Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2177.428828814130.0
KLLA0E11341g2892879371e-128
YBR101C (FES1)2902909291e-126
Kwal_27.125772882889281e-126
Scas_718.82922928731e-118
ADL319W2892888681e-117
CAGL0K12144g2912898451e-114
Scas_582.1221660730.24
CAGL0M03553g36460690.99
CAGL0M13871g109199672.0
KLLA0D18194g148064672.1
CAGL0L06776g82853662.9
YNL288W (CAF40)37360653.3
KLLA0E13277g42145653.4
CAGL0G06754g32485643.7
AFR269W1018165644.1
KLLA0E09350g62964644.7
AEL194W37360634.8
Scas_599.13107143635.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2177.4
         (288 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2177.4 YBR101C, Contig c2177 5523-6389 reverse complement        548   0.0  
KLLA0E11341g 999242..1000111 similar to sp|P38260 Saccharomyces ...   365   e-128
YBR101C (FES1) [290] chr2 complement(443778..444650) Protein inv...   362   e-126
Kwal_27.12577                                                         362   e-126
Scas_718.8                                                            340   e-118
ADL319W [1422] [Homologous to ScYBR101C - SH] complement(135162....   338   e-117
CAGL0K12144g complement(1187185..1188060) similar to sp|P3826 Sa...   330   e-114
Scas_582.12                                                            33   0.24 
CAGL0M03553g complement(401779..402873) highly similar to sp|P53...    31   0.99 
CAGL0M13871g complement(1368745..1372020) highly similar to sp|P...    30   2.0  
KLLA0D18194g 1533582..1538024 weakly similar to sp|Q04002 Saccha...    30   2.1  
CAGL0L06776g 761583..764069 some similarities with sp|P40209 Sac...    30   2.9  
YNL288W (CAF40) [4323] chr14 (90301..91422) Component of the Ccr...    30   3.3  
KLLA0E13277g 1172956..1174221 some similarities with sp|P53829 S...    30   3.4  
CAGL0G06754g complement(645915..646889) highly similar to sp|P25...    29   3.7  
AFR269W [3461] [Homologous to ScYGL241W (KAP114) - SH] complemen...    29   4.1  
KLLA0E09350g complement(832187..834076) similar to sgd|S0005548 ...    29   4.7  
AEL194W [2312] [Homologous to ScYNL288W (CAF40) - SH] complement...    29   4.8  
Scas_599.13                                                            29   5.8  

>Sklu_2177.4 YBR101C, Contig c2177 5523-6389 reverse complement
          Length = 288

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/288 (95%), Positives = 276/288 (95%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60
           MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN
Sbjct: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60

Query: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120
           KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ
Sbjct: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120

Query: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180
           ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV
Sbjct: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180

Query: 181 LGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240
           LGDETSNDKLKMR            EFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV
Sbjct: 181 LGDETSNDKLKMRVLALLAAVLTAVEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240

Query: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288
           LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL
Sbjct: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288

>KLLA0E11341g 999242..1000111 similar to sp|P38260 Saccharomyces
           cerevisiae YBR101c singleton, start by similarity
          Length = 289

 Score =  365 bits (937), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 218/287 (75%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60
           MEKLLHWSIANA GD EA  +AGQPDPKLL+QLFG GPDEP LMK A+ VI+NPEA LEN
Sbjct: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60

Query: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120
           KL+AFDNFEMLIENLDNANNIEN+KLWEPLI+VL   E ELRAFALSV GTAVQNN +SQ
Sbjct: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120

Query: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180
            NF KY+  L  VI++A    E   VRTKAFY LSNLIRHN  +Y++F  L GL+II+PV
Sbjct: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180

Query: 181 LGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240
           L D  +++KLK+R            + NA F  +LR   IIE+TL+FL P+  LY+IDRV
Sbjct: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240

Query: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQV 287
           LNF SQLI+ GF+F+  E+ KL+ G +NIE ++ +LNEDDY+TV+ V
Sbjct: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQYV 287

>YBR101C (FES1) [290] chr2 complement(443778..444650) Protein
           involved in resistance to H2O2 [873 bp, 290 aa]
          Length = 290

 Score =  362 bits (929), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 224/290 (77%), Gaps = 2/290 (0%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSG-PDEPALMKQAILVITNPEAELE 59
           MEKLL WSIAN+ GDKEA+ +AGQPDPKLLQQLFG G PD+P LMK+++ VI NPE +LE
Sbjct: 1   MEKLLQWSIANSQGDKEAMARAGQPDPKLLQQLFGGGGPDDPTLMKESMAVIMNPEVDLE 60

Query: 60  NKLIAFDNFEMLIENLDNANNIENLKLWEPLISVL-KSNEEELRAFALSVIGTAVQNNTK 118
            KL+AFDNFEMLIENLDNANNIENLKLWEPL+ VL ++ +EELRA ALS+IGTAVQNN  
Sbjct: 61  TKLVAFDNFEMLIENLDNANNIENLKLWEPLLDVLVQTKDEELRAAALSIIGTAVQNNLD 120

Query: 119 SQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIIS 178
           SQ NF+KY++GL  +IEIA +  +   VRTKAFYALSNLIR++ D+ EKF  L GL+ I+
Sbjct: 121 SQNNFMKYDNGLRSLIEIASDKTKPLDVRTKAFYALSNLIRNHKDISEKFFKLNGLDCIA 180

Query: 179 PVLGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYIID 238
           PVL D T+  KLKMR            + + + + VLRKDG+IEST++ L  +  L IID
Sbjct: 181 PVLSDNTAKPKLKMRAIALLTAYLSSVKIDENIISVLRKDGVIESTIECLSDESNLNIID 240

Query: 239 RVLNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288
           RVL+FLS LIS G KFN+QE+ KL +GY++IE LKDRLNEDDY  V+ VL
Sbjct: 241 RVLSFLSHLISSGIKFNEQELHKLNEGYKHIEPLKDRLNEDDYLAVKYVL 290

>Kwal_27.12577
          Length = 288

 Score =  362 bits (928), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 213/288 (73%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60
           MEKLLHWS+AN+ GDKEA  K GQPDPK+LQQLFG GPDEPALMKQAI+V +NPEA L+ 
Sbjct: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60

Query: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120
           KL+A DNFEMLIENLDNANNIENLKLW P++ ++   E E+RA ALS++GTAVQNN KSQ
Sbjct: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120

Query: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180
            NFL YE GL  +I+IA +  E  AVR KAFYALSNL+RHN    EK  +LGGL+II+ V
Sbjct: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180

Query: 181 LGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240
           L DE++ DKLK+R            E + S V  LR   I+ESTL +L     +Y++DRV
Sbjct: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240

Query: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288
           LNFLS LIS G  F + E++ L+ G  +IE +++RLNEDDYQTV+ VL
Sbjct: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVKHVL 288

>Scas_718.8
          Length = 292

 Score =  340 bits (873), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 172/292 (58%), Positives = 216/292 (73%), Gaps = 4/292 (1%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFG----SGPDEPALMKQAILVITNPEA 56
           MEKLLHWSIANA GDKEAI KAGQPDP+LLQQLFG    SGPD+P LMK+ + VI NP+ 
Sbjct: 1   MEKLLHWSIANAQGDKEAIAKAGQPDPRLLQQLFGGAGSSGPDDPTLMKEQMEVIMNPDV 60

Query: 57  ELENKLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNN 116
           EL+ KL+A DNFEMLIENLDNANNIENLKLW+P++ +L+  E+EL + ALS+IGT+VQNN
Sbjct: 61  ELDIKLVAIDNFEMLIENLDNANNIENLKLWDPILKILEFEEDELVSQALSIIGTSVQNN 120

Query: 117 TKSQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEI 176
           T SQ+ FLK+E+GL  VI++A +  +   VRTKA YALSNL+R++  +  KF  L GL+I
Sbjct: 121 TNSQDKFLKHENGLNKVIQLANDKSQSFEVRTKALYALSNLVRNHEHMATKFRELNGLDI 180

Query: 177 ISPVLGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYI 236
           I P+L D  +  KLKMR            E + S +  +RKDG IE+T+D L  +  L +
Sbjct: 181 IPPILNDPKAKTKLKMRAIALLTAFLTSTEISESLISDMRKDGTIEATIDCLNSETDLNL 240

Query: 237 IDRVLNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288
           IDRVLN L+QLIS G KFN+ EM KL+ G++ +E LKDRLNEDDY TV+ VL
Sbjct: 241 IDRVLNLLAQLISAGIKFNQVEMEKLKTGFQKVEPLKDRLNEDDYLTVKYVL 292

>ADL319W [1422] [Homologous to ScYBR101C - SH]
           complement(135162..136031) [870 bp, 289 aa]
          Length = 289

 Score =  338 bits (868), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 163/288 (56%), Positives = 211/288 (73%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60
           M+KLLHWSIANA GDKEA  KAG PDPKLLQQLFG GPDEPALM+ A+ VI NPEA ++N
Sbjct: 1   MDKLLHWSIANAQGDKEAAAKAGAPDPKLLQQLFGGGPDEPALMRDAMAVIMNPEATVDN 60

Query: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120
           KL+AFDNFEMLIENLDNANNIEN++LW PLIS+L+S EE+LR  ALSV+GTAVQNN KSQ
Sbjct: 61  KLVAFDNFEMLIENLDNANNIENMRLWAPLISILESEEEQLRECALSVVGTAVQNNEKSQ 120

Query: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180
            NFLK++  +  +IE+A    E   VRTKAFYALSN++RHN D    FV  GGLEI++PV
Sbjct: 121 SNFLKHDGAMKKIIELARKDSESEQVRTKAFYALSNIVRHNKDASALFVDNGGLEIMAPV 180

Query: 181 LGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240
           L  + + +K+K+R              +  F + +R+D I+E++L+ L P    Y+IDRV
Sbjct: 181 LKHQNTGEKMKIRALALLTSVLTSLSADEKFSDRIREDKILEASLEHLAPSANPYLIDRV 240

Query: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288
           LN L  +   G KF+  E+SK+R+ + ++  +KD+LNEDDY  V+++L
Sbjct: 241 LNLLVLMKGSGAKFDTDELSKIRKSFASLYPVKDQLNEDDYNAVKEML 288

>CAGL0K12144g complement(1187185..1188060) similar to sp|P3826
           Saccharomyces cerevisiae YBR101c, start by similarity
          Length = 291

 Score =  330 bits (845), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/289 (59%), Positives = 213/289 (73%), Gaps = 2/289 (0%)

Query: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSG-PDEPALMKQAILVITNPEAELE 59
           MEKLLHWSIANA GDKEAIEKAG PDPKLL+QLFG G PD+P LMK+A+ VI NPEA+LE
Sbjct: 1   MEKLLHWSIANAQGDKEAIEKAGAPDPKLLEQLFGGGGPDDPTLMKEAMAVIMNPEADLE 60

Query: 60  NKLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKS 119
           NKLIA+DNFEMLIENLDNANNIEN+KLWEP++  L+ NE +LRA  LSVIGTAVQNNT S
Sbjct: 61  NKLIAYDNFEMLIENLDNANNIENMKLWEPILKTLEDNEADLRASGLSVIGTAVQNNTDS 120

Query: 120 QENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISP 179
           Q NFLKYE GL  +I IA +++E   VR KAFYALSNL+R++ +  +KF +LGGL++   
Sbjct: 121 QTNFLKYEGGLKILIAIAKSSEEPSDVRIKAFYALSNLLRNHIEAGKKFQALGGLDVFPV 180

Query: 180 VLGDETSNDKLKMRXXXXXXXXXXXXEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDR 239
            L D  +  KLKMR            + +   ++ LRKDG++ S ++ L  D  + +IDR
Sbjct: 181 ALNDPKATPKLKMRAISALSAFLSSSKIDEQLLDTLRKDGVLVSVIENLGTD-NVNVIDR 239

Query: 240 VLNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVRQVL 288
           VL+ LS LIS G KFN  E+  L++ +E I+SLKDRLNEDDY  V+ V 
Sbjct: 240 VLSVLSHLISSGIKFNDSELEMLQKEFEKIDSLKDRLNEDDYLAVKYVF 288

>Scas_582.12
          Length = 216

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 99  EELRAFALSVIGTAVQNNTKSQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLI 158
           E LR  +L VIG  V+N+++   NFL   D +P  + I  ++ E+   +T A + L  ++
Sbjct: 59  EYLRLTSLGVIGALVKNDSQDVINFLLRTDIVPLCLRIMESSSELS--KTVAIFILQKIL 116

>CAGL0M03553g complement(401779..402873) highly similar to sp|P53829
           Saccharomyces cerevisiae YNL288w CAF40, hypothetical
           start
          Length = 364

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 99  EELRAFALSVIGTAVQNNTKSQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLI 158
           E LR  +L VIG  V+N++K    FL   D +P  + I  ++ E+   +T A + L  ++
Sbjct: 209 EYLRLTSLGVIGALVKNDSKDVIGFLLRTDIVPLCLRIMESSSELS--KTVAIFILQKIL 266

>CAGL0M13871g complement(1368745..1372020) highly similar to
           sp|P32337 Saccharomyces cerevisiae YMR308c PSE1 beta
           karyopherin, start by similarity
          Length = 1091

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 11/99 (11%)

Query: 86  LWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQENFLKYEDGL-PGVIE--IAGNAKE 142
           LW  +I+ L  +E     FAL V+G  VQ   +   NF   +D + P ++E  ++ +A  
Sbjct: 862 LWPLIITFLNDSESMNIIFALVVVGDMVQYGGEKSANF---KDSIAPKIVEYLVSPDA-- 916

Query: 143 VPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPVL 181
             +VR  A + L     +    Y   + +  LE +S V+
Sbjct: 917 --SVRQAAAFVLGTCAEYAPTTYHS-ICIPSLETLSQVV 952

>KLLA0D18194g 1533582..1538024 weakly similar to sp|Q04002
           Saccharomyces cerevisiae YDR180w SCC2 involved in sister
           chromatid cohesion singleton, start by similarity
          Length = 1480

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 48  ILVITNPEAELENKLIAFDNFEMLIEN--LDNANNI-ENLKLWEPLISVLKSNEEELRAF 104
           I V +NP  +LE   +  D+   L+++  L++  ++ EN K W+PL  V  +  E + A 
Sbjct: 164 ICVQSNPMNDLEVGKLCLDHLSKLLDSVGLNSEGSVNENAKFWKPLGDVYVATSEAIDAI 223

Query: 105 ALSV 108
           +L++
Sbjct: 224 SLTI 227

>CAGL0L06776g 761583..764069 some similarities with sp|P40209
           Saccharomyces cerevisiae YMR136w GAT2, hypothetical
           start
          Length = 828

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 109 IGTAVQNNTKSQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHN 161
           I  A   N+K QEN + ++D +  V + A NA + P+   ++ Y      R N
Sbjct: 622 ISKAENPNSKKQENLVSHQDHISHVEQCADNATDKPSKNERSQYKSKVTSREN 674

>YNL288W (CAF40) [4323] chr14 (90301..91422) Component of the
           Ccr4p-Not complex [1122 bp, 373 aa]
          Length = 373

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 99  EELRAFALSVIGTAVQNNTKSQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLI 158
           E LR  +L VIG  V+N+++    FL   D +P  + I  ++ E+   +T A + L  ++
Sbjct: 217 EYLRLTSLGVIGALVKNDSQDVITFLLRTDIVPLCLRIMESSSELS--KTVAIFILQKIL 274

>KLLA0E13277g 1172956..1174221 some similarities with sp|P53829
           Saccharomyces cerevisiae YNL288w CAF40 singleton,
           hypothetical start
          Length = 421

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 99  EELRAFALSVIGTAVQNNTKSQENFLKYEDGLPGVIEIAGNAKEV 143
           E LR  +L VIG  V+N++    +FL   D +P  + I  N+ E+
Sbjct: 265 EYLRLTSLGVIGALVKNDSAEVISFLLRTDIIPLCLRIMENSSEL 309

>CAGL0G06754g complement(645915..646889) highly similar to sp|P25342
           Saccharomyces cerevisiae YCR002c CDC10 cell division
           control protein, hypothetical start
          Length = 324

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 9/85 (10%)

Query: 18  AIEKAGQPDPKLLQQLFGSGPDEPA----LMKQAILVITNPEAELENKLIAFDNFEMLIE 73
            +  +G     L+  LF S   +PA    + KQ I   T  E ++ +  +  D   + I 
Sbjct: 38  VVGHSGLGKSTLINTLFSSHLIDPATGEDISKQPITKTT--EMKVSSHTLIEDRVRLNIN 95

Query: 74  NLDN---ANNIENLKLWEPLISVLK 95
            +D     +NI N K+WEP++  +K
Sbjct: 96  IIDTPGFGDNINNNKVWEPIVKYIK 120

>AFR269W [3461] [Homologous to ScYGL241W (KAP114) - SH]
           complement(916449..919505) [3057 bp, 1018 aa]
          Length = 1018

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 71/165 (43%), Gaps = 31/165 (18%)

Query: 27  PKLLQQLFGSGPDEPALMKQAILVITNPEAELENK------LIAFDNFEMLIE-----NL 75
           P+LL++   S P+   L+++ + +  N     EN+      LIAF  +   ++      +
Sbjct: 480 PRLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGV 539

Query: 76  DNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQENFLK-YEDGL---- 130
             A  +E L L   + ++L   +E+   F L V+      N +S+   LK YE  L    
Sbjct: 540 QTAEELEKLVL-STIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNV 598

Query: 131 ----PGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSL 171
               P  I++   A+E           L NL++++ + Y ++  L
Sbjct: 599 ATADPSNIQVVVEAQE----------CLKNLLQYDPENYLQYAEL 633

>KLLA0E09350g complement(832187..834076) similar to sgd|S0005548
           Saccharomyces cerevisiae YOR022c, hypothetical start
          Length = 629

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 227 FLVPD--GGLYIIDRVLNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTV 284
           FL+PD  GG   +  + + ++QLI  G        SKL +GYE   SL +R  E + Q +
Sbjct: 162 FLLPDIYGGHLQLTILRSSVAQLIQLG-------ASKLTKGYEEPSSLTERAKEIEGQVI 214

Query: 285 RQVL 288
              +
Sbjct: 215 EHAM 218

>AEL194W [2312] [Homologous to ScYNL288W (CAF40) - SH]
           complement(268286..269407) [1122 bp, 373 aa]
          Length = 373

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 99  EELRAFALSVIGTAVQNNTKSQENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLI 158
           E LR  +L VIG  V+N++    NFL   D +P  + I  ++ E+    T A + L  ++
Sbjct: 219 EYLRLTSLGVIGALVKNDSVEVINFLLRTDIIPLCLRIMESSSELST--TVAIFILQKIL 276

>Scas_599.13
          Length = 1071

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 221 IESTLDFLVPDGGLY----IIDRVLNFLSQLISFGFKFNKQEM 259
           ++S + F+  + GLY    ++ R+LNF+ +L ++  +FN++ +
Sbjct: 700 MQSLVQFIHQEMGLYKLYTVVPRLLNFIDELTNWYIRFNRRRL 742

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.135    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,365,827
Number of extensions: 391763
Number of successful extensions: 1165
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1160
Number of HSP's successfully gapped: 34
Length of query: 288
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 187
Effective length of database: 13,099,691
Effective search space: 2449642217
Effective search space used: 2449642217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 61 (28.1 bits)