Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2174.241341321940.0
Kwal_47.1815141440015360.0
ADL116C43536814040.0
CAGL0L00869g41939413021e-179
KLLA0E04455g42138811761e-160
YIL042C39438310311e-138
Scas_704.444434499381e-124
KLLA0F27423g5122812028e-17
AER270W4892741947e-16
Kwal_14.18254922791922e-15
CAGL0F07007g4852841868e-15
AAR157C5032851822e-14
KLLA0C05654g4732791795e-14
Scas_563.94922881582e-11
Sklu_2299.65302891574e-11
YGL059W4911891361e-08
Scas_698.14118381850.025
KLLA0A00638g115581810.078
CAGL0H06567g116979780.17
AFR284W110395780.17
YIL147C (SLN1)122081760.27
Kwal_55.19707114381730.73
Scas_671.16723136720.89
KLLA0D10153g65526655.8
Sklu_2253.4915175638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2174.2
         (413 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement         849   0.0  
Kwal_47.18151                                                         596   0.0  
ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352) [...   545   0.0  
CAGL0L00869g complement(105236..106495) similar to sp|P40530 Sac...   506   e-179
KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces c...   457   e-160
YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein...   401   e-138
Scas_704.44                                                           365   e-124
KLLA0F27423g complement(2537353..2538891) similar to ca|CA5524|I...    82   8e-17
AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761...    79   7e-16
Kwal_14.1825                                                           79   2e-15
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    76   8e-15
AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1...    75   2e-14
KLLA0C05654g complement(504568..505989) similar to sp|P53170 Sac...    74   5e-14
Scas_563.9                                                             65   2e-11
Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement       65   4e-11
YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with simi...    57   1e-08
Scas_698.14                                                            37   0.025
KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1 ...    36   0.078
CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces c...    35   0.17 
AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH] complement(...    35   0.17 
YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-componen...    34   0.27 
Kwal_55.19707                                                          33   0.73 
Scas_671.16                                                            32   0.89 
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    30   5.8  
Sklu_2253.4 YPR160W, Contig c2253 5679-8426 reverse complement         29   8.6  

>Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement
          Length = 413

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/413 (100%), Positives = 413/413 (100%)

Query: 1   MLRSVLRKKISAKSTVLVPRLRFSTTASLTIKHSSHHNRRNERLLSGLGFEQLYQIRSSI 60
           MLRSVLRKKISAKSTVLVPRLRFSTTASLTIKHSSHHNRRNERLLSGLGFEQLYQIRSSI
Sbjct: 1   MLRSVLRKKISAKSTVLVPRLRFSTTASLTIKHSSHHNRRNERLLSGLGFEQLYQIRSSI 60

Query: 61  ELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXY 120
           ELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLS Y
Sbjct: 61  ELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXY 120

Query: 121 IAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFE 180
           IAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFE
Sbjct: 121 IAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFE 180

Query: 181 EVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSPAIGVLHKNLKISELIH 240
           EVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSPAIGVLHKNLKISELIH
Sbjct: 181 EVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSPAIGVLHKNLKISELIH 240

Query: 241 RVEEFVGDLCFVKYDRQVPVKILYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKER 300
           RVEEFVGDLCFVKYDRQVPVKILYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKER
Sbjct: 241 RVEEFVGDLCFVKYDRQVPVKILYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKER 300

Query: 301 DLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIP 360
           DLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIP
Sbjct: 301 DLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIP 360

Query: 361 GEEVNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLLK 413
           GEEVNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLLK
Sbjct: 361 GEEVNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLLK 413

>Kwal_47.18151
          Length = 414

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/400 (71%), Positives = 334/400 (83%), Gaps = 7/400 (1%)

Query: 20  RLRFSTTA------SLTIKHSSHHNRRNERLLSGLGFEQLYQIRSSIELLIQDYANKPIP 73
           RLR++  A      +L      H       +L  +GFE+LY+IRS+ ELLIQD+A KPIP
Sbjct: 16  RLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRSNTELLIQDFAKKPIP 75

Query: 74  AISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXYIAVVNPNVEESNR 133
           AISYE+L+ YK PLTDNEKY+L I+TVNLLL YTCRRL AIQKL  YIAV+NPN+EE+NR
Sbjct: 76  AISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLP-YIAVLNPNIEETNR 134

Query: 134 LYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFEEVMEFYQQEAVFE 193
           LYL+TLESLLS+++PYGLHDQE M  KLT+FLDDHQDTL+TLSRGF+E+MEF+ +E+VFE
Sbjct: 135 LYLRTLESLLSLNYPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGFQEIMEFFPKESVFE 194

Query: 194 FLNQHLRDRISMKLLVTHYLALVQQQDKNSPAIGVLHKNLKISELIHRVEEFVGDLCFVK 253
           FLN HLRDRISMKLL THYLA+V Q  ++   IGVLH+ +KISEL+ RVEEFVGDLC+VK
Sbjct: 195 FLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKISELVCRVEEFVGDLCYVK 254

Query: 254 YDRQVPVKILYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKERDLTEKPIEVTIVR 313
           YD+QVP+KIL G DVTFPCIPTDLEYVLTE+LKNSSRAHIE ST + +  EKP+EVTIVR
Sbjct: 255 YDQQVPIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEKPVEVTIVR 314

Query: 314 SDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFG 373
            D DL+IRIRDFGGGIPP VEDRMF+YSYSTV  + KD+GMSAYVIPG +V NVSGMGFG
Sbjct: 315 KDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFG 374

Query: 374 LPMCKAYLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLLK 413
           LPMCKAY+EMF+G+LDIQSL+GWGTD YI LKGP+ K  K
Sbjct: 375 LPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGPDPKCFK 414

>ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352)
           [1308 bp, 435 aa]
          Length = 435

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/368 (70%), Positives = 308/368 (83%), Gaps = 2/368 (0%)

Query: 45  LSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLL 104
           LS L FEQLYQ+RS++E+LIQDYA + IP I+YE+L+ Y PPL+DNE+++L IK +N+LL
Sbjct: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125

Query: 105 AYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKF 164
            YTCRRL A+Q+L  YIAV+NPN+EESNRLYLKTLESLL+I+ PYGLHD  AM  KL  F
Sbjct: 126 TYTCRRLLALQRLP-YIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITF 184

Query: 165 LDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSP 224
           LDDH DTL+TLS+GFEE+M+FY Q+ VF+FLN HLRDR+SMKLLVTHYL LV+Q    + 
Sbjct: 185 LDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQS-SGAD 243

Query: 225 AIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQVPVKILYGADVTFPCIPTDLEYVLTEI 284
            IGVL K L I+EL+ R EEFVGDL FVKYDR VPV IL G DVTF CIP DLEYVL EI
Sbjct: 244 CIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEI 303

Query: 285 LKNSSRAHIENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYST 344
           LKNS+RAHIEN T      EKPIEVTIVRS  DLEIRIRDFGGGIPP+VEDRMF+YSY+T
Sbjct: 304 LKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTT 363

Query: 345 VQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
            + + KDTGMSAY+IPG++V+NVSGMGFGLP+CKAY+EMF+G LDI SL+GWGTDVYI+L
Sbjct: 364 SEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423

Query: 405 KGPENKLL 412
           KGP+  LL
Sbjct: 424 KGPKESLL 431

>CAGL0L00869g complement(105236..106495) similar to sp|P40530
           Saccharomyces cerevisiae YIL042c, hypothetical start
          Length = 419

 Score =  506 bits (1302), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 247/394 (62%), Positives = 318/394 (80%), Gaps = 7/394 (1%)

Query: 26  TASLTIKHSSHHNRRN-ERLLSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYK 84
            AS+ +K+S + +  N +  L  L F++ Y+IRS+IELLIQ+YA+KPIP ++Y+YL+ YK
Sbjct: 22  AASVLLKNSKYGSVANYQDRLKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYK 81

Query: 85  PPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLS 144
           PPL+ NE+Y+L IKT+NLLL+YTCRRL AIQKL  Y+A VNP++E+S  LYLKTLESLLS
Sbjct: 82  PPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLP-YVAAVNPSIEKSYSLYLKTLESLLS 140

Query: 145 IDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRIS 204
           I+FPY LHD++ +   L +FLDDHQDT+ TLSRG EE+M+F +++ +F+FL++HLRDRI+
Sbjct: 141 IEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIA 200

Query: 205 MKLLVTHYLALVQQQDKNSP-AIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQV-PVKI 262
           MK+L T++LA+      + P  IG +HK L +++++ +V EFV DLCFVKYD+ V PVKI
Sbjct: 201 MKILATNHLAVSNHNRDSDPNMIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKI 260

Query: 263 LYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKERDLTEKPIEVTIVRS---DCDLE 319
             G DVTFPCIPT LEYVLTEILKNS RAHIEN+T    L EKP+EV IV+    D +LE
Sbjct: 261 YGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELE 320

Query: 320 IRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKA 379
           IRIRDFGGGIPP VE  +FEYSY+TV+++ K++G SAYVIPGE++N VSGMGFGLPMCKA
Sbjct: 321 IRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKA 380

Query: 380 YLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLLK 413
           Y+EMFDG LDIQSL+GWGTDVYIKLKGP  K+L+
Sbjct: 381 YIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKMLE 414

>KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces
           cerevisiae YIL042c, hypothetical start
          Length = 421

 Score =  457 bits (1176), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 300/388 (77%), Gaps = 8/388 (2%)

Query: 25  TTASLTIKHSSHHNRRNERLLSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYK 84
           T +S    H  +++R+  + ++ L F++LY IRS+I+ LIQDY++  IP I + +L  Y+
Sbjct: 40  TVSSHNRLHRRNNHRKRSKEMTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYR 99

Query: 85  PPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLS 144
            PL DNEKY L IKT+NLLL  TC RLA++Q+L  YIA+VNPN+E+SNRLYLKTLESLLS
Sbjct: 100 GPLQDNEKYFLTIKTLNLLLTLTCHRLASLQELP-YIALVNPNIEQSNRLYLKTLESLLS 158

Query: 145 IDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRIS 204
           I++PY L+D + +     +FL+DHQDTL+TLS G +EV  FY  E +F+FLN+HL DRI 
Sbjct: 159 IEYPYDLYDTDKIQNLTEEFLNDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRIL 218

Query: 205 MKLLVTHYLALVQQQDKNSPAIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQVPVKILY 264
           MKLL T+YL L++Q   +   IGV+HK+L IS+L+ R  EFV DL F+KYD+ VPVKI+ 
Sbjct: 219 MKLLTTNYLKLLEQTSSDE-VIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIME 277

Query: 265 GADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKERDLTEKPIEVTIVRSDCDLEIRIRD 324
           G+DV F  IPTDLEYVL E+LKNSSRAHIEN+       +K +EVTIV++D  LEIRIRD
Sbjct: 278 GSDVKFSYIPTDLEYVLQELLKNSSRAHIENNV------DKDVEVTIVKNDDQLEIRIRD 331

Query: 325 FGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKAYLEMF 384
           FGGGI P+VEDR+F+YS+ST     KD+GMS YV+PG+EV NV+GMGFGLPMCKAYLE+F
Sbjct: 332 FGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELF 391

Query: 385 DGSLDIQSLYGWGTDVYIKLKGPENKLL 412
           +G+LDIQSL+GWGTDVYI+L GP ++L 
Sbjct: 392 NGTLDIQSLWGWGTDVYIRLHGPSDRLF 419

>YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein
           with similarity to mitochondrial branched chain
           alpha-ketoacid and pyruvate dehydrogenase protein
           kinases [1185 bp, 394 aa]
          Length = 394

 Score =  401 bits (1031), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 273/383 (71%), Gaps = 13/383 (3%)

Query: 35  SHHNRRNERLLSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYV 94
           +H  R +  LLS L F+Q Y+IRS+IELLIQDYA+KPI  ++YEY   Y+PPLT  E+Y+
Sbjct: 16  AHRQRPSHELLSQLSFDQHYKIRSNIELLIQDYASKPIAPLNYEYFLQYRPPLTKKEEYM 75

Query: 95  LVIKTVNLLLAYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQ 154
           L IKT+NLLL+ TC+RL AIQ+L  Y AV+NP++E +N LYLK+L++LLSI +PY LH+ 
Sbjct: 76  LTIKTINLLLSLTCKRLNAIQRLP-YNAVINPHIERTNSLYLKSLQTLLSIAYPYELHNP 134

Query: 155 EAMVTKLTKFLDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLA 214
             +  K T+ LDDH+D ++ L++G +E+   Y +  + +FLN HL++RI+MKLLVTHYL+
Sbjct: 135 PKIQAKFTELLDDHEDAIVVLAKGLQEIQSCYPKFQISQFLNFHLKERITMKLLVTHYLS 194

Query: 215 LVQQQ--DKNSPAIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQ-VPVKILYGA-DVTF 270
           L+ Q   D N   IG+LH++L I++LI  V ++V D+CFVK++ Q  PV I   + D+TF
Sbjct: 195 LMAQNKGDTNKRMIGILHRDLPIAQLIKHVSDYVNDICFVKFNTQRTPVLIHPPSQDITF 254

Query: 271 PCIPTDLEYVLTEILKNSSRAHIENSTKERDLTEKPIEVTIVRSDCD-LEIRIRDFGGGI 329
            CIP  LEY++TE+ KN+  A I    +       PIE+ +++ D D L +RIRD GGGI
Sbjct: 255 TCIPPILEYIMTEVFKNAFEAQIALGKEHM-----PIEINLLKPDDDELYLRIRDHGGGI 309

Query: 330 PPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKAYLEMFDGSLD 389
            PEVE  MF YSYST    + D+  +   +PGE++NNVSGMGFGLPMCK YLE+F G +D
Sbjct: 310 TPEVEALMFNYSYSTHTQQSADSESTD--LPGEQINNVSGMGFGLPMCKTYLELFGGKID 367

Query: 390 IQSLYGWGTDVYIKLKGPENKLL 412
           +QSL GWGTDVYIKLKGP    L
Sbjct: 368 VQSLLGWGTDVYIKLKGPSKTAL 390

>Scas_704.44
          Length = 443

 Score =  365 bits (938), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 204/449 (45%), Positives = 292/449 (65%), Gaps = 47/449 (10%)

Query: 1   MLRSVLR-KKISAKSTVLVPRLRFSTTASLTIKHSSHHNRRNERL--LSGLGFEQLYQIR 57
           ML+S +R  ++  KS +  P    S T +    H+ HH + N+    LS L F+  Y+IR
Sbjct: 1   MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHA-HHLKHNKAAINLSHLDFQAYYKIR 59

Query: 58  SSIELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKL 117
           S+IELLIQDY+ KPIP +SY++L+ Y+ PL+  EKY L IKT+N L++ TCR+L+ IQ L
Sbjct: 60  SNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNL 119

Query: 118 SXYIAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSR 177
             YI ++NP + + N LYLKTLESLLSI FPY L+  + +++ L    ++H DTL+ LS 
Sbjct: 120 P-YIVLLNPKINQINSLYLKTLESLLSITFPYDLYKNDLILSLLNHLNEEHNDTLLVLSD 178

Query: 178 GFEEV-MEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSP-AIGVLHKNLKI 235
           G +E+  E    EA+ +FL+ H+RDRI+MKL++ ++LAL+    K  P  IG++HK +KI
Sbjct: 179 GLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSP--KTEPDMIGIIHKRVKI 236

Query: 236 SELIHRVEEFVGDLCFVKYDRQVP-------VKILYGADVTFPCIPTDLEYVLTEILKNS 288
           S+ I++  EFV DLC +K++  +        +  + G ++ FPCIP  LEYVLTEILKNS
Sbjct: 237 SQFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNS 296

Query: 289 SRAHIENSTKERDLTEKPIEVTIVRSDCD-LEIRIRDFGGGIPPEVEDRMFEYSYSTVQA 347
            +AHIEN     D+T KPIE++I  +D D L +RIRD+GGGI P++E ++F+YS+ST   
Sbjct: 297 MKAHIEN-----DVT-KPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLD 350

Query: 348 NT-----------------------KDTGMSAYVIPGE-EVNNVSGMGFGLPMCKAYLEM 383
           +T                        D+ +   ++PGE E N +SGMG+GLP+CK YLE+
Sbjct: 351 STFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLEL 410

Query: 384 FDGSLDIQSLYGWGTDVYIKLKGPENKLL 412
           FDG + IQ+L+G GTDVYIK+KGP   LL
Sbjct: 411 FDGDITIQNLWGLGTDVYIKVKGPNKSLL 439

>KLLA0F27423g complement(2537353..2538891) similar to
           ca|CA5524|IPF2861 Candida albicans putative pyruvate
           dehydrogenase kinase, hypothetical start
          Length = 512

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 130/281 (46%), Gaps = 50/281 (17%)

Query: 168 HQDTLITLSRGFEEVMEFYQQ----EAVFEFLNQHLRDRISMKLLVTHYLALVQ--QQDK 221
           H  T+ITL++G  +  + +QQ    +++  FL++    RI +++L+   LAL++  +Q  
Sbjct: 227 HDATVITLAKGVLKWKKTHQQNVVDDSIQSFLDRFYLSRIGIRMLIGQQLALLESARQPA 286

Query: 222 NSP-------AIGVLHKNLKISELIHRVEEFVGDLCFVKYD-RQVP-VKILY-------- 264
             P        +G++     I++L     +    +C   Y   + P V++L         
Sbjct: 287 EGPFDEDDEDWVGIICTKTNITQLSKTAIDNARHICAEHYGLYEAPKVQLLTFPLDYRPS 346

Query: 265 ----------GADVTFPCIPTDLEYVLTEILKNSSRAHIEN------STKERDLTEKPIE 308
                       D+ F  +P  L ++L E LKN+ RA +E       S  + DL    ++
Sbjct: 347 TEEKSGCPNESPDIEFMYVPGHLIHMLFETLKNALRATVEKTIEKNPSVDKYDLKFPDVK 406

Query: 309 VTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTK----DTGMSA-YVIPGEE 363
           V I     DL ++I D GGGI       ++ Y Y+T+  N +    D  MS  + IP   
Sbjct: 407 VIITEGTEDLTVKISDEGGGIARSNLPLVWTYLYTTMPENEQIGLMDEEMSQNFRIP--- 463

Query: 364 VNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
              ++G G+GL + + Y   F G L + S+ G+GTDVY+ L
Sbjct: 464 ---MAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHL 501

>AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761)
           [1470 bp, 489 aa]
          Length = 489

 Score = 79.3 bits (194), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 127/274 (46%), Gaps = 37/274 (13%)

Query: 168 HQDTLITLSRGFEEVMEFYQQEAVFE----FLNQHLRDRISMKLLVTHYLALVQQQ---- 219
           H  T++TL+RG        +   V      +L++    RI +++L+  +L+L++Q     
Sbjct: 205 HDATVVTLARGLLRWKRTQKNNVVDASIKGYLDRFYMGRIGIRMLIGQHLSLLEQAMHSD 264

Query: 220 ----------DKNSPAIGVLHKNLKISELIHRVEEFVGDLCFVKYD---------RQVPV 260
                       ++  +G++    K++++     +    +C   Y+           +P+
Sbjct: 265 LACEHVPGAVGSDADYVGIVCTRTKVAQVADIAIDRARHICAEYYNLYEAPKVELHTIPI 324

Query: 261 KILYGA---DVTFPCIPTDLEYVLTEILKNSSRAHIENSTKER-------DLTEKPIEVT 310
           K    +   ++ F  +P+ L ++L E+LKN+ RA +E++ ++         L   P++V 
Sbjct: 325 KRDDSSGLREIEFTYVPSHLVHMLFEVLKNALRATVESTIQKNPGVTDYDSLRFPPVKVI 384

Query: 311 IVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGM 370
           I     +L ++I D GGGI       ++ Y Y+T+  + +D+ +            ++G 
Sbjct: 385 ISEGTEELAVKISDEGGGIARSNLPLVWTYLYTTMTDDEQDSLIDGDSTLSGSCPPMAGY 444

Query: 371 GFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
           G+GL + + Y   F G L + S+ G+GTDVY+ L
Sbjct: 445 GYGLALSRLYARHFGGDLRLLSMDGYGTDVYLHL 478

>Kwal_14.1825
          Length = 492

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 124/279 (44%), Gaps = 58/279 (20%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQ----QDKNSPAIGVLHKNLKISE 237
           +++    E + E ++  LR RIS +L+V  +L++       + +N+  +G + +     E
Sbjct: 201 ILDLCPPEKMDEVISSLLRARISRRLIVEEHLSITSNYHSGKKENTLVLGDIFQECSARE 260

Query: 238 LI----HRVEEFVGDLCFVKYDRQVPVKILYG-ADVTFPCIPTDLEYVLTEILKNSSRAH 292
            +       E+F+ D+ +V    ++P  I+ G  D+ F  +P  L+Y+L E+L+NS  A 
Sbjct: 261 FLLGAKSMCEKFIQDMYYVGI--KLPEFIIDGKTDLKFYFLPLHLKYLLGEVLRNSYEAT 318

Query: 293 IENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPE-------------------- 332
           ++   +      +PI VT+V ++     RI D  GGIP +                    
Sbjct: 319 MQEYIRLGLKDPEPITVTVVSNESSFIFRISDRAGGIPHDEKTIWSFGKSKELARKSLSN 378

Query: 333 ---------------VEDR------MFEYSYST---VQANTKDTGMSAYVIP---GEEVN 365
                          V D        F Y +++   + A+   TG+  +  P     E +
Sbjct: 379 FHKLPGLQTVSLYDHVTDHHPGHSSTFPYKFTSLEPINASNLPTGLHKFEKPLLGLLERS 438

Query: 366 NVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
           +   +G GL MCK Y E ++G L + SL G+GTD  +KL
Sbjct: 439 SRYKLGIGLAMCKVYAEYWNGDLTVHSLQGYGTDTVLKL 477

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 128/284 (45%), Gaps = 65/284 (22%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQ----QDKNSPAIGVLHKNLKISE 237
            ++ Y  + + + L+  LR RIS +L+V  ++++       + KN+  +G + +     E
Sbjct: 191 TLDLYPTDKMDKLLSDLLRARISRRLIVEEHISIADNYFSGKKKNTLVLGDIFQECSAKE 250

Query: 238 LI----HRVEEFVGDLCFVKYDRQVPV---KILYGADVTFPCIPTDLEYVLTEILKNSSR 290
            I       E+F+ D+ F      +P+   KI    D+ F  +P+ L+Y+L EIL+N+  
Sbjct: 251 HILGASKICEKFIQDMYF----ESIPMPELKINGETDLKFYFLPSHLKYLLGEILRNTYE 306

Query: 291 AHIENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVED-RMFEYSYSTVQA-- 347
           A I++  ++     +PI +TI++++     RI D  GG+    +D  ++ +  +  QA  
Sbjct: 307 ATIKDYIRKGLPKPEPIVITIIKNEESYLFRICDRAGGLAHHHDDNNIWSFGKTKEQAAQ 366

Query: 348 ----------------------NTKD-----------------TGMSAYVIPGEEVNNVS 368
                                 NT+D                 + +++ V  G EV  + 
Sbjct: 367 SISNFHKLPGLQTVSLYDHLYNNTEDRQVNRAYINTSLEPMAHSNIASAVATGYEVPLLK 426

Query: 369 --------GMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
                    +G GL MCK Y E ++G L + S++G+GTD  +KL
Sbjct: 427 LLKRSFRYKLGIGLAMCKVYAEYWNGDLTLHSIHGFGTDTVLKL 470

>AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1512
           bp, 503 aa]
          Length = 503

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 120/285 (42%), Gaps = 67/285 (23%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQ----QDKNSPAIGVLHKNLKISE 237
           +++ Y Q+A+   ++  LR RIS +L+V  +L++       + +N+  +G + +     E
Sbjct: 209 ILDLYPQDAMDRLMSSFLRARISRRLIVEEHLSVTSNYMSGKSENTLVLGDIFQECSARE 268

Query: 238 -LIHRV---EEFVGDLCFVKYDRQVPVKILYG-ADVTFPCIPTDLEYVLTEILKNSSRAH 292
            L+H     E  + D+ +   D  +P  I+ G AD+ F  +P+ L Y+  E L+NS  A 
Sbjct: 269 YLLHAARICENAIRDMFYP--DIPLPDFIIDGCADLRFYFLPSQLHYLFGETLRNSYEAT 326

Query: 293 IENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDT 352
           ++ + +       PI VT+V++      RI D GGGI P  +  ++ +  S + A     
Sbjct: 327 VKEAIRRGLPKPDPITVTVVQNPESYLFRISDRGGGI-PHPDRTIWSFGKSKLLAQQALD 385

Query: 353 GMSAYVIPGE--------------------------------EVNNVSG----------- 369
               + +PG                                 E N   G           
Sbjct: 386 NF--HKLPGAQTVSLYDHMYDADARRVAAACKLSNTSLQSMAETNLTKGRYKFDFPRPLV 443

Query: 370 ----------MGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
                     +G GL MCK Y E ++G L + S++G GTD  +KL
Sbjct: 444 GLLERPFRYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTVLKL 488

>KLLA0C05654g complement(504568..505989) similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, start by similarity
          Length = 473

 Score = 73.6 bits (179), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 124/279 (44%), Gaps = 61/279 (21%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQ----QDKNSPAIGVLHKNLKISE 237
           +++ Y Q+ +   ++  LR RIS +L+V  +L++       + +N+  +G + +     E
Sbjct: 185 ILDLYPQDKMDALISDLLRARISRRLIVEEHLSITSNYLSGKKENTLVLGDIFQKCNAKE 244

Query: 238 LIHRVEE----FVGDLCFVKYDRQVPVKILYG-ADVTFPCIPTDLEYVLTEILKNSSRAH 292
            ++   E    ++ ++ F     ++P  I+ G  ++ F  +P+ L+++L EIL+NS    
Sbjct: 245 YLNGAREVCEAYINNMYFAGI--KMPELIINGDTELEFYFLPSHLKFLLGEILRNSYEVT 302

Query: 293 IENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDT 352
           ++ + +       P+ VTI+ +D     RI D GGG+P    D+   +S+   +   K +
Sbjct: 303 VKETIRLGLEKAPPVTVTIISNDQSYLFRISDRGGGVPH--SDKQI-WSFGKSKELAKQS 359

Query: 353 GMSAYVIPGEEV---------------------------NNVS----------------- 368
             + + +PG +                            NN++                 
Sbjct: 360 LDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQTSLDRMSENNLTKGKFKVGQPLMELLKRS 419

Query: 369 ---GMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
               +G GL +CK Y E ++G L + S+ G+GTD  +KL
Sbjct: 420 PRYKLGIGLALCKVYAEYWNGDLTVHSIQGYGTDTVLKL 458

>Scas_563.9
          Length = 492

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 121/288 (42%), Gaps = 70/288 (24%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLAL----VQQQDKNSPAIGVLHKNLK--- 234
           ++E   ++ +   L+  LR RIS +L+V  +L++    +  + +N+  +G + +  +   
Sbjct: 195 ILELLPRDEIDALLSSLLRARISRRLIVEEHLSISANYLSGKKENTLVLGDIFQECQALD 254

Query: 235 -ISELIHRVEEFVGDLCFVKYDRQVPVKILYG-ADVTFPCIPTDLEYVLTEILKNSSRAH 292
              E     E+FV  + F   D  +P  I+ G  D+TF  +PT L+Y+L EIL+N   A 
Sbjct: 255 YFMEASRTCEKFVKAMYFD--DIPIPELIIEGQKDLTFYFLPTHLQYILGEILRNIYEAT 312

Query: 293 IENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDT 352
           I++  ++     +PI +TIV++D     R  D  GGI    ED    +S+   +    ++
Sbjct: 313 IKDYIRKGLAKPEPIVITIVKNDSSFIFRFSDKAGGILHHEEDI---WSFGKSKERAAES 369

Query: 353 GMSAYVIPGEEV----------------------------NNVSGMG----------FGL 374
             + + +PG +                              ++  MG          F +
Sbjct: 370 LNNFHKLPGLQTVSLYDHLYNGEEHDMNTRTLMANRPYMHTSLEAMGHSNLKKGPYKFEM 429

Query: 375 P------------------MCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
           P                  MCK Y E ++G L + ++ G GTD  + L
Sbjct: 430 PLIEMLERAPRYKLGIGLAMCKIYAEYWNGDLSLTTIPGHGTDTVLTL 477

>Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement
          Length = 530

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 121/289 (41%), Gaps = 68/289 (23%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQ----QDKNSPAIGVLHKNL---- 233
           +++ Y+QE + E ++  LR RIS +L+V  +L++       + +N+  +G + +      
Sbjct: 229 ILDLYKQEQMDELISTLLRARISRRLIVEEHLSITSNFASGKKENTLVLGDIFQECCARD 288

Query: 234 KISELIHRVEEFVGDLCFVKYDRQVPVKILYG-ADVTFPCIPTDLEYVLTEILKNSSRAH 292
            + E     E F+ D+ F      +P  ++ G  D+ F  +P+ L+Y+L E L+NS  A 
Sbjct: 289 YLLEASQMCEAFIKDMFFDGI--PLPKFVIDGDTDLKFYFLPSHLKYLLGETLRNSYEAT 346

Query: 293 IENSTKERDLTEKPIEVTIVRSDCDLEIRIRD--------------FGGG---------- 328
           ++   +       PI VTI+ ++     RI D              FG            
Sbjct: 347 VKEYIRLGLDNPHPITVTIISNNHSFLFRISDRGGGIPHDDKTIWSFGKSKKLAKESLDN 406

Query: 329 ---IPPEVEDRMFEYSYSTV-------QANTKDTGMSAY----VIPGEEVNNVSGM---- 370
              +P      +++Y Y  +       +  +KD     Y    + P  + N   G+    
Sbjct: 407 FHKLPGLQTVSLYDYMYQGIHDGKISQRITSKDDLNQPYRYTSLEPMSDTNLHKGLYKLE 466

Query: 371 ---------------GFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
                          G GL +CK Y E ++G L + S++G+GTD  +KL
Sbjct: 467 KPLLGLLERSSRYKLGIGLAVCKVYAEYWNGDLTVHSIHGYGTDTVLKL 515

>YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with
           similarity to human branched-chain alpha-ketoacid
           dehydrogenase kinase, transcription is induced by the
           drug FK506 in a GCN4-dependent manner [1476 bp, 491 aa]
          Length = 491

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 97/189 (51%), Gaps = 14/189 (7%)

Query: 182 VMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQ----QDKNSPAIGVLHKNLKISE 237
           +++ Y +E + + L+  LR RIS +L+V  ++         +++N+  +G + +     +
Sbjct: 192 ILDLYPREKMDQLLSDLLRARISRRLIVEEHVVYTANYTSGKEENTLVLGDIFQECSAKK 251

Query: 238 LIHRVEE----FVGDLCFVKYDRQVPVKILYG-ADVTFPCIPTDLEYVLTEILKNSSRAH 292
            +    E    F+ D+ F   D  +P  I+ G   ++F  +PT L+Y+L EIL+N+  A 
Sbjct: 252 YLLEASEESQKFIQDMYFK--DIPMPEFIIEGDTQLSFYFLPTHLKYLLGEILRNTYEAT 309

Query: 293 IENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDT 352
           +++  ++     +PI VT+V +D     RI D  GG+  + E+    +S+   +   +++
Sbjct: 310 MKHYIRKGLEKPEPIIVTVVSNDESYLFRISDKAGGVLHDDENL---WSFGKSKERAQES 366

Query: 353 GMSAYVIPG 361
             + + +PG
Sbjct: 367 LNNFHKLPG 375

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 370 MGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404
           +G GL MCK Y E ++G L + S+ G+GTDV +KL
Sbjct: 442 LGIGLAMCKVYAEYWNGDLSLHSMPGYGTDVVLKL 476

>Scas_698.14
          Length = 1183

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 318 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 377
           + I ++D G GI P ++  +FE      Q  ++  G               G G GL +C
Sbjct: 839 IAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 883

Query: 378 KAYLEMFDGSLDIQSLYGWGT 398
           +    M +G+++++S  G G+
Sbjct: 884 RQLANMMNGTMELKSEVGVGS 904

>KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1
           Kluyveromyces lactis SLN1 homologue, start by similarity
          Length = 1155

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 318 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 377
           + + + D G GI P +++ +FE      Q  ++  G               G G GL +C
Sbjct: 849 ISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 893

Query: 378 KAYLEMFDGSLDIQSLYGWGT 398
           +   +M  G++ + S  G G+
Sbjct: 894 RQLAKMMKGTMKLDSKVGVGS 914

>CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces
           cerevisiae YIL147c SLN1, hypothetical start
          Length = 1169

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 15/79 (18%)

Query: 320 IRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKA 379
           I + D G GI P++ + +FE      Q  ++  G               G G GL +C+ 
Sbjct: 806 IEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYG---------------GTGLGLSICRQ 850

Query: 380 YLEMFDGSLDIQSLYGWGT 398
              M  G++ ++S  G G+
Sbjct: 851 LATMMHGTMKLESKVGVGS 869

>AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH]
           complement(947124..950435) [3312 bp, 1103 aa]
          Length = 1103

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 22/95 (23%)

Query: 304 EKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEE 363
           EKP    IV       I ++D G GI P + + +F+      Q  ++  G          
Sbjct: 794 EKPRSWVIV-------IEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYG---------- 836

Query: 364 VNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGT 398
                G G GL +C+    M  G++ ++S  G G+
Sbjct: 837 -----GTGLGLSICRQLATMMKGTMKLESKVGSGS 866

>YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-component
           signal transducer involved in the osmotic stress signal
           transduction pathway that initiates a phosphorelay from
           Sln1p to Ypd1p to the response regulators Ssk1p and
           Skn7p [3663 bp, 1220 aa]
          Length = 1220

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 318 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 377
           + I + D G GI P +++ +F       Q  ++  G               G G GL +C
Sbjct: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897

Query: 378 KAYLEMFDGSLDIQSLYGWGT 398
           +    M  G++ ++S  G G+
Sbjct: 898 RQLANMMHGTMKLESKVGVGS 918

>Kwal_55.19707
          Length = 1143

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 33/81 (40%), Gaps = 15/81 (18%)

Query: 318 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 377
           + + + D G GI P + + +FE      Q  ++  G               G G GL +C
Sbjct: 825 ISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 869

Query: 378 KAYLEMFDGSLDIQSLYGWGT 398
           +    M  G++ + S  G G+
Sbjct: 870 RQLATMMHGTMKLDSQVGVGS 890

>Scas_671.16
          Length = 723

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 27/136 (19%)

Query: 164 FLDDHQDTLITLSRGFEE--VMEFYQQEAVFEFLNQHLRDRISMKL---LVTHYLALVQQ 218
           ++D H      L+  +E   +ME+ +   + +F+N  L++R++ K    +++  +  V  
Sbjct: 88  YIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSA 147

Query: 219 QDKNSPAIGVLHKNLKISE-LIHRVEEF----VGDLCFVKYDRQVPVKILYGADVTFPCI 273
                PA+  +H+++KI   LI    EF     G +C   Y R              P  
Sbjct: 148 MHALQPAL--IHRDIKIENVLISAKGEFKICDFGSVC--SYIRP-------------PRN 190

Query: 274 PTDLEYVLTEILKNSS 289
           P +L YV  ++LKN++
Sbjct: 191 PQELAYVQHDVLKNTT 206

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
           Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 208 LVTHYLALVQQQDKNSPAIGVLHKNL 233
           L+T  L++    DKN+PAI V HK L
Sbjct: 229 LITKILSMTYFHDKNTPAIDVFHKYL 254

>Sklu_2253.4 YPR160W, Contig c2253 5679-8426 reverse complement
          Length = 915

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 27/175 (15%)

Query: 18  VPRLRFSTTASLTIKHSSHHNRRNERLLSGL-GFEQLYQIRSSIELLIQDYANKPIPAIS 76
           +PR + ST+AS  +     HN +  RL   L GF  L Q   SI+ +I      P+ A S
Sbjct: 4   IPRPQLSTSASNDLITEEPHNSQVPRLARRLTGF--LPQEIKSIDTMI------PLEARS 55

Query: 77  -YEYLSMYKPPLTD--NEKYVLVIKTVNLLLAYTCRRLAAIQKLSXYIA---VVNPN--- 127
            ++  ++ K   +D   EK++  ++T      Y C  LAA +  S  +    +++ N   
Sbjct: 56  LWKKHAVKKFGNSDEFQEKFIAHVETTLARSLYNCDDLAAYEATSQTVRDNLIIDWNKTQ 115

Query: 128 ----VEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRG 178
                 +  R+Y  +LE L+       L + +  V+      +D  DT  TL++G
Sbjct: 116 QRQTARDPKRVYYLSLEFLMGRALDNALINMQTDVSP-----EDVNDTKETLTKG 165

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,983,910
Number of extensions: 564378
Number of successful extensions: 1683
Number of sequences better than 10.0: 40
Number of HSP's gapped: 1675
Number of HSP's successfully gapped: 47
Length of query: 413
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 309
Effective length of database: 12,995,837
Effective search space: 4015713633
Effective search space used: 4015713633
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)