Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2174.463263231930.0
Kwal_47.1814562462324540.0
YER049W64462922710.0
CAGL0J02816g62562721780.0
ADL114C61462821670.0
KLLA0E04411g60061919900.0
Scas_715.28*63263619360.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2174.4
         (632 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement       1234   0.0  
Kwal_47.18145                                                         949   0.0  
YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3...   879   0.0  
CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...   843   0.0  
ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154) [...   839   0.0  
KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...   771   0.0  
Scas_715.28*                                                          750   0.0  

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score = 1234 bits (3193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/632 (95%), Positives = 604/632 (95%)

Query: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60
           MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI
Sbjct: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60

Query: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120
           NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS
Sbjct: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120

Query: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180
           EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK
Sbjct: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180

Query: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240
           DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ
Sbjct: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240

Query: 241 GWYHIPQVXXXXXXXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300
           GWYHIPQV            WVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK
Sbjct: 241 GWYHIPQVGEPGHIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300

Query: 301 VLQXXXXXXXXXXXXXXXXAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360
           VLQ                AIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS
Sbjct: 301 VLQDSSPDSDSSKEKSPVSAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360

Query: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420
           FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE
Sbjct: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420

Query: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480
           NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL
Sbjct: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480

Query: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540
           CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG
Sbjct: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540

Query: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600
           YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI
Sbjct: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600

Query: 601 SWSAKSSRWDVSMQWDVKTMDDDKSEDETPEN 632
           SWSAKSSRWDVSMQWDVKTMDDDKSEDETPEN
Sbjct: 601 SWSAKSSRWDVSMQWDVKTMDDDKSEDETPEN 632

>Kwal_47.18145
          Length = 624

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/623 (74%), Positives = 527/623 (84%), Gaps = 1/623 (0%)

Query: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60
           MKR++ + +     KQ   E  K+K LFNSKIWDP+FQ  L+QEIA+SKPYNWGTIRDL+
Sbjct: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIRDLV 60

Query: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120
           +DDLLRAVRKE+ETQIHFT KETDIYKVNQSGDLANLSGLDW DLSRLPNL KLREILYS
Sbjct: 61  DDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120

Query: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180
           E+YRDVIS+VTGAGKLSGSK DMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDP+ +WK
Sbjct: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180

Query: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240
           +HYGGGLRLFPSIVANVP SDHSAKL+PQFNQIAFFQVQPGFSFHDVEEVRV++HRLSIQ
Sbjct: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240

Query: 241 GWYHIPQVXXXXXXXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300
           GWYHIPQ             WVKTNTSTLAQLESNVLQDYEFPK ERDILP HQ+KH+E 
Sbjct: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300

Query: 301 VLQXXXXXXXXXXXXXXXXAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360
           +L+                A+ D   LT++E+ +LS FVS EYLTP GI  LQ RF++NS
Sbjct: 301 LLE-AQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNS 359

Query: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420
            LQ+  FL+D ++ LLK+LIK DEL+K+CPYES  V+ PWKTA+PPHKWRYLYIDGKSHE
Sbjct: 360 HLQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHE 419

Query: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480
           NF +E DIL KLNNEE PNY  LKQ+LDK+K+DTE EL+ + EFFQST FKKYLALLT L
Sbjct: 420 NFTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKYLALLTLL 479

Query: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540
            PLSEQ+L+RRFRPGKDFTLAT++N+N LL +VEG VDAVLEGTLCLTPTNGW+SGEVGG
Sbjct: 480 SPLSEQVLIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGG 539

Query: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600
           YELYM++QD+ E  DKD+EDAAVYK DD+GD+VLIN PPSWNSLNLVLRDESVLQF+KY+
Sbjct: 540 YELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYV 599

Query: 601 SWSAKSSRWDVSMQWDVKTMDDD 623
           SWSAKSSRWD++ QWDVK + ++
Sbjct: 600 SWSAKSSRWDITAQWDVKAVGNE 622

>YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3
           histone acetyltransferase complex [1935 bp, 644 aa]
          Length = 644

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/629 (67%), Positives = 504/629 (80%), Gaps = 13/629 (2%)

Query: 14  TKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLINDDLLRAVRKEIE 73
           +KQ + EE K+K +FN KIWD  FQ  L++EI +S+PYNWGTI +L+NDDLLRAVRKEIE
Sbjct: 16  SKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIE 75

Query: 74  TQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYSEIYRDVISYVTGA 133
           T+IHFT KETDIY+VNQSGDLANLSGLDW+DLSRLPNLFKLR+ILYS+ YRD   YVT A
Sbjct: 76  TEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKA 135

Query: 134 GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWKDHYGGGLRLFPSI 193
           GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRR+SFILYLPDPD++WK HYGGGLRLFPSI
Sbjct: 136 GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSI 195

Query: 194 VANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQGWYHIPQVXXXXX 253
           + NVPHSD SAKLVPQFNQIAFF+V PGFSFHDVEEV+VDKHRLSIQGWYHIPQV     
Sbjct: 196 LPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGY 255

Query: 254 XXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEKVLQXXXXXXXXXX 313
                  WV+ NTSTLAQ+ESNVL+D+EFPK+ER+IL +H+VKHFEK+L+          
Sbjct: 256 IPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKGDAGAKTDNT 315

Query: 314 XXXXXXAIV-DTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENSFLQIGSFLNDSK 372
                 +++ D+  L+E E  YLSQ++S E+L+  GI+ LQ +F+ENS LQI SFLND K
Sbjct: 316 PKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDK 375

Query: 373 SKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHENFRSEADILAKL 432
           S+LLK++IK  EL ++CPY S  V APWKTAIPPHK RYLYIDGK + NF++EADIL  L
Sbjct: 376 SELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEAL 435

Query: 433 NNEELPNYTFLKQTLD----------KEKHDTEYELVQLVEFFQSTIFKKYLALLTSLCP 482
           NN +LPN+ F K  +           +   D E  L+ L  F +STIFKKYLALLTSLCP
Sbjct: 436 NNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCP 495

Query: 483 LSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGGYE 542
           +SEQIL+RRFRPG DFTLATK   N+LL +    +DAVLEGTLCLTP+ GW+SGE+GGYE
Sbjct: 496 VSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYE 555

Query: 543 LYM--NDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600
           LYM  +D+D+++   +D+EDA+VY+ADDSGDSVLIN PP+WN+ NLVLRDESVL+FVKY+
Sbjct: 556 LYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKYV 615

Query: 601 SWSAKSSRWDVSMQWDVKTMDDDKSEDET 629
           SWSAKSSRWDV M+WDVK+ D+D  EDE 
Sbjct: 616 SWSAKSSRWDVKMKWDVKSCDEDGQEDEA 644

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/627 (64%), Positives = 491/627 (78%), Gaps = 8/627 (1%)

Query: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60
           MKR A ++   N  KQ   EE KVK LFN K+W PEF+  L+ +I  S PYNWG I  L+
Sbjct: 1   MKRKAEAQE--NGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLV 58

Query: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120
           NDDLLRAVRKEIET+IHFT KETDIYKVNQSGDLANLSGL+W+DLSRLPN++KLR+ILYS
Sbjct: 59  NDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYS 118

Query: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180
           ++YRD+I YVTGAGKLSGSK DMS+NTYTKGCHLLTHDDVIGSRR+SFILYLPDPD++WK
Sbjct: 119 DVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWK 178

Query: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240
             YGGGLRLF SI+ N+P +D  AK VPQFN+IAFF+V PGFSFHDVEEV+VDKHRLSIQ
Sbjct: 179 PQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQ 238

Query: 241 GWYHIPQVXXXXXXXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300
           GWYH PQ             WVK NTSTL QLE+NVLQD+E+PK ERDILPYHQVKHFEK
Sbjct: 239 GWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEK 298

Query: 301 VLQXXXXXXXXXXXXXXXXAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360
           VL                  + DT +L+E+E  YLSQ++S E+LT  GI+ LQ +FLENS
Sbjct: 299 VL--YAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENS 356

Query: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420
            LQI  FLN+  S+LLK++IK +EL K CPY +  V+ PW+TA+P HKWRY+YIDGK+  
Sbjct: 357 TLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPR 416

Query: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKH-DTEYELVQLVEFFQSTIFKKYLALLTS 479
                +DI+  LNNEELPN+  L++TL K+   D E +L+ L  F++STIFKKYLALLT+
Sbjct: 417 KLLKASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTA 476

Query: 480 LCPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVG 539
           LCPLSEQIL+RRFRPG DFTLAT+   N+ L +VEG + ++L G LCLTP++GW+SGEVG
Sbjct: 477 LCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVG 536

Query: 540 GYELYMND---QDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQF 596
           GYELYM D    ++EE   KD+EDA+VY+ DD+GDSVL+N+PPSWN+ NLVLRD+SVL+F
Sbjct: 537 GYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEF 596

Query: 597 VKYISWSAKSSRWDVSMQWDVKTMDDD 623
           VKY+S +AKSSRWDV M+WDVK + +D
Sbjct: 597 VKYVSCAAKSSRWDVKMEWDVKYVGED 623

>ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154)
           [1845 bp, 614 aa]
          Length = 614

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/628 (67%), Positives = 501/628 (79%), Gaps = 17/628 (2%)

Query: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60
           MKR APS+ V   +KQ   E  KVK  FNSKIWD  ++  LR+E+A +KPYNWGTI DL+
Sbjct: 1   MKRRAPSQPVFE-SKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLV 59

Query: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120
           + DLLR+VR+EIE +IHFTNKETDIYKVNQSGDLANLSGLDW DLSRLP+L +LR+ILYS
Sbjct: 60  DPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYS 119

Query: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180
           ++YRD I YV GAGKLSG+K DMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDK WK
Sbjct: 120 DVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWK 179

Query: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240
           +HYGG LRLFPSI+ NVP SD SAKLVPQFNQ+AFF V PG+SFHDVEEV+VDKHRLSIQ
Sbjct: 180 EHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQ 239

Query: 241 GWYHIPQVXXXXXXXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300
           GWYHIPQ             +V TN STLAQLES +LQDYEF K+ER ILP  Q+K  EK
Sbjct: 240 GWYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEK 299

Query: 301 VLQXXXXXXXXXXXXXXXXAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360
            L                        L  +EL YLS ++SEE+L+  GI+SLQS+F ENS
Sbjct: 300 FLGSESEDTAFY--------------LNADELAYLSMYISEEHLSLEGIKSLQSKFTENS 345

Query: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420
           +LQI SFLN+ KS LLK+LIK +EL K+CPY++ +V+ PWKTAIPP+KWR++YIDGKSHE
Sbjct: 346 YLQIDSFLNEQKSALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHE 405

Query: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480
           +F SE DI  +L +EELPN+T LKQ L  +    E  L++LVEFF+S  FKKYLALLT L
Sbjct: 406 HFCSEDDIKRRLVHEELPNFTLLKQGL-SDHLSVEPALLELVEFFKSFAFKKYLALLTLL 464

Query: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540
           CPL+EQ+L+RRFRPG DFTLATKI  ++LL +VEG+VDAVLEG LCLTPT+GW+SGE+GG
Sbjct: 465 CPLTEQLLIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGG 524

Query: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600
           YELYM DQDDE+M +KD+EDAAVY++DDSG SVLIN P SWNS NLVLRDESVLQFVKY+
Sbjct: 525 YELYMGDQDDEDM-NKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYV 583

Query: 601 SWSAKSSRWDVSMQWDVKTMDDDKSEDE 628
           SW+AKSSRWD+SM WDVK+ ++D + +E
Sbjct: 584 SWAAKSSRWDISMNWDVKSFENDPNSNE 611

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/619 (62%), Positives = 468/619 (75%), Gaps = 28/619 (4%)

Query: 2   KRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLIN 61
           KR A   ++ +  K +  E SK    FNSKIWD  FQ  LRQEI  ++PYNWGTIRDL++
Sbjct: 7   KRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVD 66

Query: 62  DDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYSE 121
            +LL+ VR+EIET IHFT KETDIYKVNQSGDLANLSGLD  DLS+LP+L KLRE+LYSE
Sbjct: 67  PNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSE 126

Query: 122 IYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWKD 181
            YRD I+YVT +GKLSGSKTD+SINTYTKGCHLLTHDDVIGSRRVSFILYLP+P++ WK+
Sbjct: 127 KYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKE 186

Query: 182 HYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQG 241
           HYGGGLRLFPSIV NVP SDHSAKLVPQFNQIAFF+VQPGFSFHDVEEV+VDKHRLSIQG
Sbjct: 187 HYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQG 246

Query: 242 WYHIPQVXXXXXXXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEKV 301
           WYHIPQ             W+KTN STL+QL ++ LQDYEFPK +R  L +++    ++ 
Sbjct: 247 WYHIPQEGEPGYTPGEEEEWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYESGKLDRT 306

Query: 302 LQXXXXXXXXXXXXXXXXAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENSF 361
                                    LTE+++ +LS+F++ E+LT   ++ +  +F+E+SF
Sbjct: 307 DDL----------------------LTEDDITFLSKFLNPEHLTTESMRKISDKFVEDSF 344

Query: 362 LQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHEN 421
           + I SFLND  S LLK+LI + E N DCPYES  V  PWKT++PPHKWRYLYIDGKS+ N
Sbjct: 345 INIESFLNDEYSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTN 404

Query: 422 FRSEADILAKLNNEELPNY-TFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480
           FR+E DI   LNN ELPN+   L    DKE+ + E +L +L  F QS  FKK++  LT L
Sbjct: 405 FRNEEDIKKALNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKL 464

Query: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540
             LSEQ+L+RRFRPGKDFTLAT    N+LL  + G+V+A+LE TLCLTP+ GWDSGEVGG
Sbjct: 465 VILSEQLLIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGG 524

Query: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600
           YELYMN+QDD+E       DAA+Y+ADD GDSVLIN P SWNSLNLVLRDE+VLQF+KY+
Sbjct: 525 YELYMNNQDDDEDD-----DAAIYRADDDGDSVLINKPASWNSLNLVLRDENVLQFIKYV 579

Query: 601 SWSAKSSRWDVSMQWDVKT 619
           SW+AKSSRWD+S+QWDVK+
Sbjct: 580 SWAAKSSRWDISLQWDVKS 598

>Scas_715.28*
          Length = 632

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/636 (58%), Positives = 465/636 (73%), Gaps = 12/636 (1%)

Query: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60
           MKRS+   S     K Q  E+ K+K LFN +IW+P++Q  LR EIA SKP+NWG+I  LI
Sbjct: 1   MKRSSGDDSAAQ-AKMQTLEDDKLKALFNPRIWEPDYQKELRDEIANSKPFNWGSIPKLI 59

Query: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120
           +DDLLRAVRKEIET+IHF+ KETDIYKVNQSGDLANLS LDWNDLSRLPNLFKLR++LYS
Sbjct: 60  DDDLLRAVRKEIETEIHFSKKETDIYKVNQSGDLANLSKLDWNDLSRLPNLFKLRQLLYS 119

Query: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180
           E YRD  +Y+T +G LSG KTDMSINTYTKGCHL+ HDDVIGSRR+SFILYLPDPD++WK
Sbjct: 120 EKYRDFFAYITQSGHLSGKKTDMSINTYTKGCHLVPHDDVIGSRRISFILYLPDPDRKWK 179

Query: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240
            HYGGGLRL+ +I+ NVP +D  AKLVPQFNQIAFF+V PGFSFHDVEEV+VDKHRLSIQ
Sbjct: 180 SHYGGGLRLYDTIMPNVPENDPCAKLVPQFNQIAFFKVNPGFSFHDVEEVKVDKHRLSIQ 239

Query: 241 GWYHIPQVXXXXXXXXXXXXWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300
           GWYHIPQ             ++  N + L +L+S VL+D+EFPK ER++LP +Q+KHFEK
Sbjct: 240 GWYHIPQEGDKGYIPNEEATYIDKNITQLGELDSAVLEDFEFPKEERELLPNYQIKHFEK 299

Query: 301 VLQXXXXXXXXXXXXXXXXAIV-----DTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSR 355
           +L+                + +     +  +LTEEE+ YLS++V+ E+LT  GI  LQ  
Sbjct: 300 ILERSNSGDNDSSNVLSIPSGMKVIPSEIPSLTEEEVAYLSEYVALEHLTKEGISKLQES 359

Query: 356 FLENSFLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYID 415
           FLENSFL I SFLN+ KS LL+  IK  EL KDCP  S  V  PWKTA+P HK +YLYID
Sbjct: 360 FLENSFLSIESFLNEEKSSLLENQIKRTELEKDCPLFSKDVAYPWKTAMPSHKCKYLYID 419

Query: 416 GKSHENFRSEADILAKLNNEELPNYTFLKQTLD--KEKHDTEYELVQLVEFFQSTIFKKY 473
           GK  ++  +   ++  LNN+E  N+  +K+ ++  KE  DTE  L++L  FF+S IFKKY
Sbjct: 420 GKKQQDLATADGLITTLNNDENSNFEMVKELVNIGKEDIDTEKSLIELSIFFKSLIFKKY 479

Query: 474 LALLTSLCPLSEQILVRRFRPGKDFTLATKINQN-KLLSNVEGYVDAVLEGTLCLTPTNG 532
           L LLTSLC ++EQ+L+RRFRPG DFTLA K   N K L+ V   +D VL          G
Sbjct: 480 LVLLTSLCLITEQVLIRRFRPGNDFTLANKCKMNTKYLNEV---LDNVLRRYFMFDSIKG 536

Query: 533 WDSGEVGGYELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDES 592
           W++G+VGGYE+YM D   E+  D+D  +A  YK D++G+S+L+NSP SWN+ NLVLRDES
Sbjct: 537 WETGDVGGYEIYMMDGTKEKAEDEDDVEAERYKNDENGESILLNSPASWNTFNLVLRDES 596

Query: 593 VLQFVKYISWSAKSSRWDVSMQWDVKTMDDDKSEDE 628
           VL+FVKYISW AKSSRWD+ ++WDV+T DD++  DE
Sbjct: 597 VLEFVKYISWEAKSSRWDIKLKWDVRTFDDEEYGDE 632

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,831,795
Number of extensions: 993444
Number of successful extensions: 3441
Number of sequences better than 10.0: 19
Number of HSP's gapped: 3515
Number of HSP's successfully gapped: 19
Length of query: 632
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 524
Effective length of database: 12,857,365
Effective search space: 6737259260
Effective search space used: 6737259260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)