Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2174.333033017010.0
Kwal_47.1814832332213540.0
ADL115W33331512031e-167
CAGL0L00891g3413179951e-135
YIL041W3263189811e-133
Scas_704.453293379251e-124
KLLA0E04433g3023159171e-124
Kwal_55.212273763652233e-20
AFR309C3643472127e-19
CAGL0L08492g3852371924e-16
KLLA0E04543g3893741829e-15
Scas_676.184442361741e-13
YPR148C435661463e-10
AAR137W88871720.55
KLLA0B03520g140186720.56
KLLA0C06226g59294654.5
Kwal_23.585615927624.8
CAGL0D02376g69523645.1
Scas_614.1818563626.2
AER322C63627628.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2174.3
         (330 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2174.3 YIL041W, Contig c2174 2044-3036                           659   0.0  
Kwal_47.18148                                                         526   0.0  
ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....   468   e-167
CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces c...   387   e-135
YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic prote...   382   e-133
Scas_704.45                                                           360   e-124
KLLA0E04433g complement(406764..407672) similar to sp|P40531 Sac...   357   e-124
Kwal_55.21227                                                          91   3e-20
AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)...    86   7e-19
CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces c...    79   4e-16
KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyce...    75   9e-15
Scas_676.18                                                            72   1e-13
YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protei...    61   3e-10
AAR137W [324] [Homologous to ScYOR058C (ASE1) - SH] complement(5...    32   0.55 
KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces c...    32   0.56 
KLLA0C06226g 550683..552461 similar to sp|P32807 Saccharomyces c...    30   4.5  
Kwal_23.5856                                                           28   4.8  
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    29   5.1  
Scas_614.18                                                            28   6.2  
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...    28   8.4  

>Sklu_2174.3 YIL041W, Contig c2174 2044-3036
          Length = 330

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/330 (100%), Positives = 330/330 (100%)

Query: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60
           MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120
           RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHED 180
           EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHED
Sbjct: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHED 180

Query: 181 ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ 240
           ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ
Sbjct: 181 ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ 240

Query: 241 YDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSA 300
           YDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSA
Sbjct: 241 YDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSA 300

Query: 301 QLAYYKLSTELLSDFLPQLEAPAISTETQE 330
           QLAYYKLSTELLSDFLPQLEAPAISTETQE
Sbjct: 301 QLAYYKLSTELLSDFLPQLEAPAISTETQE 330

>Kwal_47.18148
          Length = 323

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/322 (80%), Positives = 292/322 (90%), Gaps = 1/322 (0%)

Query: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60
           MSFN+FADS+N+KFQE+S+ VSQ+AQEAQLDKKFKDLS AVSQ+TQD TT LPSLAQSTQ
Sbjct: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60

Query: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120
           RL+QE+LGQVTDISQLPQ+Y+ELEN+IDR++LVYENFLKVTQVYE+ESYDYPNNVRDSVN
Sbjct: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKS-GHE 179
           EFS  V +KLHELS A+ST+EAQ++LISPGP KDPKTLNYALSKVALTSSEYL+KS G E
Sbjct: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180

Query: 180 DETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRL 239
           D  ++++LLKYSDVQAKIAQARL QDTLIQTKFNKKLR  LA DLN+A KARK VENKRL
Sbjct: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRL 240

Query: 240 QYDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVS 299
           QYDIARANLANA+PEKEASLRVQMESLEDEFAQAT+DA  +MQ V  SSE LKDL ELV+
Sbjct: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300

Query: 300 AQLAYYKLSTELLSDFLPQLEA 321
           AQ  YYK S ELLS+FLPQLE+
Sbjct: 301 AQAEYYKQSAELLSEFLPQLES 322

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score =  468 bits (1203), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/315 (70%), Positives = 276/315 (87%)

Query: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60
           MSFNAFADS +K+FQE+S++V QKAQEAQLDKK KDLS +VSQRTQDLT++LPSLAQ+TQ
Sbjct: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQ 60

Query: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120
           R VQERLGQVTDISQ+P+EY+ELE R+DR +L+Y+NFLKV+Q+YE ESYDYP ++ DSVN
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHED 180
           +FSKTV+ K+ EL+ A++T+EAQ+ILISPGPA++PKTLNYALSKVALTSSEYLSKSG +D
Sbjct: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDD 180

Query: 181 ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ 240
              A  LLKYSDVQAKIAQARLQQDTLIQT+FN++LRE L +   +A+++RK+V+ KRLQ
Sbjct: 181 VVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ 240

Query: 241 YDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSA 300
           YDIARAN   A+PEK+ASLRVQME+LED+FAQ+TEDA  +MQ VI  +EFLK+  ELV+A
Sbjct: 241 YDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTA 300

Query: 301 QLAYYKLSTELLSDF 315
           QL ++K + ELLS F
Sbjct: 301 QLGFHKAAAELLSGF 315

>CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces
           cerevisiae YIL041w, hypothetical start
          Length = 341

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 195/317 (61%), Positives = 247/317 (77%), Gaps = 22/317 (6%)

Query: 2   SFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQR 61
           +FN+FA+SL +  Q  S +VSQK                    T +L+T++P+LAQSTQR
Sbjct: 3   NFNSFANSLRENLQSFSNTVSQK--------------------THELSTNIPTLAQSTQR 42

Query: 62  LVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNE 121
           +VQE+LGQVTDISQLPQEYLELEN++D I++VYE+FL+VT VYE+ESYDYP  V +SVNE
Sbjct: 43  MVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE 102

Query: 122 FSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHE-- 179
           FSK +++K+ ELS A+S  EAQNIL++PGP K+PKTLNYA+SKVAL +SEYL+ S  +  
Sbjct: 103 FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPM 162

Query: 180 DETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRL 239
           D  ++  LL YSDVQ K+AQARLQQDT IQTKFNK +RE LA  + +A KARK+V++KRL
Sbjct: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222

Query: 240 QYDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVS 299
           QYD+AR NL NAKPEKEA LRVQME+LED+FAQATEDAT VMQ+VIAS+ FL  L EL +
Sbjct: 223 QYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELAT 282

Query: 300 AQLAYYKLSTELLSDFL 316
           AQL YY+ S +L+ +F+
Sbjct: 283 AQLEYYEQSAKLMKEFI 299

>YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic protein
           with possible role in cell-cycle regulation [981 bp, 326
           aa]
          Length = 326

 Score =  382 bits (981), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/318 (61%), Positives = 245/318 (77%), Gaps = 26/318 (8%)

Query: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60
           MSFNAFA SL+KK QE+STSVS+K QE                        LPSLAQSTQ
Sbjct: 1   MSFNAFASSLSKKLQEISTSVSEKTQE------------------------LPSLAQSTQ 36

Query: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120
           R+VQERLGQVTDISQLP+EY ELE+++D I+L+Y +FL VT +YE+ SYDYP  + +SVN
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKS-GHE 179
           EFS++V+SKL EL+HA+S  EAQNIL++PGP K+PKTLNYALSKVAL SSE L+K    E
Sbjct: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTE 156

Query: 180 DETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRL 239
           ++ +A+ALL++SDVQAKIAQAR+QQDTLIQTKFNK LRE L+ ++ KA K RK+V + RL
Sbjct: 157 EQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRL 216

Query: 240 QYDIARANLA-NAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELV 298
           +YD+AR NLA N KPEKEASLRVQME+LED+FAQ TEDAT  +Q+VI+ + F +DL EL 
Sbjct: 217 RYDVARTNLANNKKPEKEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELA 276

Query: 299 SAQLAYYKLSTELLSDFL 316
            AQ  Y++ S  L+ +FL
Sbjct: 277 KAQAEYFETSAGLMKEFL 294

>Scas_704.45
          Length = 329

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 250/337 (74%), Gaps = 28/337 (8%)

Query: 2   SFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQR 61
           SFN+F +S +K   ELS++VSQK                    TQ+L+T+LP+LAQSTQR
Sbjct: 3   SFNSFTNSFSKTLSELSSTVSQK--------------------TQELSTNLPNLAQSTQR 42

Query: 62  LVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNE 121
           +VQERLGQVTDISQLP+EYLELE ++D I+ +Y+NFL V+ VYE +SYDYP   ++S+ E
Sbjct: 43  MVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIE 102

Query: 122 FSKTVSSKLHELSHASSTDEAQNILI-SPGPAKDPKTLNYALSKVALTSSEYLSKSGHED 180
           FSKT +SK+ ELSHASS  EAQNIL  S    K+PKTLN+ALSKVAL SSE+L++    +
Sbjct: 103 FSKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNE 162

Query: 181 --ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKR 238
             ++ A+ALL +S++QAKIAQARLQQD LI+ KFN  LR  LA+++ KA K RKEV++KR
Sbjct: 163 AFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKR 222

Query: 239 LQYDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELV 298
           LQYDIAR NL NAKPEKEASLRVQME+LED+FAQATE AT VMQDVI +S+ +  ++EL 
Sbjct: 223 LQYDIARTNLMNAKPEKEASLRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELA 282

Query: 299 SAQLAYYKLSTELLSDFL-----PQLEAPAISTETQE 330
            AQLAY++LS+ L+ +F        + AP  +TET E
Sbjct: 283 RAQLAYFELSSSLMKEFTEGSTSASIPAPPTTTETSE 319

>KLLA0E04433g complement(406764..407672) similar to sp|P40531
           Saccharomyces cerevisiae YIL041w singleton, start by
           similarity
          Length = 302

 Score =  357 bits (917), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 185/315 (58%), Positives = 244/315 (77%), Gaps = 17/315 (5%)

Query: 6   FADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQE 65
           + DS +KK QELSTSVSQKAQEAQLD+KFKDL            T+LP LA STQR++QE
Sbjct: 4   YFDSFSKKVQELSTSVSQKAQEAQLDQKFKDLK-----------TNLPLLANSTQRMLQE 52

Query: 66  RLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKT 125
           +LGQVTDISQLP EY++LE+R++ I+L+YENFLKVT++YE+ESYDYP+NV++SV+EFSK 
Sbjct: 53  KLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKL 112

Query: 126 VSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHEDETIAT 185
           V  KLH+LS  ++ ++AQN+L+S    K+PKTLNYALSKVALTSSE++     EDE++A 
Sbjct: 113 VGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHV-----EDESLAN 167

Query: 186 ALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIAR 245
            L KYSD Q KIAQ RLQQDT+IQTKFNK ++E L  D+  + KARK VE KRLQYD+ R
Sbjct: 168 FLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

Query: 246 AN-LANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAY 304
           +N L N KPEK+A+L+V+  + E+EFA+AT+DA   M  V+  ++F  +L ELV+AQLAY
Sbjct: 228 SNRLKNTKPEKQAALQVEESTHEEEFAKATDDAIIAMSKVVELADFSANLHELVAAQLAY 287

Query: 305 YKLSTELLSDFLPQL 319
           +K S E+L + + ++
Sbjct: 288 HKSSAEILEELVNEV 302

>Kwal_55.21227
          Length = 376

 Score = 90.5 bits (223), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 91/365 (24%), Positives = 157/365 (43%), Gaps = 76/365 (20%)

Query: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60
            SFN   D+L        T+ + K Q+         LS A++    D   ++ SL ++ +
Sbjct: 8   FSFNKLTDTL--------TNAAHKTQDT--------LSTAIANIQLDDPQAILSL-KARK 50

Query: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120
             +QE LG + DIS+LP +Y  LE + D +       L VT+ +E E YDYP N+ +S++
Sbjct: 51  HYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLS 110

Query: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHED 180
           ++  +    L  L  +S  D+      +   A  P++   A++K A  S + L+    ++
Sbjct: 111 DWWSSNKEGLFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQE 170

Query: 181 ETIA----------TALLK----YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNK 226
           +  +          T L+K    +S+ Q KI Q + + D L+  +FN+KL   +      
Sbjct: 171 QQASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKN 230

Query: 227 AVKARKEVENKRLQYDIARAN-----------LANAKPE-KEASLRVQ------------ 262
           A   R++VE+ RL++D  R             + N K + KE+ L  +            
Sbjct: 231 ASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNE 290

Query: 263 ---------------------MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQ 301
                                +E LEDEF   T +A   M ++  S+E L  +    + Q
Sbjct: 291 VGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQ 350

Query: 302 LAYYK 306
           L Y++
Sbjct: 351 LVYHR 355

>AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)
           [1095 bp, 364 aa]
          Length = 364

 Score = 86.3 bits (212), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 152/347 (43%), Gaps = 51/347 (14%)

Query: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60
           +S +  A++LN   Q+      QK  E Q     + L+ A+     D   ++ SL ++ +
Sbjct: 8   ISLDKLANTLNNAAQK----TQQKLSETQ-----EHLTHAIQNIKIDDPKTILSL-KTRK 57

Query: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120
           R +QE LG   DISQLP +Y  LE + D I  V +  L V++ +E E YDYP N  +S++
Sbjct: 58  RQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESIS 117

Query: 121 EFSKTVS--SKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGH 178
           ++  T +  ++  +     +  + ++       + DP +  +AL + A  S   + +   
Sbjct: 118 DWWNTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKE 177

Query: 179 ED--------------ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDL 224
           +               E++      ++D Q  +  A+ + D  +  +FN+KL+  L  + 
Sbjct: 178 QAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEF 237

Query: 225 NKAVKARKEVENKRLQYDIAR-----ANLANAKPEKEA--------------------SL 259
            K    R++VE  RL +D  +      + A AK + EA                    + 
Sbjct: 238 KKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAF 297

Query: 260 RVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306
             Q+E  EDEF   T +A   M  +  +++ +  +    + QL Y++
Sbjct: 298 YAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHR 344

>CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 385

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 112/237 (47%), Gaps = 25/237 (10%)

Query: 37  LSQAVSQRTQDLTTSL--PSLAQSTQ---RLVQERLGQVTDISQLPQEYLELENRIDRIR 91
           ++Q++S+ TQ L      P    S +   R +QE +G   DIS+LP +Y+ LE + D I 
Sbjct: 9   ITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIE 68

Query: 92  LVYENFLKVTQVYEHESYDYPNNVRDS------------VNEFSKTVSSKLHELSHASST 139
            V +  L VT+ YE E YDYP N+ +S            ++E +K V  K H     + T
Sbjct: 69  KVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPK-HGNVEKAGT 127

Query: 140 DEAQNILISPGPAKDPKTLNYALSKVALTSS---EYLSKSGHEDETIATALLK----YSD 192
           + ++ +       + P +   A+++    S    E +     +++     L+K    +SD
Sbjct: 128 EASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKEDIDELVKIFKIWSD 187

Query: 193 VQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLA 249
              +I+ ++ + D ++  +FN KL + L  +  K    R +VE  RL +D  R  +A
Sbjct: 188 CFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVA 244

>KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 389

 Score = 74.7 bits (182), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 156/374 (41%), Gaps = 99/374 (26%)

Query: 17  LSTSVSQKAQEAQLDKKFKDLSQAVSQ-RTQDLTTSLPSLAQSTQRLVQERLGQVTDISQ 75
           ++ S+S  AQ  Q     +  S A+ +    D  T L  L +  Q  +QE LG V DISQ
Sbjct: 10  ITDSISNAAQRTQ-----EQFSSAIEKIHLDDPETRLSILKRRHQ--LQETLGTVHDISQ 62

Query: 76  LPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSK-------TVSS 128
           LP +Y  LE + D +  + +  L VT+ +E E YDYP N+ +S N++         + S 
Sbjct: 63  LPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSK 122

Query: 129 KLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYL--------------S 174
           K  E+S     + A+N L+       P++   ALSK A  S+  L              S
Sbjct: 123 KKAEVS-PEVKETAENGLL-------PRSFAQALSKAATDSALILKQLKAEETRTNQEES 174

Query: 175 KSGHE----DETIA----------------------TALLKYSDVQAKIAQARLQQDTLI 208
           + G +    +ET A                       A   ++  Q  I Q++ + D+L+
Sbjct: 175 QEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLM 234

Query: 209 QTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANL---------------ANAK- 252
             +FN KL + + +D  K  + R +V++ RL +D  R  +               A  K 
Sbjct: 235 VKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKKV 294

Query: 253 -------PEKEASLR-VQM------------ESLEDEFAQATEDATGVMQDVIASSEFLK 292
                  PEK+ +   V M            E LED+F  AT +    + ++  SSE + 
Sbjct: 295 ATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIIS 354

Query: 293 DLSELVSAQLAYYK 306
            +    + QL +YK
Sbjct: 355 LVKLFHNFQLIHYK 368

>Scas_676.18
          Length = 444

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 103/236 (43%), Gaps = 39/236 (16%)

Query: 37  LSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYEN 96
           LS A++  T D  T L SL +S +RL QE +G V DIS LP++Y  LE R D +      
Sbjct: 25  LSNAITTAT-DPATKL-SL-RSQKRLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRR 81

Query: 97  FLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPK 156
            L V++ +E E YDYP N+ +S +++           S +S   + Q      G    P+
Sbjct: 82  ILIVSKTFEMEGYDYPPNLSESFSDW----------WSLSSKKKKEQEKEDKKGFL--PR 129

Query: 157 TLNYALSKVALTSSEYLSKSGHEDETIATA--------------------LLKYSDVQAK 196
           +   A+S  A    E        D+                         L+K  D  AK
Sbjct: 130 SFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEEDEDVKNLIKTFDSWAK 189

Query: 197 ----IAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANL 248
               I Q + + D+++  +FN KL + L  +  K    RK V++ RL++D  R  L
Sbjct: 190 CYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDTVRYEL 245

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 263 MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306
           +E LED F  +T  A  +M+++  SSE +  +    + QL YY+
Sbjct: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYR 426

>YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protein
           of unknown function [1308 bp, 435 aa]
          Length = 435

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%)

Query: 57  QSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116
           +S  R VQE LG V+DIS+LP +Y  LE + D +  V +  L V++ +E E YDYP N+ 
Sbjct: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108

Query: 117 DSVNEF 122
           +S++++
Sbjct: 109 ESISDW 114

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 190 YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLA 249
           +S     I + + + D+++  +FNKKL   +  D  K    RK+VE  RL++D  R  + 
Sbjct: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVK 280

Query: 250 NAKPEKEA 257
             + E EA
Sbjct: 281 AKEAELEA 288

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 245 RANLANAKPEKEASLRVQM-ESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLA 303
           ++N  N +P  E S   ++ E LEDEF   T  A   M+++  SSE L  +    + QL 
Sbjct: 355 KSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLV 414

Query: 304 YYK 306
           Y++
Sbjct: 415 YFR 417

>AAR137W [324] [Homologous to ScYOR058C (ASE1) - SH]
           complement(586622..589288) [2667 bp, 888 aa]
          Length = 888

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 67  LGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTV 126
           +G + D+++L Q+  EL NR+ + +      LK+ Q       D  + ++D +  +++  
Sbjct: 307 VGNIMDVAKLYQK--ELSNRLGKAKRTCHGLLKLLQTLGMNIMDLGDEIKDKIRIYTQKS 364

Query: 127 SSKLHELSHAS 137
              + +LSH++
Sbjct: 365 EETICDLSHST 375

>KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces
            cerevisiae YPR189w SKI3 antiviral protein singleton,
            start by similarity
          Length = 1401

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 15   QELSTSV---SQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQVT 71
            QELS+ V   SQ  +++Q D     LS    +R  D TT+  SLAQ    LV+ER  +  
Sbjct: 1083 QELSSVVFGLSQYLKKSQNDVFATQLSILALERLHDFTTA-TSLAQHLSTLVEERFEKTQ 1141

Query: 72   DISQLPQEYLELENRIDRIRLVYENF 97
            D S+L    L L+ ++ R+ L Y ++
Sbjct: 1142 DESELLNFAL-LKTQLARLYLGYADY 1166

>KLLA0C06226g 550683..552461 similar to sp|P32807 Saccharomyces
           cerevisiae YMR284w HDF1 high-affinity DNA-binding
           protein singleton, start by similarity
          Length = 592

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 77  PQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHE--LS 134
           P E+L +++R  R+R V      V  +Y++    Y N V   +    K     ++   L 
Sbjct: 180 PAEFLNVDSR-SRLRKV------VDDLYDY----YINFVTFFIGSEDKPFDDSMYADILK 228

Query: 135 HASSTDEAQNILISPGPAKDPKTLNYALSKVALT 168
             S  +EAQ+ L S GP+ +P   +Y  SKV  T
Sbjct: 229 WGSKINEAQSWLSSHGPSTNPINASYIKSKVKRT 262

>Kwal_23.5856
          Length = 159

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 106 HESYDYPNNVRDSVNEFSKTVSSKLHE 132
           HES+D P  ++D+VN  SK     LH+
Sbjct: 59  HESHDDPEKIKDTVNSHSKKFVRHLHQ 85

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
           Saccharomyces cerevisiae YLR117c CLF1, start by
           similarity
          Length = 695

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (82%), Gaps = 3/23 (13%)

Query: 80  YLELENRI---DRIRLVYENFLK 99
           Y++LE ++   DR+R++YENFLK
Sbjct: 439 YIDLETKLREFDRVRILYENFLK 461

>Scas_614.18
          Length = 185

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 94  YENFLKVTQVYEHESYDYPNNVRDS----VNEFSKTVSSKLHELSHASSTDEAQNILISP 149
           + +F KVT+ ++  +Y    ++RDS    ++EF+    S      H   T E  N L+  
Sbjct: 65  HCHFTKVTKFFKINNYAISASIRDSRFQLLSEFTPKCVSNFERRHHRRLTSETLNCLLVI 124

Query: 150 GPA 152
           G A
Sbjct: 125 GDA 127

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 128 SKLHELSHASSTDEAQNILISPGPAKD 154
           S  H L+ AS+   A NIL++P P +D
Sbjct: 503 SDYHPLTKASALSSAANILVAPPPTQD 529

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.123    0.312 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,484,780
Number of extensions: 381485
Number of successful extensions: 2148
Number of sequences better than 10.0: 205
Number of HSP's gapped: 2108
Number of HSP's successfully gapped: 226
Length of query: 330
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 228
Effective length of database: 13,065,073
Effective search space: 2978836644
Effective search space used: 2978836644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)