  N IS+ +  P       L+ +F   F     +L+ +  A+ +  +G +   + +
Sbjct: 63  RAQYGKNEISSEEDEP-------LWWKFVTTFVGDPLILLLIGSAVISFIMGNIDDAVSI 115

Query: 221 PLAFVLMVTM-------SKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIK 273
            LA V++VT+       S+++++ + R   D+     L     +++L+ S  L  GD+++
Sbjct: 116 TLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQ---CHLIRCGQESKLLASV-LVPGDVVR 171

Query: 274 IHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISIT 333
              G RIPADL ++++ + S    I+   L GE +   +   ++ +    ++L + + ++
Sbjct: 172 FRVGDRIPADLRIIEAVDLS----IEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVS 227

Query: 334 ASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNT 393
               E+S   F+G L  +                      G  IG    T       M  
Sbjct: 228 ----ERSCIAFMGTLVREGHGR------------------GIVIGTAKNTAFGKVFEMMN 265

Query: 394 TMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIMRYLILFST 449
            +   KT L +  ++ L K L    F++  ++        + W     + +   +     
Sbjct: 266 AIEKPKTPL-QTAMDKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMFQISVSLAVAAIPE 324

Query: 450 IIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM 509
            +P+ + V L LG    A++          I+R     E LG +  + SDKTGTLT N M
Sbjct: 325 GLPIIVTVTLALGVLRMAKR--------RAIIRRLPSVETLGSVNVICSDKTGTLTANHM 376

Query: 510 QLKKL-HLGTVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAIC 568
            + K+  LG++S   + + +                      KK+L   +R  + T  +C
Sbjct: 377 SVNKVWCLGSMSNKSNILKL--------------DKATSGSFKKNLTEDLRATLRTGNLC 422

Query: 569 HNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQ 628
           +N T + E  +      +P +IA+++     GL   + +R  V+   + S          
Sbjct: 423 NNSTYSHEHAKYL---GNPTDIALLEVLHKFGL---EDERPQVTRSDEIS---------- 466

Query: 629 VFPFNSDTKRMGIIVYDK-------VKGEHW-FMQKGADTVMA--RIVQSNDWLDEEVGN 678
              FNS  K M + V +        VKG +   ++K    + A  ++V+ +  L + + +
Sbjct: 467 ---FNSKRKFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITD 523

Query: 679 ----MAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLEL 734
               +A +GLRTL   + +LS  + ++            L  D+           + L  
Sbjct: 524 SADALASDGLRTLAFAQLELSNGNSKK------------LTEDDI----------NGLTF 561

Query: 735 LGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTK 794
            GL G+ D  +  VK+++E L    V I M+TGD   TA  VSI+ ++   G  V     
Sbjct: 562 AGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTA--VSIARQI---GIPV----- 611

Query: 795 LSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQK 854
                          +N  + +L      G  L +  ++    ++D   + A R TP+ K
Sbjct: 612 ---------------VNPETAVLT-----GDKLDHMSEDQLASIIDHVNIFA-RATPEHK 650

Query: 855 ADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVT 908
            ++   +++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 651 LNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 703

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 173/700 (24%), Positives = 288/700 (41%), Gaps = 127/700 (18%)

Query: 261 VPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACSLT 318
           + SK+L  GD+  I  G  +PADL LL+S        ++TD+  L GE+   L VA S +
Sbjct: 143 IQSKELVPGDICIIKVGDTVPADLRLLESIN------LETDEALLTGES---LPVAKSHS 193

Query: 319 QNLSTD----DLLNKISITASSPEK----------SIHRFLGKL--TYKDSSSNALSVDN 362
           +    D    D LN ++  AS+  K          +++  +GK+  + K  +S     +N
Sbjct: 194 EVYEKDTPVGDRLN-LAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDEN 252

Query: 363 TMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLS 422
             +   +  ++   IG   + GT+    ++  +S +                 A +  + 
Sbjct: 253 KSFGQNLWITLKETIGS--FLGTNVGTPLHRKLSQL-----------------AILLFVV 293

Query: 423 IVLVAFAGFGNKDWYVD--IMRYLILFS-TIIPVSLRVNLDLGKSVYARQIEHDATIPDT 479
            V+ A    G + + V+  +  Y I  + ++IP SL V L +  S  A+ +       + 
Sbjct: 294 AVIFAIVVMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVM----ATRNV 349

Query: 480 IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTVSY---------TMDTMD 527
           IVR     E LG +  + SDKTGTLTQ  M  K++     GT++          T+  + 
Sbjct: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIH 409

Query: 528 IVTDY--VQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTL-------AICHNVTPTFEDG 578
           ++  +   Q                 K L   +  L V+L       A   N+   F+D 
Sbjct: 410 LIPKFSPYQYKHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDS 469

Query: 579 ELTYQAA--SPDEIAIVKFTESVGLS---LFKRDRHSVSLFHQHSATNFEYDILQVFPFN 633
           E     A   P EIAI  F   + L    L   D+       + +  N  ++ +  FPF+
Sbjct: 470 ETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDD----EKDARANSSFEHVAEFPFD 525

Query: 634 SDTKRMGII---VYDKVKGEHWFMQKGADTVMARIVQSND-WL---DEEVGNMAREGLRT 686
           S  KRM  I     D     +    KGA     R++Q  D W    D +   +++E L T
Sbjct: 526 SSVKRMSAIYKNTEDPATPIYEVFTKGA---FERVLQCCDSWYTTPDGKPSPLSKEDLET 582

Query: 687 LVIGRKKLSPKSYE--QFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKL 744
           +      LS +      F K+  + S    N+D+ +    +  +E  L  LGL G+ D  
Sbjct: 583 IQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKE--RDFVECKLTFLGLIGIYDPP 640

Query: 745 QNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNA 804
           + +  ++++    AG+ + MLTGD   TA+ ++    ++    Y +       P+  +N 
Sbjct: 641 RQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY-------PKEVVNF 693

Query: 805 LEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREI 864
           +     +              F     QE  D+ V LP VIA RC PQ K  +   +   
Sbjct: 694 MVMAATD--------------FDALSDQEIDDLRV-LPLVIA-RCAPQTKVRMIEALHRR 737

Query: 865 TGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900
           +  + C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 738 S--KFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDAS 775

>Kwal_26.9207
          Length = 1469

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 143/630 (22%), Positives = 252/630 (40%), Gaps = 137/630 (21%)

Query: 423  IVLVAFAGFG---------NKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHD 473
            + L+A AGF             + V I+R L + + ++P +L   L +G S    +++  
Sbjct: 706  MTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKK 765

Query: 474  A--TIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHL----GTVSYTMDTMD 527
                I  T V  S      G+I+ +  DKTGTLT++ + +  +H+    G  ++    + 
Sbjct: 766  GIFCIAPTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL- 818

Query: 528  IVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASP 587
             +T+ V+ L                 +  + R+ +V+L  CH++     DGEL      P
Sbjct: 819  -ITN-VRGLFNKYSLND-----CGSPIDFKSRNFLVSLLTCHSLRVV--DGELL---GDP 866

Query: 588  DEIAIVKFT--------ESVGLSLFKRDRHSVSLFHQHSAT------------------N 621
             +  + +FT        +         +R++ S   +++                    N
Sbjct: 867  LDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTEN 926

Query: 622  FEYDILQV---FPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEE 675
              +++L V   F F S+ +RM +IV    +   W   KGA  V++ I   +      ++ 
Sbjct: 927  DPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQI 986

Query: 676  VGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELL 735
            +      G R +    K L PK   +F ++                 V ++ +E N+E L
Sbjct: 987  LQQYTHNGYRVIACAGKTL-PKRTWRFAQK-----------------VSREEVESNMEFL 1028

Query: 736  GLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQ-YVHTVTK 794
            G    E+KL+     ++  L++AG++  M TGD V TA  V   + LI+    +V  +  
Sbjct: 1029 GFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQIND 1088

Query: 795  LSRPEGALNALEYLKINKSSC-LLIDGESL---------------GMFLTYYKQ-----E 833
               P   L     +  +   C L++DG +L                +F   +K      E
Sbjct: 1089 NMDPNEDL----IIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPE 1144

Query: 834  FFDIVVDLPAVIACRCTPQQKADVALLIREITGKR--VCCIGDGGNDVSMIQCADVGVGI 891
             +  +V L + I  R +P +K +   L+ ++ G    V   GDG ND   ++ ADVGV +
Sbjct: 1145 SYINMVLLKSSIYARMSPDEKHE---LVGQLQGLDYVVGFCGDGANDCGALKAADVGVSL 1201

Query: 892  VGKEGKQASLAADFSVTQF---CHLTKLLLWHGRNSYKRSAKLAQF-------------- 934
               E   AS+AA F+ + F   C L   ++  GR S   S    Q+              
Sbjct: 1202 SEAE---ASVAAPFTSSVFEISCILD--VIKEGRASLTTSFSCFQYMSLYSAIQFVTVTM 1256

Query: 935  VIHRGLIISVCQAVYSVCSKFEPIALYQGW 964
            +  RG+ +   Q +Y       PIA++  W
Sbjct: 1257 LYSRGINLGDFQFLYIDLFLIVPIAIFMSW 1286

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 173/770 (22%), Positives = 301/770 (39%), Gaps = 201/770 (26%)

Query: 191 KFFFNLY---FLLVALSQAIPALRIGYLSSYI-VPLAFVLMVTMSKEAMDDIQRRQRDKE 246
           KF  N      +L+ +  AI ++ +G +   I + +A V++VT+       +Q  + +K 
Sbjct: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGF-----VQEYRSEKS 149

Query: 247 SNNELYEVLNKAQLVPSK---------------DLKVGDLIKIHKGTRIPADLVLLQSSE 291
                 E LNK  LVP +               +L  GDL++   G RIPAD+ +++ ++
Sbjct: 150 -----LEALNK--LVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECND 202

Query: 292 PSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYK 351
            +    I    L GETD                            P    ++ L + +Y 
Sbjct: 203 LT----IDESNLTGETD----------------------------PVHKSYKALSRDSYN 230

Query: 352 DSSSNALSV---DNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTGLLE 404
           D  ++ + V    N  +  T L   G+  G VV TG +T       M +++   KT L +
Sbjct: 231 DQPNSIVPVAERTNIAYMGT-LVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPL-Q 288

Query: 405 LEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIMRYLILFSTIIPVSLRVNLD 460
           L ++ L K L    FV+  ++        + W     + +   +      +P+ + V L 
Sbjct: 289 LTMDKLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLA 348

Query: 461 LGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL-HLGTV 519
           LG    A++          IVR     E LG +  + SDKTGTLT N M + K+  LG++
Sbjct: 349 LGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSM 400

Query: 520 SYTMDTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGE 579
           +  ++ + +  +    L              K  L + V+  ++   +C+N + + E  +
Sbjct: 401 ANKLNVLSLDKNKGGNL--------------KNYLTDDVKTTLLCGNLCNNASYSQEHAK 446

Query: 580 LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRM 639
                 +P ++A+++  +   L+    D  S            EY  ++   FNS  K M
Sbjct: 447 YL---GNPTDVALLEQLQKFELA----DVRS------------EYTKVKELSFNSKRKMM 487

Query: 640 GIIVYDKVKGEHWFMQKGADTVMARIV-QSNDWLDEE-----------------VGNMAR 681
              + D  K    F+ KGA     RI+ +S+ +L E+                    +A 
Sbjct: 488 ATKIQDNEKKTTLFI-KGA---FERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLAS 543

Query: 682 EGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVE 741
           EGLR L   ++ ++  S +    +  D                       L   GL G+ 
Sbjct: 544 EGLRVLAFAKRAMTDSSSKLVEDDISD-----------------------LVFTGLIGMN 580

Query: 742 DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP--E 799
           D  ++ VK +I+     G+ I M+TGD   TA               V+   ++  P  +
Sbjct: 581 DPPRSSVKFAIDQFLQGGIHIIMITGDSENTA---------------VNIARQIGIPVID 625

Query: 800 GALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVAL 859
             L+ L   K+N+ +                  +    V+D   + A R TP+ K ++  
Sbjct: 626 PKLSVLSGDKLNEMT-----------------DDQLANVIDHVNIFA-RATPEHKLNIVR 667

Query: 860 LIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVT 908
            +R   G  V   GDG ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 668 ALRR-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 184/778 (23%), Positives = 300/778 (38%), Gaps = 179/778 (23%)

Query: 254 VLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQS-SEPSGESFIKTDQLDGETDWKLR 312
           V+  AQ+VP      GD++++  G  +PADL L+++ +  + E+ +  + L    D    
Sbjct: 144 VMASAQVVP------GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKD---- 193

Query: 313 VACSLTQNLSTDDLLNKISITASSPEKS------------------IHRFLGKLTYKDSS 354
            A    Q+    D LN ++  +S+  K                        GK +     
Sbjct: 194 PAAVFEQDTPVGDRLN-LAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRD 252

Query: 355 SNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKIL 414
            N   + NT+   TV ASVGS +G  V T                   L  ++  L+ IL
Sbjct: 253 ENKSGLQNTVL--TVKASVGSFLGTNVGTP------------------LHRKLAKLALIL 292

Query: 415 CACVFVLSIVLVAFAGF-GNKDWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYARQIEH 472
            A   + +++++A   F  N++    +  Y I  + ++IP SL V L +  S  A+ +  
Sbjct: 293 FAIAVLFALIVMATQKFIVNRE----VAIYAICVALSMIPSSLVVVLTITMSAGAKVM-- 346

Query: 473 DATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTV---------- 519
             +  + IVR     E LG +  + SDKTGTLTQ  M LK+L     GTV          
Sbjct: 347 --STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFD 404

Query: 520 ---------------SYTMDT---MDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDL 561
                           Y  D    + I+ ++ Q                 K L  R  + 
Sbjct: 405 PTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRW---------QSNSLPKGLNPRKFES 455

Query: 562 VVTLAICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESV-----GLSLFKRDRHSVSLF 614
            +  A   N+   F+D +     A   P EIAI  F   +      L+  + +  S S  
Sbjct: 456 WLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQ 515

Query: 615 HQHSATNFEYDILQVFPFNSDTKRMGII---VYDK------VKGE---------HWFMQK 656
              +A  +E+     FPF+S  KRM  +   + DK       KG           W +  
Sbjct: 516 QNDAARIYEH--AAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDP 573

Query: 657 GADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNR 716
           G            + + + V  ++ EGLR L    K +  +  E   +         L +
Sbjct: 574 GTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------LTK 625

Query: 717 DETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCV 776
           D       +  +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ +
Sbjct: 626 D-------RDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAI 678

Query: 777 SISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFD 836
           +    ++    Y +       P+  ++ +        S  L D E              D
Sbjct: 679 AQEVGILPHNLYHY-------PKEVVDIMVMTATQFDS--LTDEE-------------LD 716

Query: 837 IVVDLPAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGVGIVG 893
            +  LP VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+ + G
Sbjct: 717 QLPVLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAM-G 770

Query: 894 KEGKQASLAADFSVTQFCHLTKLL--LWHGRNSYKRSAKLAQFVIHRGLIISVCQAVY 949
             G   +  A   V    +   +L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 771 INGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAANVAQAIY 824

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 165/729 (22%), Positives = 292/729 (40%), Gaps = 157/729 (21%)

Query: 193 FFNLYFLLVALSQAIPALRIGYLSSYI-VPLAFVLMVTMSKEAMDDIQRRQRDKESNNEL 251
           F     +L+ +  A+ +  IG +   + + LA +++VT+       IQ  + +K      
Sbjct: 102 FVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGF-----IQEYRSEKS----- 151

Query: 252 YEVLNKAQLVPSK---------------DLKVGDLIKIHKGTRIPADLVLLQSSEPSGES 296
            E LNK  LVP+K               +L  GDL++   G RIPAD+ ++++ + S   
Sbjct: 152 LEALNK--LVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLS--- 206

Query: 297 FIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSN 356
            I    L GET+   + A    Q +  ++  N+        E+S   ++G L  +     
Sbjct: 207 -IDESNLTGETEPLHKDA----QTIDPEEYDNR---NVPVSERSCIAYMGTLVKE----- 253

Query: 357 ALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTGLLELEINSLSK 412
                            G   G V+ TGT+T       M  ++   KT L E      ++
Sbjct: 254 -----------------GHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQETMDRLGTE 296

Query: 413 ILCACVFVLSIVLVAFAGFGNK---DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQ 469
           +     F+++I+ +     GN     + V +   +      +P+ + V L LG     +Q
Sbjct: 297 LSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQ 356

Query: 470 IEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIV 529
                   + IVR     E LG +  + +DKTGTLT N M + KL      + +D+    
Sbjct: 357 --------NAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKL------FCLDSSGTY 402

Query: 530 TDYVQELVXXXXXXXXXXXXAKKDL-PNRVRDLVVTLAICHNVTPTFEDGELTYQAASPD 588
            + +                ++ D+  N V++ +    IC+N   + E         +P 
Sbjct: 403 ENAISP-----------EEDSEFDVHDNDVKETLTIANICNNAKYSEEH---NLYIGNPT 448

Query: 589 EIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVK 648
           ++A+++     G+   +RD H               + ++   FNS  K M  I   K  
Sbjct: 449 DVALIEVLTKFGIP-DQRDSH---------------EKMEELSFNSKRKYMA-IKSSKES 491

Query: 649 GEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHD 708
           GEH    KGA     RI+  + +  ++ G +      + V+  +     + +  R     
Sbjct: 492 GEHVLYIKGA---FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLR----- 543

Query: 709 ASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGD 768
            +++   +     +VI +   + L   GL G+ D  + +VK+SIE L   GV I M+TGD
Sbjct: 544 -TIACAFKPTDSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGD 602

Query: 769 KVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLT 828
            V TA  VSI+ K+                         L +      ++ G+     ++
Sbjct: 603 SVNTA--VSIAEKI------------------------GLSVQDRESSVMTGDK----VS 632

Query: 829 YYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVG 888
              ++    V+D   + A R TP+ K ++   +R+  G  V   GDG ND   ++ AD+G
Sbjct: 633 ELTEDELSKVIDKVNIFA-RATPENKLNIVKALRK-RGDIVAMTGDGVNDAPALKLADIG 690

Query: 889 V--GIVGKE 895
           +  GI G +
Sbjct: 691 IAMGISGTD 699

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 113/556 (20%), Positives = 221/556 (39%), Gaps = 101/556 (18%)

Query: 417  CVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476
             +F   +  V F   G  D    I+R L + + ++P +L   L +G +    +++     
Sbjct: 704  AIFGFCVSCVQFIKLG-LDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIF 762

Query: 477  PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTM--DIVTDYVQ 534
              +  R +      G+I+ +  DKTGTLT++ + +  + +   +        ++++D  Q
Sbjct: 763  CISPTRLNIS----GKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQ 818

Query: 535  ELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVK 594
                               L  + R+  ++L  CH++     DG L      P +  + +
Sbjct: 819  VF------PKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQ 867

Query: 595  FT--------ESVGLSLFKRDRHSVSLFHQHS----------ATNFE-----------YD 625
            FT        +          RH   +F ++S          + N E             
Sbjct: 868  FTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLG 927

Query: 626  ILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEEVGNMARE 682
            +++ F F S+ +RM +IV       +W   KGA  V++ I   +      +E +      
Sbjct: 928  VVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHN 987

Query: 683  GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
            G R +    K L  +++   +K                  V ++ +E NLE LG    ++
Sbjct: 988  GYRVIACAGKTLPKRTWLYSQK------------------VSREEVESNLEFLGFIIFQN 1029

Query: 743  KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS--------------RGQY 788
            KL+ +   +++ L++A ++  M TGD + TA  V   A LI                G+ 
Sbjct: 1030 KLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEP 1089

Query: 789  VHTVTKLSRPEGALN--ALEYLKINKSSC---------LLIDGESLGMFL---TYYKQEF 834
            V     ++ P+  L+   L+ +K+  +S          L + G+   +         +E+
Sbjct: 1090 VIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEY 1149

Query: 835  FDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGK 894
             + ++ L + I  R +P +K ++ + ++++      C GDG ND   ++ ADVG+ +   
Sbjct: 1150 LNEIL-LNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEA 1207

Query: 895  EGKQASLAADFSVTQF 910
            E   AS+AA F+   F
Sbjct: 1208 E---ASVAAPFTSKIF 1220

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 180/772 (23%), Positives = 299/772 (38%), Gaps = 203/772 (26%)

Query: 186 LYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-VPLAFVLMVTMSKEAMDDIQRRQR 243
           L+++F   F     +L+ +  A+ +L +G +   + + LA  ++VT+       +Q  + 
Sbjct: 84  LFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGF-----VQEYRS 138

Query: 244 DKESNNELYEVLNKAQLVPSK---------------DLKVGDLIKIHKGTRIPADLVLLQ 288
           +K       E LNK  LVP++                L  GDL+    G RIPAD+ +++
Sbjct: 139 EKS-----LEALNK--LVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIE 191

Query: 289 SSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKL 348
           + + S    I    L GE +   + + ++ ++   D   + + I+    E+S   ++G L
Sbjct: 192 AIDLS----IDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPIS----ERSCIAYMGTL 243

Query: 349 TYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTGLLE 404
             +                      G   G VV TGT+T       M   +   KT L +
Sbjct: 244 VKE----------------------GHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPL-Q 280

Query: 405 LEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNL 459
           L ++ L K L    F++ I ++   G      ++++ +  +  +       +P+ + V L
Sbjct: 281 LTMDKLGKDLSLVSFIV-IGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTL 339

Query: 460 DLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTV 519
            LG    A++          IVR     E LG +  + SDKTGTLT N M + KL     
Sbjct: 340 ALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL----- 386

Query: 520 SYTMDTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGE 579
            + +D+M        +L             +  +L N          +  +V  T   G 
Sbjct: 387 -WCLDSMS------NKLNVLSLDKNKKTKNSNGNLKNY---------LTEDVRETLTIGN 430

Query: 580 LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEY-DI------LQVFPF 632
           L   A+   E AI           F  +   V+L  Q +  NFE  DI      +Q  PF
Sbjct: 431 LCNNASFSQEHAI-----------FLGNPTDVALLEQLA--NFEMPDIRNTVQKVQELPF 477

Query: 633 NSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQ-SNDWL------------------D 673
           NS  K M   + + V  +     KGA     RI++ S  +L                  +
Sbjct: 478 NSKRKLMATKILNPVDNKCTVYVKGA---FERILEYSTSYLKSKGKKTEKLTEAQKATIN 534

Query: 674 EEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLE 733
           E   +MA EGLR     +  LS                         S+ + + L  +L 
Sbjct: 535 ECANSMASEGLRVFGFAKLTLSDS-----------------------STPLTEDLIKDLT 571

Query: 734 LLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVT 793
             GL G+ D  + +VK +IE L   GV I M+TGD   TA               V+   
Sbjct: 572 FTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA---------------VNIAK 616

Query: 794 KLSRP--EGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTP 851
           ++  P  +  L+ L   K+++ S                  +    V+D   + A R TP
Sbjct: 617 QIGIPVIDPKLSVLSGDKLDEMS-----------------DDQLANVIDHVNIFA-RATP 658

Query: 852 QQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900
           + K ++   +R+  G  V   GDG ND   ++ +D+GV  G +G +  K+AS
Sbjct: 659 EHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEAS 709

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 150/669 (22%), Positives = 260/669 (38%), Gaps = 154/669 (23%)

Query: 269 GDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLN 328
           GDL+    G RIPAD+ +++S++ S    +    L GET+  +  +C+   + +  D+  
Sbjct: 178 GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE-PVHKSCTPVNSATYSDVPG 232

Query: 329 KISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTR 388
            I       E++   ++G L  +                      G   G VV TG  T 
Sbjct: 233 GIIPIG---ERTSIAYMGTLVRE----------------------GHGKGIVVATGKHTM 267

Query: 389 -QAMNTTMSSVKTGL--LELEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIM 441
             A+   M+S++     L++ +++L + L    FVLS ++        + W     + + 
Sbjct: 268 FGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVS 327

Query: 442 RYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKT 501
             +      +P+ + V L LG    A +          IVR     E LG +  + SDKT
Sbjct: 328 LAVAAIPEGLPIIVTVTLALGVLRMANR--------KAIVRRLPSVETLGSVNVICSDKT 379

Query: 502 GTLTQNDMQLKKL-HLGTVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRD 560
           GTLT N M   K+  LG+++   + + +       L              K  L + V+ 
Sbjct: 380 GTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGL-------PGKLPNLKNYLSDDVKA 432

Query: 561 LVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSAT 620
            +   +IC+N + + E G+      +P +IA+++  +   L                  T
Sbjct: 433 TLRIGSICNNASFSHEHGKYL---GNPTDIALLEVLQKFDLV-------------DERPT 476

Query: 621 NFEYDILQVFPFNSDTKRMGIIVYDKVK-GEHWFMQKGADTVMARIVQSN---------- 669
               D L    FNS  K M + V      G+H    KGA     RI++ +          
Sbjct: 477 TTRVDELT---FNSKRKYMAVKVDSPANSGKHIIYVKGA---FERILERSASFIGGAGKV 530

Query: 670 --------DWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMS 721
                     +++   ++A EGLRTL   + + S        K  +D+++          
Sbjct: 531 EKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN------KPMNDSTI---------- 574

Query: 722 SVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVS--IS 779
                    NL  +GL G++D  ++ V+ +IE L   GV + M+TGD   TA  ++  I 
Sbjct: 575 --------QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG 626

Query: 780 AKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVV 839
             +I+    V T  +L +                   + D +  G             V+
Sbjct: 627 IPVINPEISVLTGDRLDQ-------------------MTDDQLAG-------------VI 654

Query: 840 DLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQA 899
           D   + A R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +       A
Sbjct: 655 DHVNIFA-RATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVA 712

Query: 900 SLAADFSVT 908
             A+D  +T
Sbjct: 713 KEASDMVLT 721

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 176/715 (24%), Positives = 283/715 (39%), Gaps = 157/715 (21%)

Query: 261 VPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACS-- 316
           + SK+L  GD+  I  G  +PADL L ++        ++TD+  L GE+   L VA S  
Sbjct: 143 IESKELVPGDICIIRVGDTVPADLRLFEAIN------LETDEALLTGES---LPVAKSHG 193

Query: 317 --LTQNLSTDDLLNKISITASSPEK----------SIHRFLGKLTYKDSSSNAL------ 358
               Q+    D LN ++  AS+  K          +++  +GK+     S  +L      
Sbjct: 194 EVYEQDTPVGDRLN-LAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSEASLISRDKS 252

Query: 359 -SVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMN----------TTMSSVKTGLLELEI 407
            S    +W  T+  S+G+ +G  V  GT   + ++             + V  G  + ++
Sbjct: 253 KSFGRNLWI-TLRESIGTFLGTSV--GTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKV 309

Query: 408 NSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYA 467
           N    I   CV +                            ++IP SL V L +  S  A
Sbjct: 310 NKQVAIYAICVAL----------------------------SMIPSSLVVVLTITMSAGA 341

Query: 468 RQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTVSY--- 521
           + +         I+R     E LG +  + SDKTGTLTQ  M  K++     GT++    
Sbjct: 342 KVM----ATRHVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNS 397

Query: 522 ------TMDTMDIVTDY--VQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTL-------A 566
                 T+  + ++  +   Q                 K   + +  L V+L       A
Sbjct: 398 NEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTA 457

Query: 567 ICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLS---LFKRDRHSVSLFHQHSATN 621
              N+   F D E     A   P EIAI  F   + L    L   D       + H+   
Sbjct: 458 TLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLPRRVLTGEDNDDEK--NIHNDIT 515

Query: 622 FEYDILQVFPFNSDTKRMGIIVYDKVKGE----HWFMQKGADTVMARIVQS-NDWLDEEV 676
           FE+  +  +PF+S  KRM  I Y  V+      +    KGA     R++Q  N W     
Sbjct: 516 FEH--VAEYPFDSSVKRMSAI-YKNVEEPKAPIYEVFTKGA---FERVLQCCNSWYTTPD 569

Query: 677 GN---MAREGLRTLVIGRKKLSPKSYE--QFRKEYHDASLSMLNRDETMSSVIKKHLEHN 731
           G+   +  E L T+      LS +      F K+  + S   +N+D+ +    +  +E+N
Sbjct: 570 GSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQFTINKDKLLKE--RDFVENN 627

Query: 732 LELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHT 791
           L  LGL G+ D  + +  ++++    AG+ + MLTGD   TA+ ++    ++    Y + 
Sbjct: 628 LTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY- 686

Query: 792 VTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTP 851
                 P+  +N +     +              F     +E  ++ V LP VIA RC P
Sbjct: 687 ------PKEVVNFMVMTATD--------------FDALSDKEIDELPV-LPLVIA-RCAP 724

Query: 852 QQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900
           Q K  +  AL  R     R C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 725 QTKVRMIEALHRR----NRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDAS 775

>Scas_707.48*
          Length = 741

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 171/764 (22%), Positives = 296/764 (38%), Gaps = 181/764 (23%)

Query: 186 LYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-VPLAFVLMVTMSKEAMDDIQRRQR 243
           L+++F   F     +L+ +  A+ +  +G +   + + LA V++V++       +Q  + 
Sbjct: 84  LWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVIVVSVGF-----VQEYRS 138

Query: 244 DKESNNELYEVLNKAQLVPSK---------------DLKVGDLIKIHKGTRIPADLVLLQ 288
           +K       E LNK  LVP++                L  GDL+    G RIPADL +++
Sbjct: 139 EKS-----LEALNK--LVPAECHLIRCGQESHVLASGLVPGDLVHFKIGDRIPADLRIIE 191

Query: 289 SSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKL 348
           + + S    I    L GE +   + A  + ++   D   + I I+    +++   ++G L
Sbjct: 192 AVDLS----IDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPIS----DRTCVAYMGTL 243

Query: 349 TYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEIN 408
             K+     + V   +  NT   ++   +  +    T  + AM+                
Sbjct: 244 V-KEGHGKGIVVG--IGKNTSFGAIFEMLSNIEKPKTPLQNAMD---------------- 284

Query: 409 SLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGK 463
            L K L    F++ I L+   G      ++++ +  +  +       +P+ + V L LG 
Sbjct: 285 KLGKDLSLFSFIV-IGLICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGV 343

Query: 464 SVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTM 523
              A++          IVR     E LG +  + SDKTGTLT N M   K+      + +
Sbjct: 344 LRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKI------WCL 389

Query: 524 DTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQ 583
           D+M    + +                 K  L   V+  +    IC+N + + E G+    
Sbjct: 390 DSMANKANVLS-------LEKSKSGSLKNYLTEDVKSTLTIGNICNNASFSQEHGKYL-- 440

Query: 584 AASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIV 643
             +P +IA+++      LS  +                  +  +Q  PFNS  K M + +
Sbjct: 441 -GNPTDIALLEQLSKFDLSDIRP----------------TFKKVQEIPFNSKRKFMAVKI 483

Query: 644 YDK-------VKG---------EHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTL 687
            +        VKG          H+  QKG    + +     D + E   ++A EGLR L
Sbjct: 484 VNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQ--GQRDVIIETANSLASEGLRML 541

Query: 688 VIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQND 747
              +  L P S               L  +E++  +I           GL G+ D  +  
Sbjct: 542 AFAKTTL-PDS-------------PTLLTEESVGDLI---------FTGLIGMNDPPRPT 578

Query: 748 VKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP--EGALNAL 805
           VK +IE L   GV I M+TGD   TA               V+   ++  P  +  L+ L
Sbjct: 579 VKPAIEQLLQGGVHIIMITGDSENTA---------------VNIARQIGIPVLDPKLSVL 623

Query: 806 EYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREIT 865
              K+N+ S                  +    V+D   + A R TP+ K ++   +R+  
Sbjct: 624 SGDKLNEMS-----------------DDQLANVIDHVNIFA-RATPEHKLNIVRALRK-R 664

Query: 866 GKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVT 908
           G  V   GDG ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 665 GDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMVLT 707

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/400 (24%), Positives = 168/400 (42%), Gaps = 76/400 (19%)

Query: 585 ASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYD-ILQVFPFNSDTKRMGIIV 643
            S  E A++ F +    SL  +D H +    +   ++   D ++QV PF S  K   I V
Sbjct: 597 GSKTETALLAFAQK---SLGMKDVHKL----RTKPSDLGIDKVVQVIPFESSRKWGAIAV 649

Query: 644 YDKVKGEHWFMQKGADTVMARIV--QSN----------DWLDE---EVGNMAREGLRTLV 688
                  + F  KGA  ++ ++   Q N          D  DE   ++ +MA   LRT+ 
Sbjct: 650 QLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQDMASHALRTIS 709

Query: 689 IGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSS---VIKKHLEH-NLELLGLT-----G 739
           +  +       E   KE+ D++      D +++S   V+   L+H NL   G+T     G
Sbjct: 710 LVHRDFK----EWPPKEFADST------DPSIASPDLVMGHELDHKNLSSEGMTLDAMVG 759

Query: 740 VEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPE 799
           ++D L+  VK S+E  + AGV + M+TGD + TAR +S +  ++S   Y       + PE
Sbjct: 760 LQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY-------NDPE 812

Query: 800 GALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAV-IACRCTPQQKADVA 858
            A+    + K+     L +                      +P + +  R +P+ K  + 
Sbjct: 813 CAMEGPTFRKLPYKKMLRV----------------------IPKLRVLARSSPEDKRILV 850

Query: 859 LLIREITGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSVTQFCHLTKL 916
             ++++ G+ V   GDG ND   ++ ADVG  +GI G E  + +         F  +   
Sbjct: 851 ETLKKM-GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNA 909

Query: 917 LLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFE 956
           + W GR       K  QF +   +   +   V +V S  E
Sbjct: 910 IKW-GRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEE 948

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 105/285 (36%), Gaps = 49/285 (17%)

Query: 259 QLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLT 318
            L+   DL VGD+I +  G  +PAD VL+  S    ES      L GE+D   +VA    
Sbjct: 250 HLISIHDLLVGDVISLQTGDVVPADAVLISGSCECDES-----ALTGESDTIKKVALKPA 304

Query: 319 QNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMW----ANTVLASVG 374
                  L     I    P   I    G     +   + L +  +       N V+ SVG
Sbjct: 305 -------LEKYKQIFEKDPTIDI----GSHGVGEKVPDPLLISGSKLLSGIGNAVITSVG 353

Query: 375 SCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKI-LCACVFVLSIVLVAFAGF-- 431
                      + R  M     S  T L E   N    I +  C+  L + ++ F  F  
Sbjct: 354 E-------NSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLT 406

Query: 432 --GNKDWYVDI------MRYLILF-------STIIPVSLRVNLDLGKSVYARQIEHDATI 476
              N   Y D+       +++ +F          +P  L + + L  +    ++  D   
Sbjct: 407 YLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDG-- 464

Query: 477 PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY 521
              +VR     E +G    + SDKTGTLT+N M + K   G + +
Sbjct: 465 --NLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGF 507

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 87/360 (24%), Positives = 147/360 (40%), Gaps = 73/360 (20%)

Query: 626 ILQVFPFNSDTKRMGIIV-YDKVKGE---HWFMQKGADTVMARIV----QSNDWL----- 672
           ++Q  PF S  K  G++V Y + K +   + F  KGA  ++++       S+D L     
Sbjct: 609 VVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINE 668

Query: 673 ------DEEVGNMAREGLRTLVIGRKKLS-----PKSYEQFRKEYHDASLSMLNRDETMS 721
                 D+E+ N+A + LR + +  K        P    + +   + A+L +L   +   
Sbjct: 669 DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQ--- 725

Query: 722 SVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAK 781
                     L L GL G++D L+  V+ S++  + AGV + M+TGD +       ++AK
Sbjct: 726 --------KGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNI-------LTAK 770

Query: 782 LISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDL 841
            I+R   + +    S    A+   E+ K+ K+  + I                      L
Sbjct: 771 AIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRI----------------------L 808

Query: 842 PAV-IACRCTPQQKADVALLIREITGKR--VCCIGDGGNDVSMIQCADVG--VGIVGKEG 896
           P + +  R +P+ K    LL+  + G    V   GDG ND   ++ ADVG  +GI G E 
Sbjct: 809 PNLRVLARSSPEDK---RLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEV 865

Query: 897 KQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFE 956
            + +         F  +   + W GR       K  QF +   +   +   V SV S  E
Sbjct: 866 AREASDIILMTDDFSAIVNAIKW-GRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDE 924

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 130/323 (40%), Gaps = 36/323 (11%)

Query: 219 IVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQ--LVPSKDLKVGDLIKIHK 276
           ++ +  V++V+ + +   ++Q  + +K+  N    V+   Q  L+    + VGD+I +  
Sbjct: 161 MIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQT 220

Query: 277 GTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASS 336
           G  +PAD V++     + ES I      GE++          Q    D+ L       S 
Sbjct: 221 GDVVPADCVMISGKCEADESSIT-----GESN--------TIQKFPVDNSLRDFKKFNSI 267

Query: 337 PEKSIHRFLGKLTYKDSSSNALSVDNTMW--ANTVLASVGSCIGCVVYTGTDTRQAMNTT 394
                H     L   D + +   + + M    + +L+ +G  +   V   +   Q M + 
Sbjct: 268 DS---HNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSL 324

Query: 395 MSSVKTGLLELEINSLSKILC--ACVFVLSIVLVAF-----------AGFGNKDWYVDIM 441
            +  ++  L+L ++ L+  +    CV  + + LV F             F + D      
Sbjct: 325 NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGS 384

Query: 442 RYLILFST---IIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLS 498
           +++ +F T   +I V++   L L  ++         T    +VR     E +G    + S
Sbjct: 385 KFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCS 444

Query: 499 DKTGTLTQNDMQLKKLHLGTVSY 521
           DKTGTLT+N M + +   G   +
Sbjct: 445 DKTGTLTENVMTVVRGFPGNSKF 467

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 164/711 (23%), Positives = 277/711 (38%), Gaps = 177/711 (24%)

Query: 231 SKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSS 290
           S EA++ +   +     + +L  VL  + LVP      GDL++   G RIPADL +++S 
Sbjct: 136 SLEALNKLVPAECHLTRSGQLSHVL-ASNLVP------GDLVRFKVGDRIPADLRIVESI 188

Query: 291 EPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTY 350
           +                       C    NL+ ++             + +H+  G +  
Sbjct: 189 D----------------------LCVDESNLTGEN-------------EPVHKSSGAVDP 213

Query: 351 KDSSSNALSV-----DNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTG 401
           K+ S    S+      N +     L   G   G V+ TG  T       M + +   KT 
Sbjct: 214 KNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTP 273

Query: 402 LLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIMRYLILFSTIIPVSLRV 457
           L +  ++ L + L    FVL  ++        + W     + +   +      +P+ + V
Sbjct: 274 L-QTAMDKLGQDLSYMSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTV 332

Query: 458 NLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG 517
            L LG    A++          IVR     E LG +  + SDKTGTLT N M + K+   
Sbjct: 333 TLALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKI--- 381

Query: 518 TVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXAKKDLPNRV-RDLVVTLA---ICHNVTP 573
              + + +M+  T+ +                  K+ P ++ +D+  TL    IC+N   
Sbjct: 382 ---WCLGSMENKTNCL-------------ALSKVKERPIKMEQDVATTLRIGNICNN--G 423

Query: 574 TFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFN 633
           T+    L Y   +P +IAI++  +  G++     R+SV+  ++              PFN
Sbjct: 424 TYSQEHLKY-LGNPTDIAILESLQHFGIN---DCRNSVNKINE-------------IPFN 466

Query: 634 SDTKRMGIIVYDK-------VKG------EHWFMQKGADTVMARIVQSND--WLDEEVGN 678
           S  K M +   D        VKG      E      G D  + ++ + ND   +++    
Sbjct: 467 SKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKL-KPNDKAIINDAAVA 525

Query: 679 MAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLT 738
           +A EGLRTL     ++S    +   KE+++                   +   L   GL 
Sbjct: 526 LASEGLRTLAFAELEVSATHGD---KEFNE------------------DMVEGLTFTGLI 564

Query: 739 GVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP 798
            + D  +  V+S+IE L    V + M+TGD   TA  VSI+ ++            +  P
Sbjct: 565 AMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTA--VSIARQI---------GIPVINP 613

Query: 799 EGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVA 858
           E +               ++ G+ L         +    V+D   V A R TP+ K ++ 
Sbjct: 614 EYS---------------VLSGDKLDQM----TDDQLASVIDHVNVFA-RATPEHKLNIV 653

Query: 859 LLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVT 908
             +++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 654 RALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 702

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 105/428 (24%), Positives = 165/428 (38%), Gaps = 98/428 (22%)

Query: 491 GRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXA 550
           GRI+    DKTGTLT  D+  +    G    + D  DI   Y                 +
Sbjct: 477 GRIDVCCFDKTGTLTGEDLVFE----GLAGLSSDPKDIRHLY-----------------S 515

Query: 551 KKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 610
             D PN    LVV  A  H +    EDGE+         +  +K+T   G  +F      
Sbjct: 516 ATDCPNST-SLVVGAA--HALV-RLEDGEIVGDPMEKATLKALKWTVEKGDKVFNEKNGQ 571

Query: 611 VSLFHQHSATNFEYDILQVFPFNSDTKRMG-IIVYDKVKGEHWFMQKGA-DTVMARIVQS 668
           V+             IL+ F F+S  KR   +  +D   G+ +   KGA +T+  R+   
Sbjct: 572 VT-------------ILRRFQFSSALKRSSSVATHD---GKLYSAVKGAPETIRERLFTI 615

Query: 669 NDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHL 728
               DE   +  R G R L +  KKL   S  Q      DA               ++H 
Sbjct: 616 PANYDEIYKSFTRSGSRVLALASKKLEKMSQSQI----EDAD--------------REHF 657

Query: 729 EHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK----VETARCVSI------ 778
           E +LE  G       L++D   +I++L  +  +  M+TGD     V  A+ V I      
Sbjct: 658 ERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETL 717

Query: 779 ---------SAKLISRG-----QYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLG 824
                      KL+ R       +   V+K        ++ E   I     L + G +L 
Sbjct: 718 IVDMVDNGNDDKLVFRNVEETLSFEFVVSK--------DSFEKYGIFDKYDLAVTGHALE 769

Query: 825 MFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQC 884
               +++ +  D++    A I  R +P QK  +   ++++  + + C GDG NDV  ++ 
Sbjct: 770 ALKGHHQLQ--DLIRH--AWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQ 824

Query: 885 ADVGVGIV 892
           A VGV ++
Sbjct: 825 AHVGVALL 832

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 124/290 (42%), Gaps = 54/290 (18%)

Query: 626 ILQVFPFNSDTKRMGII-VYDKVKGEHWFMQKGA-DTVMARIVQSNDWLDEEVGNMAREG 683
           IL+ F F+S  KR   I V++K   +H+   KGA +T+  R+ Q     D+   +  R G
Sbjct: 577 ILRRFQFSSALKRSSTIAVHNK---QHYSAVKGAPETIRERLSQVPTDYDQVYKSFTRAG 633

Query: 684 LRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDK 743
            R L +  KKL   S +Q  K   +A                  +E +LE  G       
Sbjct: 634 SRVLALASKKLPSMSIKQIEKLEREA------------------VESDLEFKGFLVFHCP 675

Query: 744 LQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP-EGAL 802
           L++D   +I++L  +  +  M+TGD   TA  V+    ++ R   +     L  P +G+ 
Sbjct: 676 LKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLI-----LDEPIDGSS 730

Query: 803 NALEYLKINKSSCLLIDGESLGMFLTYYKQEFF---DIVVDLPAV--------------- 844
           +AL +  I ++     + E      T+   + F   DI V   A+               
Sbjct: 731 HALVFRNIEETIVNPFNPEK----DTFEHSKLFAKYDIAVTGHALQLLSGHSQLNELIRH 786

Query: 845 --IACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIV 892
             +  R +P QK  +   ++++  + + C GDG NDV  ++ A VG+ ++
Sbjct: 787 TWVYARVSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 835

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 99/479 (20%), Positives = 174/479 (36%), Gaps = 132/479 (27%)

Query: 429 AGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRT 483
           A F   +  V I+RY +  + +     +P  +   + +G +  A++          IV+ 
Sbjct: 292 ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQK 343

Query: 484 STIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVXXXXXX 543
            +  E L  +E L SDKTGTLT+N + L +       YT++ +D                
Sbjct: 344 LSAIESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVD---------------- 381

Query: 544 XXXXXXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSL 603
                      P+   DL++T  +                AAS  +  +    ++   SL
Sbjct: 382 -----------PD---DLMLTACL----------------AASRKKKGLDAIDKAFLKSL 411

Query: 604 FKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMA 663
               R   +L         +Y +L+  PF+  +K++  IV +  +GE     KGA   + 
Sbjct: 412 ISYPRAKAAL--------TKYKLLEFHPFDPVSKKVTAIV-ESPEGERIICVKGAPLFVL 462

Query: 664 RIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSV 723
           + V+    + E+V                          R+ Y +    + +R      V
Sbjct: 463 KTVEEEHPIPEDV--------------------------RENYENKVAELASRGFRALGV 496

Query: 724 IKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLI 783
            +K  E + E+LG+    D  ++D   ++   R+ G+++ MLTGD V  A+         
Sbjct: 497 ARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAK--------- 547

Query: 784 SRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPA 843
                  T  +L       NA             + G  L  F+      F ++      
Sbjct: 548 ------ETCRQLGLGTNIYNAERLGLGGGGD---MPGSELADFVE-NADGFAEVF----- 592

Query: 844 VIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLA 902
                  PQ K +V  ++++  G  V   GDG ND   ++ AD G+ + G      S A
Sbjct: 593 -------PQHKYNVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAA 643

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 101/434 (23%), Positives = 168/434 (38%), Gaps = 95/434 (21%)

Query: 491 GRIEYLLSDKTGTLTQNDM---QLKKLHLGTVSYTMDTMDIVTDYVQELVXXXXXXXXXX 547
           GRI+    DKTGTLT  D+    L  LH G+    + T+    D  QE++          
Sbjct: 478 GRIDVCCFDKTGTLTAEDLVFEGLAGLHDGS---DIRTLKSANDASQEVLS--------- 525

Query: 548 XXAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRD 607
                            +   H +    +DGE+      P E A +K       S +  D
Sbjct: 526 ----------------AIGAAHALV-KLDDGEIV---GDPMEKATLK------ASSWTVD 559

Query: 608 RHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQ-KGA-DTVMARI 665
              V    +  A N    IL+ F F+S  KR   I     +   +F   KGA +T+  R+
Sbjct: 560 FKDV--VKRAGADNIR--ILRRFQFSSSLKRSASIAS---QSNRFFAAVKGAPETIRERL 612

Query: 666 VQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIK 725
                  D+   +  R G R L +  K L   S  Q         +  ++RDE       
Sbjct: 613 NSVPSDYDDIYKSFTRSGSRVLALAYKDLPKMSNSQ---------IDNIDRDE------- 656

Query: 726 KHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISR 785
             +E  L           L++D   +I++L  +  +  M+TGD   TA  V+    ++ R
Sbjct: 657 --IETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDR 714

Query: 786 GQYV------------------HTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFL 827
              +                   T+ K   P+   +  +  +I +   L + G +L + L
Sbjct: 715 ETLILDEPIDGSSHALVMRDVNETIVKPFNPDA--DTFDEKEIFQKYDLAVTGHALKL-L 771

Query: 828 TYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADV 887
             +KQ   D++      I  R +P QK  + + ++++  + + C GDG NDV  ++ A V
Sbjct: 772 QGHKQ-LRDVIRH--TWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHV 827

Query: 888 GVGIVGKEGKQASL 901
           G+ ++   G + SL
Sbjct: 828 GIALL--NGTEDSL 839

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 104/271 (38%), Gaps = 59/271 (21%)

Query: 623 EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMARE 682
           +Y +L+  PF+  +K++  IV +  +GE     KGA   + + V+ N  + E+V      
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIV-ESPEGERIVCVKGAPLFVLKTVEENHLIPEDV------ 475

Query: 683 GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
                               ++ Y +    + +R      V +K  E + E+LG+    D
Sbjct: 476 --------------------KENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMD 515

Query: 743 KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGAL 802
             ++D   ++   R+ G+++ MLTGD V  A+                T  +L       
Sbjct: 516 PPRDDTAQTVNEARHLGLRVKMLTGDAVGIAK---------------ETCRQLGLGTNIY 560

Query: 803 NALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIR 862
           NA             + G  L  F+      F ++             PQ K +V  +++
Sbjct: 561 NAERLGLGGGGD---MPGSELADFVE-NADGFAEVF------------PQHKYNVVEILQ 604

Query: 863 EITGKRVCCIGDGGNDVSMIQCADVGVGIVG 893
           +  G  V   GDG ND   ++ AD G+ + G
Sbjct: 605 Q-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 438 VDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGR 492
           V I+RY +  + +     +P  +   + +G +  A++          IV+  +  E L  
Sbjct: 301 VTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKK--------KAIVQKLSAIESLAG 352

Query: 493 IEYLLSDKTGTLTQNDMQLKK 513
           +E L SDKTGTLT+N + L +
Sbjct: 353 VEILCSDKTGTLTKNKLSLHE 373

>Scas_583.14*
          Length = 875

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 101/427 (23%), Positives = 169/427 (39%), Gaps = 76/427 (17%)

Query: 491 GRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXA 550
           GRI+    DKTGTLT  D+  +    G    +  + D+   +  E               
Sbjct: 133 GRIDVCCFDKTGTLTGEDLVFE----GLAGLSDKSEDVRHLFSSE--------------- 173

Query: 551 KKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 610
                +  ++ ++ +   H +    +DGE+      P E A +K   ++G  +   D   
Sbjct: 174 -----DASQETILVVGAAHALV-KLDDGEIV---GDPMEKATLK---ALGWKVEGND--- 218

Query: 611 VSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGA-DTVMARIVQSN 669
              F     T  +  IL+ F F+S  KR   +   K K   +   KGA +T+  R+    
Sbjct: 219 ---FTSRPKTG-KLQILRRFQFSSALKRSSSVASHKDK--LFTAVKGAPETIRERLAVVP 272

Query: 670 DWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLE 729
              DE   +  R G R L +  K L   S +Q         L  L+RDE         +E
Sbjct: 273 KNYDEIYKSFTRSGSRVLALASKSLPNLSSKQ---------LDDLDRDE---------IE 314

Query: 730 HNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYV 789
             L   G       L+ D   +I++L  +  +  M+TGD   TA  V+    +++ G+ +
Sbjct: 315 TGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVT-GETL 373

Query: 790 HTVTKLSRPEGAL---NALEYLKI--NKSSCLLIDGESLGMF---LTYYKQEFFDIVVDL 841
                 +  +G L   N  E +KI  + +S      E    +   +T Y     +    L
Sbjct: 374 ILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQL 433

Query: 842 PAVIA-----CRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEG 896
             +I       R +P QK  +   ++E+  + + C GDG NDV  ++ A VGV ++   G
Sbjct: 434 KDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVALL--NG 490

Query: 897 KQASLAA 903
            + S+ A
Sbjct: 491 TEESMTA 497

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 92/222 (41%), Gaps = 44/222 (19%)

Query: 567 ICHNVTPTFEDGEL------TYQAASPDEIAIVKFTESVGLSLFKRDRHSV------SLF 614
           +C + T T    +L      T +  SPD++ +   T  +  S  K+   ++      SL 
Sbjct: 404 LCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML---TACLAASRKKKGLDAIDKAFLKSLI 460

Query: 615 HQHSATNF--EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWL 672
               A +   +Y +L+  PF+  +K++  +V +  +GE     KGA   + + V+ +  +
Sbjct: 461 EYPKAKDALTKYKVLEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEEDHPI 519

Query: 673 DEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNL 732
            E+V                           + Y +    + +R      V +K  E + 
Sbjct: 520 PEDV--------------------------HENYENKVAELASRGFRALGVARKRGEGHW 553

Query: 733 ELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETAR 774
           E+LG+    D  ++D   +I   RN G++I MLTGD V  A+
Sbjct: 554 EILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAK 595

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 65/148 (43%), Gaps = 17/148 (11%)

Query: 374 GSCIGCVVYTGTDT---RQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAG 430
           G     V  TG +T   R A     +S   G     +N +  IL   V + +++LV  A 
Sbjct: 283 GEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILLVLV-IATLLLVWTAC 341

Query: 431 FGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTST 485
           F      V I+RY +  + I     +P  +   + +G +  A++          IV+  +
Sbjct: 342 FYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQKLS 393

Query: 486 IPEDLGRIEYLLSDKTGTLTQNDMQLKK 513
             E L  +E L SDKTGTLT+N + L +
Sbjct: 394 AIESLAGVEILCSDKTGTLTKNKLSLHE 421

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 92/425 (21%), Positives = 166/425 (39%), Gaps = 92/425 (21%)

Query: 491 GRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVXXXXXXXXXXXXA 550
           GRI+    DKTGTLT  D+  +    G    + D+ +I   Y                 +
Sbjct: 479 GRIDVCCFDKTGTLTGEDLVFE----GLAGISADSENIRHLY-----------------S 517

Query: 551 KKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 610
             + P      ++ +   H +    EDG++      P E A +K   +VG ++ +++ + 
Sbjct: 518 AAEAPEST---ILVIGAAHALV-KLEDGDIV---GDPMEKATLK---AVGWAVERKNSN- 566

Query: 611 VSLFHQHSATNFEYDILQVFPFNSDTKRMGII------VYDKVKGEHWFMQKGADTVMAR 664
                 +     + DI++ F F+S  KR   I      ++  VKG         +T+  R
Sbjct: 567 ------YREGTGKLDIIRRFQFSSALKRSASIASHNDALFAAVKG-------APETIRER 613

Query: 665 IVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVI 724
           +       DE   +  R G R L +  K L PK  +        + +  LNRD+      
Sbjct: 614 LSDIPKNYDEIYKSFTRSGSRVLALASKSL-PKMSQ--------SKIDDLNRDD------ 658

Query: 725 KKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS 784
              +E  L   G       L++D   +I++L  +  +  M+TGD   TA  V+    ++ 
Sbjct: 659 ---VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV- 714

Query: 785 RGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAV 844
              +  T+      +   N L +  + ++  +  D  S   F      + +DI V   A+
Sbjct: 715 ---FGETLILDRAGKSDDNQLLFRDVEETVSIPFD-PSKDTFDHSKLFDRYDIAVTGYAL 770

Query: 845 IA-----------------CRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADV 887
            A                  R +P QK  +   ++++  + + C GDG NDV  ++ A V
Sbjct: 771 NALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHV 829

Query: 888 GVGIV 892
           G+ ++
Sbjct: 830 GIALL 834

>Scas_688.1
          Length = 913

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 103/271 (38%), Gaps = 59/271 (21%)

Query: 623 EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMARE 682
           +Y +L+  PF+  +K++  +V +  +GE     KGA   + + V+ +  + E++      
Sbjct: 437 KYKVLEFHPFDPVSKKVTAVV-ESPEGERIICVKGAPLFVLKTVEEDHPIPEDI------ 489

Query: 683 GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
                                + Y +    + +R      V +K  E + E+LG+    D
Sbjct: 490 --------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMD 529

Query: 743 KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGAL 802
             ++D   ++   R  G+++ MLTGD V  A+    + + +  G  V+   +L    G  
Sbjct: 530 PPRDDTGETVAEARRLGLRVKMLTGDAVGIAKE---TCRQLGLGTNVYNAERLGLSGG-- 584

Query: 803 NALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIR 862
                            G+  G        E  D V +          PQ K  V + I 
Sbjct: 585 -----------------GDMPG-------SELADFVENADGF--AEVFPQDKYRV-VEIL 617

Query: 863 EITGKRVCCIGDGGNDVSMIQCADVGVGIVG 893
           +  G  V   GDG ND   ++ AD G+ + G
Sbjct: 618 QTRGYLVAMTGDGVNDAPSLKKADTGIAVEG 648

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 13/90 (14%)

Query: 429 AGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRT 483
           A F   D  V I+RY +  + +     +P  +   + +G +  A++          IV+ 
Sbjct: 306 ASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQK 357

Query: 484 STIPEDLGRIEYLLSDKTGTLTQNDMQLKK 513
            +  E L  +E L SDKTGTLT+N + L +
Sbjct: 358 LSAIESLAGVEILCSDKTGTLTKNKLSLHE 387

>Kwal_47.17522
          Length = 899

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 70/341 (20%), Positives = 125/341 (36%), Gaps = 76/341 (22%)

Query: 567 ICHNVTPTFEDGEL------TYQAASPDEIAIVKFTESVGLSLFKRDRHSV------SLF 614
           +C + T T    +L      T +   PD++ +   T  +  S  K+   ++      SL 
Sbjct: 356 LCSDKTGTLTKNKLSLHEPYTVEGVEPDDLML---TACLAASRKKKGLDAIDKAFLKSLI 412

Query: 615 HQHSATNF--EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWL 672
               A N   +Y +L   PF+  +K++  +V +  +GE     KGA   + + V+ +  +
Sbjct: 413 QYPRAKNALTKYKVLDFHPFDPVSKKVTAVV-ESPEGERIICVKGAPLFVLKTVEEDHPI 471

Query: 673 DEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNL 732
            E+V                           + Y +    + +R      V +K  E + 
Sbjct: 472 PEDV--------------------------HENYENKVAELASRGFRALGVARKRGEGHW 505

Query: 733 ELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTV 792
           E+LG+    D  ++D   ++   R  G+++ MLTGD V  A+                T 
Sbjct: 506 EILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAK---------------ETC 550

Query: 793 TKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQ 852
            +L       NA             + G  L  F+      F ++             PQ
Sbjct: 551 RQLGLGTNIYNAERLGLGGGGD---MPGSELADFVE-NADGFAEVF------------PQ 594

Query: 853 QKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVG 893
            K  V  ++++  G  V   GDG ND   ++ AD G+ + G
Sbjct: 595 HKYSVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 13/90 (14%)

Query: 429 AGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRT 483
           A F   D  V I+RY +  + I     +P  +   + +G +  A++          IV+ 
Sbjct: 292 ACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQK 343

Query: 484 STIPEDLGRIEYLLSDKTGTLTQNDMQLKK 513
            +  E L  +E L SDKTGTLT+N + L +
Sbjct: 344 LSAIESLAGVEILCSDKTGTLTKNKLSLHE 373

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 66/152 (43%), Gaps = 27/152 (17%)

Query: 623 EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMARE 682
           +Y +L+  PF+  +K++  +V +  +GE     KGA   + + V+ +  + E+V      
Sbjct: 442 KYKVLEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEEDHPIPEDV------ 494

Query: 683 GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
                                + Y +    + +R      V +K  E + E+LG+    D
Sbjct: 495 --------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMD 534

Query: 743 KLQNDVKSSIELLRNAGVKIWMLTGDKVETAR 774
             ++D   ++   R+ G+++ MLTGD V  A+
Sbjct: 535 PPRDDTAQTVSEARHLGLRVKMLTGDAVGIAK 566

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 106/270 (39%), Gaps = 69/270 (25%)

Query: 254 VLNKAQLV--PSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKL 311
           V+   QLV  P+ ++  GD++++  GT IP D  ++       + F++ DQ         
Sbjct: 182 VIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTE-----DCFLQIDQS-------- 228

Query: 312 RVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLA 371
                              +IT  S   ++ +  G  T+  S+                 
Sbjct: 229 -------------------AITGES--LAVDKHYGDQTFSSSTVKR-------------- 253

Query: 372 SVGSCIGCVVYTGTDT---RQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAF 428
             G     V  TG +T   R A     ++   G     +N +  IL   V + +++LV  
Sbjct: 254 --GEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLV-IATLLLVWT 310

Query: 429 AGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRT 483
           A F   +  V I+RY +  + I     +P  +   + +G +  A++          IV+ 
Sbjct: 311 ACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQK 362

Query: 484 STIPEDLGRIEYLLSDKTGTLTQNDMQLKK 513
            +  E L  +E L SDKTGTLT+N + L +
Sbjct: 363 LSAIESLAGVEILCSDKTGTLTKNKLSLHE 392

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/271 (20%), Positives = 100/271 (36%), Gaps = 59/271 (21%)

Query: 623 EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMARE 682
           +Y +++  PF+  +K++  +V +  +GE     KGA   + + V+ +  + E+V      
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEEDHPIPEDV------ 478

Query: 683 GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
                                + Y +    + +R      V +K  E + E+LG+    D
Sbjct: 479 --------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMD 518

Query: 743 KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGAL 802
             ++D   ++   R  G+++ MLTGD V  A+                T  +L       
Sbjct: 519 PPRDDTAETVNEARRLGLRVKMLTGDAVGIAK---------------ETCRQLGLGTNIY 563

Query: 803 NALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIR 862
           NA             + G  L  F+      F ++             PQ K  V  +++
Sbjct: 564 NAERLGLGGGGD---MPGSELADFVE-NADGFAEVF------------PQHKYKVVEILQ 607

Query: 863 EITGKRVCCIGDGGNDVSMIQCADVGVGIVG 893
              G  V   GDG ND   ++ AD G+ + G
Sbjct: 608 N-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 637

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 13/90 (14%)

Query: 429 AGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRT 483
           A F   D  V I+R+ +  + I     +P  +   + +G +  A++          IV+ 
Sbjct: 295 ACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQK 346

Query: 484 STIPEDLGRIEYLLSDKTGTLTQNDMQLKK 513
            +  E L  +E L SDKTGTLT+N + L +
Sbjct: 347 LSAIESLAGVEILCSDKTGTLTKNKLSLHE 376

>Scas_710.41
          Length = 904

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 98/271 (36%), Gaps = 59/271 (21%)

Query: 623 EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMARE 682
           +Y IL+  PF+  +K++  +V    +GE     KGA   + + V+ +  + E+V      
Sbjct: 429 KYKILEFHPFDPVSKKVTAVVKSP-EGETITCVKGAPLFVLKTVEEDHPVPEDV------ 481

Query: 683 GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742
                                + Y +    + +R      V +K  E   E+LG+    D
Sbjct: 482 --------------------HENYENKVAELASRGFRSLGVARKRGEGYWEILGVMPCMD 521

Query: 743 KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGAL 802
             ++D   +I   R  G+++ MLTGD V  A+  S    L                   +
Sbjct: 522 PPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGL------------------GV 563

Query: 803 NALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIR 862
           N     K+       + G  L  F+     + F               PQ K  V  +++
Sbjct: 564 NIYNAEKLGLGGGGDMPGSELADFVE--NADGF-----------AEVFPQHKYKVVEILQ 610

Query: 863 EITGKRVCCIGDGGNDVSMIQCADVGVGIVG 893
              G  V   GDG ND   ++ AD G+ + G
Sbjct: 611 N-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 640

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 107/260 (41%), Gaps = 61/260 (23%)

Query: 259 QLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLT 318
           Q +P+ ++  GD++++ +GT IPAD  L+  +      F++ DQ           +    
Sbjct: 176 QEIPANEIVPGDILELDEGTIIPADGRLVTENR-----FLQVDQ-----------SAITG 219

Query: 319 QNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIG 378
           ++L+ D     ++ ++S             T K  +S  + V      NT +    + +G
Sbjct: 220 ESLAVDKNYGDVTFSSS-------------TVKTGTS--VMVVTATGDNTFVGRAAALVG 264

Query: 379 CVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYV 438
                 +  +      ++ + T LL L I +L  +  AC             F   D  V
Sbjct: 265 ----EASGGQGHFTDILNDIGTILLVLVIITLLLVWTAC-------------FYRTDGIV 307

Query: 439 DIMRYLILFSTI-----IPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRI 493
            I+R+ +  + I     +P  +   + +G +  A++          IV+  +  E L  +
Sbjct: 308 MILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--------QAIVQKLSAIESLAGV 359

Query: 494 EYLLSDKTGTLTQNDMQLKK 513
           E L SDKTGTLT+N + L +
Sbjct: 360 EILCSDKTGTLTKNKLSLHE 379

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 15/90 (16%)

Query: 684 LRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDK 743
           + T+ IG KKL P           D SLS    D   S++ + ++  +  L+G   + D+
Sbjct: 706 IHTITIGNKKLFP-----------DESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750

Query: 744 LQNDVKSSIELLRNAGVKIWMLTGDKVETA 773
           ++ D    +E L+N G+K  M+TGD  ++A
Sbjct: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 850 TPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGI 891
           TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 799 TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840

>Scas_297.1
          Length = 800

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 77/194 (39%), Gaps = 36/194 (18%)

Query: 767 GDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMF 826
           GD + TAR ++ +  ++S   Y+        PE A                I+G     F
Sbjct: 1   GDNILTARAIARNCNILSEETYLI-------PECA----------------IEGPK---F 34

Query: 827 LTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKR--VCCIGDGGNDVSMIQC 884
            T  KQE   ++ +L   +  R +P+ K    LL+  + G    V   GDG ND   ++ 
Sbjct: 35  RTLTKQERIKMLPNL--RVMARSSPEDKR---LLVETLKGMGDVVAVTGDGTNDAPALKL 89

Query: 885 ADVG--VGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLII 942
           ADVG  +GI G E  + +         F  +   + W GR       K  QF +   +  
Sbjct: 90  ADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITA 148

Query: 943 SVCQAVYSVCSKFE 956
            +   V S+ S+ E
Sbjct: 149 VILAFVSSIASEDE 162

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 86/206 (41%), Gaps = 45/206 (21%)

Query: 131 DLSKY--RSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYE 188
           +L KY   S    I+LT+   +   H     +Y  N+ P          P TF+ +I +E
Sbjct: 465 NLFKYLNSSLQDGIKLTETETKNYRHTQRXKLYSDNRIPERV-------PKTFLQLI-WE 516

Query: 189 QFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAF--------------------VLMV 228
            F    N   +L+  + A+ +  +G   +   P  +                     ++V
Sbjct: 517 AF----NDKTMLLLTAAAVVSFVLGLYEALYTPPEYDPEGNPIKKVDWIEGIAIMIAVIV 572

Query: 229 TMSKEAMDDIQR-----RQRDKESNNELYEVLNKAQLVPS-KDLKVGDLIKIHKGTRIPA 282
            +   A++D Q+     R   K+ N ++  + N  +L+ S  +L VGD+I +  G  IPA
Sbjct: 573 VVFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELLTSIHNLLVGDIITLQTGDVIPA 632

Query: 283 DLVLLQSSEPSGESFIKTDQLDGETD 308
           D VL++     G+  +    + GE+D
Sbjct: 633 DGVLVE-----GQCEVDESSITGESD 653

>Scas_227.0d
          Length = 307

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 17/114 (14%)

Query: 596 TESVGLSLFKRDRH----SVSLFHQHSATNFEY-DILQVFPFNSDTKRMGIIVYDKVKGE 650
           TE+  L+L K+  +    S+    ++    FE  +I Q+ PF S  K  GIIV  K    
Sbjct: 150 TETALLTLAKKSMNLRFGSLRALRENPVDRFEVSEIAQIIPFESTRKWGGIIVKYKESNL 209

Query: 651 HWFMQKGADTVMARIVQS------------NDWLDEEVGNMAREGLRTLVIGRK 692
           + F  KGA  +++    S             D +++E+ N+A + LR L +  +
Sbjct: 210 YRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQINKEIENLANDALRALSLAHR 263

>Scas_569.0d
          Length = 468

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 15/118 (12%)

Query: 841 LPAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE 895
           LP VIA RC+PQ K  +  AL  R+    + C + GDG ND   ++ A+VG+  GI G +
Sbjct: 101 LPLVIA-RCSPQTKVRMIEALHRRD----KFCAMTGDGVNDSPSLKMANVGIAMGINGSD 155

Query: 896 GKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCS 953
             + +     S   F  +   +   GR   + S  + +FV+   L  +V QA+Y +C 
Sbjct: 156 VAKDASDIVLSDDNFASILNAIE-EGR---RMSDNIQKFVLQL-LAENVAQALYLICG 208

>Kwal_55.21575
          Length = 989

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 256 NKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQL 303
            KA+ +P + L+VGD ++I  G +IP D V+++      ES I  + L
Sbjct: 417 GKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%)

Query: 737 LTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVS 777
           +   +D+++ + K  I+ LR +G++ WM++GD   TAR V+
Sbjct: 924 MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 797  RPEGALNALEYLKINKSSCLLIDGE-SLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKA 855
            RPE A   ++ L      C +I G+ SL       +     ++ D+         P+ KA
Sbjct: 1021 RPE-AKEVVQALHERGIECWMISGDNSLAANAVALEVGIKHVIADV--------LPEGKA 1071

Query: 856  DVALLIREITGKRVCC--IGDGGNDVSMIQCADVGVGI 891
            +    IRE +G+ V    +GDG ND   I  ADVG+ +
Sbjct: 1072 EKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISL 1109

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 739  GVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP 798
             V D+L+ + K  ++ L   G++ WM++GD    A  V++   +       H +  +  P
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI------KHVIADV-LP 1067

Query: 799  EGALNALEYLK 809
            EG    +++++
Sbjct: 1068 EGKAEKIQWIR 1078

>Scas_615.9
          Length = 942

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 715 NRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK----V 770
           N D T     K ++  N  L+G   + D ++ DV   I+ L+     I+M+TGD     +
Sbjct: 675 NSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAM 734

Query: 771 ETARCVSISAKLISRG 786
           + A+ V I+A  +  G
Sbjct: 735 KVAQQVGIAANNVYSG 750

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 256 NKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGET 307
           N+ + +P + L+V D+++I  G +IPAD ++ +     GES I    + GE+
Sbjct: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITR-----GESEIDESLMTGES 467

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 727 HLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVS 777
           ++  N  + GL  + D++++D  ++++ L+  G + +M+TGD    A+ V+
Sbjct: 748 YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVA 798

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 731  NLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 782
            N  +  +  +ED L+ D  S+I LLR  G+ + +L+GD     R  S++A+L
Sbjct: 1013 NGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR--SMAARL 1062

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 742 DKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGA 801
           D++++D K  I  LRN   +++M+TGD  ++A  V+    +     Y         P+G 
Sbjct: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVT-----PDGK 817

Query: 802 LNALEYLK 809
              +EYL+
Sbjct: 818 SQTVEYLR 825

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,411,144
Number of extensions: 1597850
Number of successful extensions: 5785
Number of sequences better than 10.0: 125
Number of HSP's gapped: 5791
Number of HSP's successfully gapped: 203
Length of query: 1143
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1030
Effective length of database: 12,684,275
Effective search space: 13064803250
Effective search space used: 13064803250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)