Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2168.347947919530.0
Kwal_26.81704935009151e-118
ABR052W5095137931e-100
Scas_709.544704917556e-95
CAGL0M07678g4735116075e-73
KLLA0D11220g4775106051e-72
YMR014W (BUD22)5195285215e-60
Scas_592.1280051665.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2168.3
         (479 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           756   0.0  
Kwal_26.8170                                                          357   e-118
ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...   310   e-100
Scas_709.54                                                           295   6e-95
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...   238   5e-73
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   237   1e-72
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...   205   5e-60
Scas_592.12                                                            30   5.5  

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/479 (79%), Positives = 383/479 (79%)

Query: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATLDS 60
           MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHA              DATLDS
Sbjct: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATLDS 60

Query: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK 120
           VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK
Sbjct: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK 120

Query: 121 SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV 180
           SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV
Sbjct: 121 SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV 180

Query: 181 WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKSSN 240
           WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKSSN
Sbjct: 181 WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKSSN 240

Query: 241 ALXXXXXXXXXXXGVSDREDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQQGYHLDPN 300
           AL           GVSDREDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQQGYHLDPN
Sbjct: 241 ALDDDSGEDFTDDGVSDREDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQQGYHLDPN 300

Query: 301 VDYNEVTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMAGYFSGGSDDEIEDDRIA 360
           VDYNEVTD                                LMAGYFSGGSDDEIEDDRIA
Sbjct: 301 VDYNEVTDEEPTDNESELEEEEKLEEPPKKKQKNKAQLPELMAGYFSGGSDDEIEDDRIA 360

Query: 361 KEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQHEKDXXXXXXXXXXXXXXXAKRA 420
           KEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQHEKD               AKRA
Sbjct: 361 KEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQHEKDKEEREKRQVEYEERVAKRA 420

Query: 421 ANSVXXXXXXXXXXXXXXXXXXXXXXXXNDPIHPSWQAKKQAEERLKNVKFQGKKVTFD 479
           ANSV                        NDPIHPSWQAKKQAEERLKNVKFQGKKVTFD
Sbjct: 421 ANSVRLAEEAREKAQRLEERKRQQEEKRNDPIHPSWQAKKQAEERLKNVKFQGKKVTFD 479

>Kwal_26.8170
          Length = 493

 Score =  357 bits (915), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/500 (41%), Positives = 274/500 (54%), Gaps = 29/500 (5%)

Query: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATLDS 60
           MPKENLIFKLDNLEYQYH+LNN+LD F+PRLS T K F+A              ++ L  
Sbjct: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60

Query: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK 120
           VS+ LD LR+  +EKK YHL+ +L S LEK LQQQY +L K + +K  D+  LK L  ++
Sbjct: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDR--LKTLATLE 118

Query: 121 SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV 180
             +T   FS+LIAK +  +L++ K+  TK L+E+PPQW + ++ + ++ DK +  NP  V
Sbjct: 119 KSYTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKV 178

Query: 181 WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKL-QNKKVEANKKSS 239
           WN+V++  EGCE+LLS+ MN KK KEL+  FD  MD+F+   +E++  QN   E +K S 
Sbjct: 179 WNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSR 238

Query: 240 NALXXXXXXXXXXXG-------VSDREDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQ 292
                         G        S+ ED    +  DE+ +++QY+GML  SDEE   ++ 
Sbjct: 239 AVPETDERSSEDENGDNDFASSSSEGEDADGSALIDEDEILKQYEGMLVASDEE--GEDL 296

Query: 293 QGYHLDPNVDYNEVTDXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXX 338
               L+P+++YNEVTD                                            
Sbjct: 297 TMPSLNPDINYNEVTDEEPSESENDSDISLSDGEEDVPPLKKQKRSQEREDDQSKVKTNL 356

Query: 339 XXLMAGYFSGGSDDEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQH 398
             LM GY+SGGSDDEI +D +A +Q SNEPKRKNRRGQRARQKIWEKKYG NAKHVQRQ 
Sbjct: 357 PELMTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQV 416

Query: 399 EKDXXXXXXXXXXXXXXXAKRAANSVXXXXXXXXXXXXXXXXXXXXXXXXNDPIHPSWQA 458
           E +               A+ A  +                         + PIHPSW+A
Sbjct: 417 EAE---KSERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAKDAPIHPSWEA 473

Query: 459 KKQAEERLKNVKFQGKKVTF 478
           KK AEE+ K  KFQGKK+ F
Sbjct: 474 KKMAEEKQKGAKFQGKKIVF 493

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score =  310 bits (793), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/513 (36%), Positives = 257/513 (50%), Gaps = 38/513 (7%)

Query: 1   MP--KENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATL 58
           MP  K NL++KLD+ EYQYH LNNT+ +F PRL +T K ++                 T 
Sbjct: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60

Query: 59  DSVSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALED 118
           D + QQ+  L+   L+ KV+H++ +L   L K L+ Q   L K  ++ E     L+ LE 
Sbjct: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120

Query: 119 IKSDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPS 178
           ++    F +F +LI +SK+V++V+ KI PTK LK +PP WF++  IL  + +KEDECNP 
Sbjct: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180

Query: 179 NVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKS 238
            VW +VV  + G E+L+S ++++K  ++L+ + +  +D+ LG  +E++ QN    A K +
Sbjct: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERR-QNSDA-AEKTA 238

Query: 239 SNALXXXXXXXXXXXGVSDREDD----------------AEFSTADEEALVQQYKGMLAG 282
             A              +  + D                A   + DE+ALV QY GMLA 
Sbjct: 239 VAARSAEGEDDSSSSDNAASDIDEGAASESEEENSDDEAARSPSVDEDALVSQYAGMLAA 298

Query: 283 SDEEDDADEQQGYHLDPNVDYNEVTDXXXXXXXXXXXXXXXXXX----------XXXXXX 332
           SDEED  D+  GYHLDPNVDYNEVTD                                  
Sbjct: 299 SDEED--DDPDGYHLDPNVDYNEVTDEEPDQSADETIQPDADDSSDSDSSAPPLKKQKTS 356

Query: 333 XXXXXXXXLMAGYFSGGSDDEIED-DRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNA 391
                   LMAGY+SG  D + E+ D   K +    PKRKNRRGQRARQKIWEKKYG+NA
Sbjct: 357 KTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNA 416

Query: 392 KHVQRQHEKDXXXXXXXXXXXXXXXAKRAANSVXXXXXX-----XXXXXXXXXXXXXXXX 446
           KH+Q+Q EK+               AKR A                              
Sbjct: 417 KHIQQQFEKEREERARKQREYEERAAKRPAKEAELARTRPAFKDSAIRAAEPGAAKSAAK 476

Query: 447 XXNDPIHPSWQAKKQAEERLKNVKFQGKKVTFD 479
                +HPSW+AKK ++E+ K  KFQGKK+ FD
Sbjct: 477 PVAQELHPSWEAKKLSQEKQKAAKFQGKKIVFD 509

>Scas_709.54
          Length = 470

 Score =  295 bits (755), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 195/491 (39%), Positives = 268/491 (54%), Gaps = 33/491 (6%)

Query: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATLDS 60
           MPK+NL+FKLDNLEYQ HYLNNTLD F+PRL+ T K ++A              +  ++ 
Sbjct: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60

Query: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK 120
           V +QL++++    +KK++H +  L   L K L+ +   L K  ++          LE IK
Sbjct: 61  VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDKT--------TLEAIK 112

Query: 121 SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV 180
           + +   +F++L+  SK ++L   KI P     E+ PQWF   +   +Y+DK +E NPS +
Sbjct: 113 NQYGIPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRI 172

Query: 181 WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKSS- 239
           WN+V+MKI+  + L+S++MN KK K++I SF+ GMDVFLGIN+ KKLQ +K   NK SS 
Sbjct: 173 WNEVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSS 232

Query: 240 -NALXXXXXXXXXXXGVSD-----REDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQQ 293
            N +            +++     RE   E    DE+ ++ QY+GMLA SD+E + +E  
Sbjct: 233 NNEVEMQEDDASEDDELTERPALRRETRDEDQEIDEDEILNQYEGMLAASDDE-EGEEAS 291

Query: 294 GYHLDPNVDYNEVTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMAGYFSGG--SD 351
           G  LD  ++YNEVTD                                LM GY+SGG  SD
Sbjct: 292 G--LDKTINYNEVTD---------EEPSDDEDSESEEPSRKKPKLPELMGGYYSGGESSD 340

Query: 352 DEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQHEKDXXXXXXXXXX 411
           DE E D+IA+EQ+SN+P+RKNRRGQRAR+KIWEKKYG  AKHVQR+ EK+          
Sbjct: 341 DEKE-DKIAREQMSNKPQRKNRRGQRARRKIWEKKYGSQAKHVQREVEKEFEERKQRQIA 399

Query: 412 XXXXXAKRAANSVXXXXXXXXXXXXXXXXXXXXX-XXXNDPI--HPSWQAKKQAEERLKN 468
                AKRAA                             +P   HPSW AK+ AEE+ KN
Sbjct: 400 YEERAAKRAAKEEAFQKMVREHELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEKN 459

Query: 469 VKFQGKKVTFD 479
            KF GKKV FD
Sbjct: 460 AKFSGKKVVFD 470

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score =  238 bits (607), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 163/511 (31%), Positives = 243/511 (47%), Gaps = 70/511 (13%)

Query: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATLDS 60
           M KENL+ KLD LEYQ+HYL  T + F+PR   T + F+A               +  + 
Sbjct: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKNNKKVTKILESSDKEK 60

Query: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLK-ALEDI 119
           V   L ++R   L +K+++++K + +YL K ++              NDK   +  LE +
Sbjct: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVS----------NDKSVFQPVLEAV 110

Query: 120 KS-----DFTFTKFSQLIAKSKIVRLVISKITPT---------KTLKENPPQWFESSDIL 165
           ++     D     F +++ KSK ++ +ISK+  +         +   +  P+W    + +
Sbjct: 111 EAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYV 170

Query: 166 HVYRDKEDECNPSNVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREK 225
            ++ DK ++ NPS VWN+ V KI+ C+ L+S +MN KKYK+++D FD  +D+FL IN++K
Sbjct: 171 KMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINKQK 230

Query: 226 KLQNKKVEANKKSSNALXXXXXXXXXXX---GVSDREDDAEFSTADEEALVQQYKGMLAG 282
           +LQ ++ +     +++               G SD +D       DE+ L++QY GML G
Sbjct: 231 RLQKQQEKKKSTKTSSKQHEEENEDASGDDFGYSDNDDPRYNENIDEDELLKQYDGMLVG 290

Query: 283 --------------SDEEDDADEQQGYHLDPNVDYNEVTDXXXXXXXXXXXXXXXXXXXX 328
                         S  ED+  E+ G   +P                             
Sbjct: 291 SDDESDEEEDSAKSSASEDETSERIGKQ-EP---------------------------VP 322

Query: 329 XXXXXXXXXXXXLMAGYFSGGSDDEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYG 388
                       LM GY SGGSD+EIE D IAKEQ+  +P++KNRRGQRAR+KIWE+KYG
Sbjct: 323 KLKKKEKAKLPELMVGYVSGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYG 382

Query: 389 KNAKHVQRQHEKDXXXXXXXXXXXXXXXAKRAANSVXXXXXXXXXXXXXXXXXXXXXXXX 448
             AKHVQR+ EK+               AKRAA +                         
Sbjct: 383 SKAKHVQREIEKEMEKKRKRQAEYEERVAKRAARAEQNEEYQAKKAEIKREKEEHRKKLE 442

Query: 449 NDPIHPSWQAKKQAEERLKNVKFQGKKVTFD 479
               HPSW AKK AE++ KN KF GKK+TFD
Sbjct: 443 KIEDHPSWVAKKMAEDKEKNAKFAGKKITFD 473

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  237 bits (605), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 162/510 (31%), Positives = 237/510 (46%), Gaps = 66/510 (12%)

Query: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATLDS 60
           M K+NLIFKLDNLEYQ HY+NN  + F+PR   T + F++               A    
Sbjct: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60

Query: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEK--ALQQQYDALPKKAEQKENDKKNLKALED 118
           ++ ++  LR   L++K++H+ +RL+++  K   + ++ +     AEQ             
Sbjct: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQ------------- 107

Query: 119 IKSDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPS 178
                    F + ++ SK+V+L +S +   KT     P+WF   +   +  DK +E NPS
Sbjct: 108 ---------FIKYMSYSKLVKLTMSLMGGNKTC----PEWFREHEFYQISNDKTNELNPS 154

Query: 179 NVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKS 238
            ++N V  K      L+S ++N+K  K+LI +++ G+ V L  N + K+Q     A+ K 
Sbjct: 155 RIYNGVFSK-NKLNSLVSKLLNNKNVKDLIQTYENGIHVIL--NEKDKIQKDTTTASTKQ 211

Query: 239 SNALXXXXXXXXXXXGVSDREDDA-------------------EFSTADEEALVQQYKGM 279
           S              GVS  E  A                   E  +  EE L +QY G+
Sbjct: 212 SKTKSEDTSTDKNIDGVSKTEKGATESESESDLLEENSEREAPELDSETEELLSKQYDGL 271

Query: 280 LAGSDEEDDADEQQGYHLDPNVDYNEVTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- 338
           L GSDEE + +    + LDP +DYN+VTD                               
Sbjct: 272 LVGSDEESEPE----FQLDPTIDYNQVTDEEDKEEYSADEDDEENSDSDSGEPSNKKPKY 327

Query: 339 --XXLMAGYFSGGSDDEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQR 396
               LM GY SG  ++++ DD++A++Q++  P +KNRRGQRARQKIWEKKYG  AKHVQR
Sbjct: 328 NLPELMNGYISGDEEEDL-DDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQR 386

Query: 397 QHEKDXXXXXXXXXXXXXXXAKRAANSVXXXXXXXXXXXXXXXXXXXXX--------XXX 448
           Q EK+               AKR A +                                 
Sbjct: 387 QLEKEHKERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSSTSNIPPPPQPVITA 446

Query: 449 NDPIHPSWQAKKQAEERLKNVKFQGKKVTF 478
           + PIHPSW+AK+ AEE+ KNVKFQGKK+TF
Sbjct: 447 DKPIHPSWEAKRIAEEKQKNVKFQGKKITF 476

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score =  205 bits (521), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 155/528 (29%), Positives = 242/528 (45%), Gaps = 58/528 (10%)

Query: 1   MPKENL--IFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAXXXXXXXXXXXXXXDATL 58
           MP E+   I+KLD LEYQYHYL  +L  F+PR   T KL++                  L
Sbjct: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLEL 60

Query: 59  DSVSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKEND-KKNLKALE 117
            ++ ++LD+     L  K+++     E++L K +++Q   + KK   K  D +KN     
Sbjct: 61  KTLDKELDESYSKLLNNKIHYY----ETHLSKCIKEQIQKISKKNSSKVKDAQKNKSPSI 116

Query: 118 DIK----SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKE---NPPQWFESSDILHVYRD 170
           DI+    +  +    +  + + ++++++  +I       E   N   W  ++D      D
Sbjct: 117 DIEKMLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYIND 176

Query: 171 KEDECNPSNVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNK 230
           K  + NPSN+WN+V+ K+  CEKL +++  SK  + L +SFD  + +  G +    ++ K
Sbjct: 177 KTSKWNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVS-AMKAK 235

Query: 231 KVEANKKSSNALXXXXXXXXXXXGVSDR--------------EDDAEFSTADEEALVQQY 276
           K  A +K++NA              +++              + + E ++ +E+ L+++Y
Sbjct: 236 KYGAREKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEY 295

Query: 277 KGMLAGSDEEDDADEQQGYHLDPNVDYNEVTDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 336
           +GML  S      + + G +L+PN++YNEVTD                            
Sbjct: 296 EGMLGSS----GDEGEGGGYLNPNINYNEVTDEEPSEASSDEDDSDERFSDSEENEPRRK 351

Query: 337 XXX-----XLMAGYFSGGSDDEIED-----------------DRIAKEQLSNEPKRKNRR 374
                    LMAGY+SG   +E  D                 DR A+EQ+SNEPKRKNRR
Sbjct: 352 KPKLHNLPELMAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQMSNEPKRKNRR 411

Query: 375 GQRARQKIWEKKYGKNAKHVQRQHEKDXXXXXXXXXXXXXXXAKRAANSVXXXXXXXXXX 434
           GQRAR+KIWEKKYG  AKHVQR+ EK+               AKR A +           
Sbjct: 412 GQRARRKIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYEARVAKREAKAASLEASRSRER 471

Query: 435 XXXXXXXXXXXXXXNDPI---HPSWQAKKQAEERLKNVKFQGKKVTFD 479
                         +      HPSW AK+ AEE+L+  KF+GKK+ FD
Sbjct: 472 EDRRTETNNKKEKESASTGEEHPSWIAKRLAEEKLQKAKFEGKKIKFD 519

>Scas_592.12
          Length = 800

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 255 VSDREDDAEFSTADEEALVQ--QYKGMLAGSDEEDDADEQQGYHLDPNVDY 303
           V+D EDD+E S    E + +  ++ G+ A  ++ED    ++G++  P V Y
Sbjct: 680 VADNEDDSEDSNTTTEKITKKVRFVGVPAFQEDEDPIPTRKGWYKKPPVLY 730

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,573,966
Number of extensions: 537037
Number of successful extensions: 2745
Number of sequences better than 10.0: 57
Number of HSP's gapped: 2713
Number of HSP's successfully gapped: 67
Length of query: 479
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 374
Effective length of database: 12,961,219
Effective search space: 4847495906
Effective search space used: 4847495906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)