Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2168.250050022450.0
Kwal_26.816450050012451e-168
Scas_709.555195119061e-116
ABR051C4845018281e-105
KLLA0D11198g5155028161e-103
CAGL0M07700g4873796211e-74
YMR013C (SEC59)5193576204e-74
CAGL0I02222g151287657.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2168.2
         (500 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        869   0.0  
Kwal_26.8164                                                          484   e-168
Scas_709.55                                                           353   e-116
ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   323   e-105
KLLA0D11198g complement(954239..955786) some similarities with s...   318   e-103
CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   243   1e-74
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   243   4e-74
CAGL0I02222g complement(190099..194637) similar to sp|P38859 Sac...    30   7.4  

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/500 (87%), Positives = 439/500 (87%)

Query: 1   MSKQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQS 60
           MSKQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQS
Sbjct: 1   MSKQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQS 60

Query: 61  ALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIXXXXXXXXXXXXXARRL 120
           ALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVI             ARRL
Sbjct: 61  ALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIYLLYLPFMLSLLFARRL 120

Query: 121 VLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDL 180
           VLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDL
Sbjct: 121 VLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDL 180

Query: 181 KSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYL 240
           KSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYL
Sbjct: 181 KSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYL 240

Query: 241 RXXXXXXXXXXXXPLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNV 300
           R            PLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNV
Sbjct: 241 RSLILFSSFSLIFPLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNV 300

Query: 301 MIFKSNFSLNTSRKIWHXXXXXXXXXXXQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPV 360
           MIFKSNFSLNTSRKIWH           QLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPV
Sbjct: 301 MIFKSNFSLNTSRKIWHFLILFLLIPPLQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPV 360

Query: 361 GKFLDEKLRSFSDFRDDRGPXXXXXXXXXXGVSAPILINXXXXXXXXXXXXXXXASIVGG 420
           GKFLDEKLRSFSDFRDDRGP          GVSAPILIN               ASIVGG
Sbjct: 361 GKFLDEKLRSFSDFRDDRGPIIISYIYLIIGVSAPILINGSLVGVISLGVGDSLASIVGG 420

Query: 421 KWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGNS 480
           KWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGNS
Sbjct: 421 KWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGNS 480

Query: 481 VLNDNILIPPFMLIFSEICK 500
           VLNDNILIPPFMLIFSEICK
Sbjct: 481 VLNDNILIPPFMLIFSEICK 500

>Kwal_26.8164
          Length = 500

 Score =  484 bits (1245), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 251/500 (50%), Positives = 333/500 (66%)

Query: 1   MSKQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQS 60
           MSKQ  EER AI +EN+++S  D     E++AQL++LG T+HL V K M  E DS LFQ+
Sbjct: 1   MSKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQA 60

Query: 61  ALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIXXXXXXXXXXXXXARRL 120
           AL +AVA VVG  V+YRT++ NNG WG ++ R+S F+PDFNV+             AR L
Sbjct: 61  ALAAAVAVVVGLGVSYRTKIANNGEWGTDLQRISGFVPDFNVLYLLYIPSLLSLLFARDL 120

Query: 121 VLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDL 180
            +VN A+AFN TD P+ L+LPLQ +FVL+N ++   RS N+KAI IN  + +++E+I  L
Sbjct: 121 TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL 180

Query: 181 KSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYL 240
           KS D V+ NLFSI LTNVLYL++S ++HFQ+L+ VL GF+ AV+ N+ L       + YL
Sbjct: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAVAFNFPLLIITSRFNPYL 240

Query: 241 RXXXXXXXXXXXXPLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNV 300
           R            PLT+     ++ + P  WL++YI S+D R++II  WL CL++L+PN+
Sbjct: 241 RSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNI 300

Query: 301 MIFKSNFSLNTSRKIWHXXXXXXXXXXXQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPV 360
           MIFKSNFSLNTSRKIWH           + DP+FVK+SL+GT+VLFL VEYLR+LKL P 
Sbjct: 301 MIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPY 360

Query: 361 GKFLDEKLRSFSDFRDDRGPXXXXXXXXXXGVSAPILINXXXXXXXXXXXXXXXASIVGG 420
           G+ LD KLRSF+DFRD+RGP          GV+ PILIN               ASIVG 
Sbjct: 361 GELLDSKLRSFADFRDERGPIIISYIYLIIGVATPILINGSLVGVISLGVGDSLASIVGY 420

Query: 421 KWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGNS 480
           +WGR +WPGT+KT+EGT  FIL+TS  SL  +    +F  I++  V+L CI+SGILEGNS
Sbjct: 421 RWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNS 480

Query: 481 VLNDNILIPPFMLIFSEICK 500
           VLNDNILIP +M + +E+ K
Sbjct: 481 VLNDNILIPAYMFVVTELLK 500

>Scas_709.55
          Length = 519

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/511 (39%), Positives = 294/511 (57%), Gaps = 27/511 (5%)

Query: 1   MSKQSEEERNAILEENKDYSFADGFF------ATERIAQLVILGVTIHLCVDKYMN-DEN 53
           MS+  EEE+    E + D    D +         E++ Q+ IL  ++ LC  +Y   D++
Sbjct: 20  MSQIQEEEKKR-KEVDTDPVLNDRWLEDIFSSVPEKLIQIFILASSVFLCYKQYGAVDDD 78

Query: 54  DSLLFQSALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIXXXXXXXXXX 113
           D  +F++      A V G L+++  R  N+        R +  LP F ++          
Sbjct: 79  DFSIFKNE-----ARVAGMLLSFLLRKCND--------RDANTLPQFEIVYLLFLPFMTS 125

Query: 114 XXXARRLVLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYV 173
               + L + NS +A N+ DIP++ K+P+Q +F+  + E   +       + +N ++C  
Sbjct: 126 FLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNFSICQT 185

Query: 174 LEKISDLKSLDHVDCNLFSILLTNVLYLIDS--PTVHFQILQKVLYGFIVAVSVNYALSF 231
           L KI  LKSLD +DCNLFSI+LTNVLY+ID   P++ FQIL+  L  F V V++NY +S 
Sbjct: 186 LMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAINYIISS 245

Query: 232 PLRY--ASTYLRXXXXXXXXXXXXPLTVTRILTIDR--KKPLTWLYEYIFSSDTRIKIIF 287
            L     + +++            P+ + +++ ++   ++P  WL +Y+  S  R  I+ 
Sbjct: 246 LLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSARKSILL 305

Query: 288 IWLLCLLVLIPNVMIFKSNFSLNTSRKIWHXXXXXXXXXXXQLDPEFVKVSLSGTVVLFL 347
           +WL  LL+LIPNV+IFKSNFSLNTSRKIWH           Q+DP FVK++LSGT+VLFL
Sbjct: 306 VWLSFLLILIPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGTIVLFL 365

Query: 348 VVEYLRYLKLEPVGKFLDEKLRSFSDFRDDRGPXXXXXXXXXXGVSAPILINXXXXXXXX 407
            VEYLR+L+LEP G ++D KLRSF+DFRDD+GP          G+S P+LIN        
Sbjct: 366 SVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPIIISYIYLIIGISTPLLINDSPVGLIS 425

Query: 408 XXXXXXXASIVGGKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVV 467
                  ASI+GGKWGR  WPGT KT+EGTL FI+ TS V+   ++    F+ I+  N++
Sbjct: 426 LGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADITFSNLL 485

Query: 468 LTCIVSGILEGNSVLNDNILIPPFMLIFSEI 498
             C +SGILEGNS LNDNILIP +M+I  ++
Sbjct: 486 WVCTISGILEGNSELNDNILIPTYMMILEKL 516

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  323 bits (828), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/501 (38%), Positives = 260/501 (51%), Gaps = 26/501 (5%)

Query: 3   KQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQSAL 62
           K +  E+    EE  D           +  Q V+L VT+HL  + +  DE     F SAL
Sbjct: 5   KTANAEQAVKAEEQADTGAVP---LGGKAVQAVVLAVTVHLAAEVFGKDEAGRAAFYSAL 61

Query: 63  TSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIXXXXXXXXXXXXXARRLVL 122
            S  A    +    R                   +P FN +              R LV 
Sbjct: 62  -SVAAAYGAAAAAGR-------------------VPAFNAVYVVYLPVMVSLLFRRELVP 101

Query: 123 VNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEK-ISDLK 181
           VN AMA     +PV L++  QL  + +              +           +  S+L+
Sbjct: 102 VNCAMALGGMQMPVVLRVLQQLTILYLQPAARGRGFPGRGGVGGAPGGVVGRWRGWSELR 161

Query: 182 SLDHVDCNLFSILLTNVLYLIDS-PTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYL 240
           SLD VDC L SILLTNVL++I    +V FQIL+  LYGF+VAV  NY         + Y+
Sbjct: 162 SLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRNQYV 221

Query: 241 RXXXXXXXXXXXXPLTVTRILTID-RKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPN 299
           R            P  +   L +D     L WL +YIFSS  R++I+  WL+ L VLIP+
Sbjct: 222 RTAVLLAVFALVFPSVILAFLDLDDTDNALVWLIKYIFSSALRMQIMAGWLVFLGVLIPS 281

Query: 300 VMIFKSNFSLNTSRKIWHXXXXXXXXXXXQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEP 359
           V + KS+ SLNTSRKIWH            ++PEF  V+++GTVV+FL+VEY RY+ L P
Sbjct: 282 VFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLYP 341

Query: 360 VGKFLDEKLRSFSDFRDDRGPXXXXXXXXXXGVSAPILINXXXXXXXXXXXXXXXASIVG 419
            G +++ +LR+F+DFRD++GP          GVS P+LIN               ASI+G
Sbjct: 342 FGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDSLASIIG 401

Query: 420 GKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGN 479
            ++G+  WPGTNKTVEGTL FI+A++A+ L CQ  + +F  ++  N++L C+VSGILEGN
Sbjct: 402 RRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEGVATRNIILACVVSGILEGN 461

Query: 480 SVLNDNILIPPFMLIFSEICK 500
           S LNDNILIP FMLIF E+CK
Sbjct: 462 SDLNDNILIPSFMLIFMELCK 482

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  318 bits (816), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/502 (37%), Positives = 281/502 (55%), Gaps = 20/502 (3%)

Query: 2   SKQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQSA 61
             +    R++I+ E       D  F  +R+ QL ILG++ HL   KY ++   S  F   
Sbjct: 30  GSKGNLSRDSIISE-----VLDKVFEADRVIQLTILGLSSHLVYAKYGSEPWFSQQFSMV 84

Query: 62  LTSAVAFVVGSLVNY-RTRMVNNGAWGDNVHRLSEFLPDFNVIXXXXXXXXXXXXXARRL 120
            +  +A+VV   ++  RT +      G N       LP FN I               + 
Sbjct: 85  TSVLMAYVVNLWMSATRTNL------GVNT------LPTFNTIYLFYMQLLLSTLFVPQY 132

Query: 121 VLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDL 180
           +L+N+ +AF+ +DI V  K+PLQ++F+L+ ++   + + ++KA+ +N    + L K S L
Sbjct: 133 LLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNYFFIFGLYKTSKL 192

Query: 181 KSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRY--AST 238
           KSLD  +C++F++L T++L L++S +++FQ+ Q     FIV V+V  A+S+ L    A+ 
Sbjct: 193 KSLDKTECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSAVSYGLESVGATR 252

Query: 239 YLRXXXXXXXXXXXXPLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIP 298
           ++R               +   L I+   P TWL +YI SS  R+KI+ IWL   L+L+P
Sbjct: 253 WIRTLLLLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIMGIWLGSALLLLP 312

Query: 299 NVMIFKSNFSLNTSRKIWHXXXXXXXXXXXQLDPEFVKVSLSGTVVLFLVVEYLRYLKLE 358
           +V   KSN+SLNTSRK+WH            +D  FVK++L+GTV LFL+VEY+R+L + 
Sbjct: 313 SVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIRFLHIY 372

Query: 359 PVGKFLDEKLRSFSDFRDDRGPXXXXXXXXXXGVSAPILINXXXXXXXXXXXXXXXASIV 418
           PVG +LD+ LRSF+DFRD++GP          G+S P LIN               ASI+
Sbjct: 373 PVGHYLDKHLRSFADFRDEKGPIIISYLYFIIGISLPFLINGSIIGIISLGVGDSLASII 432

Query: 419 GGKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEG 478
           G K+GR +WP T KT EGT  FI AT   ++  +  +N F+ +S  N+VL C ++GILEG
Sbjct: 433 GKKFGRNRWPNTCKTFEGTFAFIAATGITTVIMKVYFNFFTEVSFMNLVLVCFLAGILEG 492

Query: 479 NSVLNDNILIPPFMLIFSEICK 500
           NS LNDN+LIP FMLI  E  K
Sbjct: 493 NSTLNDNLLIPTFMLILLESMK 514

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  243 bits (621), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 146/379 (38%), Positives = 207/379 (54%), Gaps = 11/379 (2%)

Query: 121 VLVNSAMAFNSTDIPVHL-KLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISD 179
           +++++     S   P+HL  L  Q   + I    Y D  + +K +  N  L   LE I  
Sbjct: 105 MIMSTTAVIPSNYTPIHLVGLIFQAGLMKIGMHNY-DYISGVKCLVANYLLVNWLEDIGQ 163

Query: 180 LKSLDHVDCNLFSILLTNVLYLIDSPTV--HFQILQKVLYGFIVAVSVNYALSFPLRYAS 237
           LK+LD +DCNLF ILLT+ L +I++ T   +  +L+  +   ++ + VN+ L+   R   
Sbjct: 164 LKTLDQIDCNLFGILLTDCL-MINNATAPNYLLVLKGAMTSVMIIIVVNHFLT---RLIP 219

Query: 238 TYLRXXXXXXXXXXXXPLTVTRILTIDRKK---PLTWLYEYIFSSDTRIKIIFIWLLCLL 294
           +               P+ V  ++    +K   P  WL ++I  S+ R  I+  W++ L+
Sbjct: 220 SLSNSIVLAGNFLVLFPILVNHLIDFSNEKITSPALWLIDFILESEIRQYIMLSWVIVLV 279

Query: 295 VLIPNVMIFKSNFSLNTSRKIWHXXXXXXXXXXXQLDPEFVKVSLSGTVVLFLVVEYLRY 354
           V IP V++FKS  SLNTSRKIWH            LDPEFVK+SL G +  FL VEYLRY
Sbjct: 280 VFIPLVILFKSKISLNTSRKIWHFVIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLRY 339

Query: 355 LKLEPVGKFLDEKLRSFSDFRDDRGPXXXXXXXXXXGVSAPILINXXXXXXXXXXXXXXX 414
           LK+EP G+ LD  LRSF+D+RD RGP          G++ P+L+                
Sbjct: 340 LKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDSL 399

Query: 415 ASIVGGKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSG 474
           ASIVG K GR+ W GTNKT+EGT+ FI+ T+ +S   Q  +N FS I    +++ C   G
Sbjct: 400 ASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGG 459

Query: 475 ILEGNSVLNDNILIPPFML 493
           +LEGNS LNDNILIP FM+
Sbjct: 460 VLEGNSELNDNILIPLFMV 478

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  243 bits (620), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 207/357 (57%), Gaps = 11/357 (3%)

Query: 142 LQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDLKSLDHVDCNLFSILLTNVLYL 201
           LQL  +  N E   DR  N+ +I IN  L  +L+ I  LKSLD++D NLFSILLTN+LY+
Sbjct: 163 LQLCLIFFNFEA-GDRLKNIISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYV 221

Query: 202 IDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYLRXXXXXXXXXXXXPLTVTRIL 261
            ++ TVHF+IL+ ++      +S+NY L   + +    L             PL     +
Sbjct: 222 SEAGTVHFRILKGIILALTTIISINYVLKKVMHFKPFMLSISFAIGL-----PLFANTFI 276

Query: 262 TI-DRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNVMIFKSNFSLNTSRKIWHXXX 320
            + D + PL WL +YI  S  R KI+F W   L++ IP+++I K + SLNTSRK+WH   
Sbjct: 277 HLEDGENPLLWLVKYILESTIRQKILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFII 336

Query: 321 XXXXXXXXQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPVGKFLDEKLRSFSDFRDDRGP 380
                   Q+D  FVK++LSGT+ +FL +EY+R+  L P+G  ++ +LR F+D RD  GP
Sbjct: 337 FLLIIPSFQMDSNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGP 396

Query: 381 XXXXXXXXXXGVSAPILINXXXXXXXXXXXXXXXASIVGGKWGRIKWPGTNKTVEGTLVF 440
                     G+S P+L+N               ASI+G ++GRI+W GT KT+EGTL F
Sbjct: 397 LIISYLYLLFGISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAF 456

Query: 441 ILATSAVSLFCQHRYNS---FSPISNGNVVLTCIVSGILEGNSVLNDNILIPPFMLI 494
           I+ TS +      R++    F+ ++   ++  C +SG+LEGNSVLNDNILIP FM+I
Sbjct: 457 IV-TSFIVCLVLLRFDKAAIFNHLTTLQLLTLCTLSGVLEGNSVLNDNILIPAFMMI 512

>CAGL0I02222g complement(190099..194637) similar to sp|P38859
            Saccharomyces cerevisiae YHR164c DNA2 DNA helicase,
            hypothetical start
          Length = 1512

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 17   KDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQSALTSAVAFVVGSLVNY 76
            +DY    G   T    +  ++   IH+ V       N S+L  S   SAV  ++  L NY
Sbjct: 1057 EDYCLILGMPGT---GKTTVIAEIIHILVKN-----NKSVLLTSYTHSAVDNIMLKLKNY 1108

Query: 77   RTRMVNNGAWGDNVHRLSEFLPDFNVI 103
             T+M   G+       +  ++PD++ I
Sbjct: 1109 NTKMCRLGSRSKIHSEIIPYIPDYSTI 1135

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,885,526
Number of extensions: 521425
Number of successful extensions: 1489
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1491
Number of HSP's successfully gapped: 11
Length of query: 500
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 394
Effective length of database: 12,926,601
Effective search space: 5093080794
Effective search space used: 5093080794
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)