Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2164.51350135068260.0
Kwal_26.70551555135455450.0
ADR354W1558135152810.0
KLLA0A03905g1550135650620.0
YOR326W (MYO2)1574137248340.0
CAGL0F00671g1566136748010.0
Scas_663.261567137647260.0
YAL029C (MYO4)1471130232520.0
Scas_592.13*141997532440.0
CAGL0G06336g141894028120.0
ACR068W180578413471e-159
Scas_688.22187679013411e-158
YHR023W (MYO1)192880013341e-156
Kwal_23.55341907107613021e-152
KLLA0E11572g184878112951e-151
CAGL0J00693g188478412611e-146
KLLA0B12562g126074811621e-137
Kwal_26.7587125072611511e-135
Scas_721.119123275311441e-134
YMR109W (MYO5)121972511391e-134
CAGL0K07590g125272311201e-131
CAGL0K03487g121772411151e-130
YKL129C (MYO3)127182010981e-128
AEL306C129273410941e-127
CAGL0F01331g72394850.095
Kwal_55.22033488122741.8
Kwal_56.23638492246732.9
CAGL0F08327g99273706.5
YDR303C (RSC3)88537697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2164.5
         (1350 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          2633   0.0  
Kwal_26.7055                                                         2140   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  2038   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1954   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  1866   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  1853   0.0  
Scas_663.26                                                          1825   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1257   0.0  
Scas_592.13*                                                         1254   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1087   0.0  
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   523   e-159
Scas_688.22                                                           521   e-158
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   518   e-156
Kwal_23.5534                                                          506   e-152
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   503   e-151
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   490   e-146
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   452   e-137
Kwal_26.7587                                                          447   e-135
Scas_721.119                                                          445   e-134
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   443   e-134
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   436   e-131
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   434   e-130
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   427   e-128
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   426   e-127
CAGL0F01331g complement(136707..138878) similar to sp|P32606 Sac...    37   0.095
Kwal_55.22033                                                          33   1.8  
Kwal_56.23638                                                          33   2.9  
CAGL0F08327g complement(829426..832404) similar to sp|P07276 Sac...    32   6.5  
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    31   7.4  

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 2633 bits (6826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1288/1350 (95%), Positives = 1288/1350 (95%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60
            MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120

Query: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240
            FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE
Sbjct: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240

Query: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300
            ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG
Sbjct: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300

Query: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360
            GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS
Sbjct: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360

Query: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420
            DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF
Sbjct: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420

Query: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540
            FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540

Query: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYI 660
            LLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYI
Sbjct: 601  LLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYI 660

Query: 661  RCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEH 720
            RCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEH
Sbjct: 661  RCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEH 720

Query: 721  WSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDRLHNS 780
            WSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDRLHNS
Sbjct: 721  WSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDRLHNS 780

Query: 781  SVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMVRSTS 840
            SVLIQ            LAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMVRSTS
Sbjct: 781  SVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMVRSTS 840

Query: 841  TRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTTRRST 900
            TRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTTRRST
Sbjct: 841  TRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTTRRST 900

Query: 901  VVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKGMTAR 960
            VVVQSLVR            TEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKGMTAR
Sbjct: 901  VVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKGMTAR 960

Query: 961  IQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXXXXXXXXXXXXXX 1020
            IQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQ                
Sbjct: 961  IQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKKEVEEAKEE 1020

Query: 1021 XXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAAVRXX 1080
                   QDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAAVR  
Sbjct: 1021 IEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAAVRSG 1080

Query: 1081 XXXXXXXXXXXXXRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQINDELY 1140
                         RRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQINDELY
Sbjct: 1081 VTSSTITSTPTASRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQINDELY 1140

Query: 1141 KLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGLTKQS 1200
            KLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGLTKQS
Sbjct: 1141 KLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGLTKQS 1200

Query: 1201 ESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNNGLNE 1260
            ESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNNGLNE
Sbjct: 1201 ESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNNGLNE 1260

Query: 1261 DEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAPESSP 1320
            DEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAPESSP
Sbjct: 1261 DEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAPESSP 1320

Query: 1321 FLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350
            FLPKLFSQSSHYKMDDIVTFFNNIYWSRET
Sbjct: 1321 FLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350

>Kwal_26.7055
          Length = 1555

 Score = 2140 bits (5545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1039/1354 (76%), Positives = 1173/1354 (86%), Gaps = 7/1354 (0%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLS-NKHQLELTLEDNQIVEIESETLDETKDDR 59
            MS+EVGTRCWYPDK++GW+G E+TK +     K  LEL LE+ + VEIE+ETL+E+++++
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQL 119
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIKARY QLNIYTYSGIVLIATNPFDRVEQL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 120  YSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179
            YSQDMIQAYAG+RRGELEPHLFAIA+EAYRLMK+DKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVEQNNEENAH--HNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            YFASVEQ N +NA   H+L+MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEILF
Sbjct: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240

Query: 238  DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYM 297
            D+  SIIGARIRTYLLERSRLVFQP+ ERNYHIFYQL+ GL+  EK +L LT VEDYHY+
Sbjct: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300

Query: 298  NQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDAS 357
             QGG+ +IKG+DDA EYQ TV+AL +VG S+DTQ+QLFKILAALLHIGN+E+KKTRNDAS
Sbjct: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360

Query: 358  LSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYS 417
            LSSDEPNL IAC+LLGID+  F+KWITKKQI TRSEKIVSNL++NQALVARDSVAKFI+S
Sbjct: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420

Query: 418  ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALF+WLV+NINTVLCNP+V+ +I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 537
            QHVFKLEQEEYV E+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDKPPTN+VFSKPRFGQTKFVVSHYALDV+YDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600

Query: 598  NETLLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNV 657
            N+TLLSIL+T+DK+AA LAEK+  NKKPGPARMV +KPTLGS+FKQSLIELM TI+STNV
Sbjct: 601  NDTLLSILDTIDKNAAALAEKQDANKKPGPARMV-KKPTLGSMFKQSLIELMNTIDSTNV 659

Query: 658  HYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP 717
            HYIRCIKPNE KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP
Sbjct: 660  HYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP 719

Query: 718  SEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDRL 777
            S++W+K+F+S+ +E+DIR+LC+ ILGA V+D  KYQLGNTKIFFKAGMLAYLEKLRS ++
Sbjct: 720  SDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKM 779

Query: 778  HNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMVR 837
            HNS VLIQ            LAI ++I N  +   G   RQ VD EFKT AAI +Q++ R
Sbjct: 780  HNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTIFR 839

Query: 838  STSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTTR 897
                R      L++I R+QSLVRKQ+AQKE+L++RQ +AAV+IQKKIR F PRQS+N TR
Sbjct: 840  GVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNATR 899

Query: 898  RSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKGM 957
             S+V +QSLVR             +AKSVNHL+EVSYKLENKVIQLT+SLAEKVKEN+ M
Sbjct: 900  GSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEKVKENRDM 959

Query: 958  TARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXXXXXXXXXXX 1017
            TA+IQ+LQ+SLNESANIK LL++QKD+HS+ LQ+QK +HD +    +             
Sbjct: 960  TAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNAKAEVEAA 1019

Query: 1018 XXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAAV 1077
                      Q++LKA+VR K+EELN  ++ F + +TQNSDL+NEVKSLKDEI RLQ ++
Sbjct: 1020 KKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQTSI 1079

Query: 1078 RXXXXXXXXXXXX-XXXRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQIN 1136
            R                RRFSAHSS+ D  SPRQLNVISMNN G+EDDARSTASALSQIN
Sbjct: 1080 RSGANSNTILAHTPTKSRRFSAHSSLTDA-SPRQLNVISMNN-GMEDDARSTASALSQIN 1137

Query: 1137 DELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGL 1196
            DELYK+LEDTKSLN EIVEGLLKGFKIPETGVA ELTRKEVLYPARI+IIVLSDMWRLGL
Sbjct: 1138 DELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRLGL 1197

Query: 1197 TKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNN 1256
            TKQSESFLAE +STIQKLV+ LKGDDMI HGAFWLTNVRELYSFVVFAQESILNDDSYN+
Sbjct: 1198 TKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSYNS 1257

Query: 1257 GLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAP 1316
            GLNEDEYKEY+TLVTELKDDFESLSYNIYNIWLKKLQKDLE+KA+SAVVMSQSLPGFIA 
Sbjct: 1258 GLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIAN 1317

Query: 1317 ESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350
            ESS FLPKLFSQS++YKMDDI+TFFNNIYWS +T
Sbjct: 1318 ESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKT 1351

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 2038 bits (5281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 989/1351 (73%), Positives = 1136/1351 (84%), Gaps = 6/1351 (0%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60
            MSYEVGTRCWYPDK+QGWIGGEITKH  + +K+QL+LTLE+ ++VEI + +++E   + L
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAG+RRGELEPHLFAIAEEAY LMKN KQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEQNN---EENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            FA+VEQ+N      + H++EMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYM 297
            DK+ISIIGARIRTYLLERSRLVFQP SERNYHIFYQLLAGL  E K +LKL GVE+YHYM
Sbjct: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300

Query: 298  NQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDAS 357
            NQGG ++I+G+DD EEY  T +ALSLV I++ TQ  LFK+LAALLHIGN+++KKTRNDAS
Sbjct: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360

Query: 358  LSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYS 417
            +S+ +P+L IACELLGID++NFAKWITKKQI TRSEKIVSNLNY QA+VARDSVAKFIYS
Sbjct: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420

Query: 418  ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALF+WLV+NIN VLCNP V +EI SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 537
            QHVFKLEQEEYVKEEI+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK
Sbjct: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540

Query: 538  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDKPPTNTVFSKPRFGQTKFVVSHYA DV+YDVEGFIEKNRDTVSDGHLEVLK ST
Sbjct: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600

Query: 598  NETLLSILETLDKHAAKLAEKEQVNKKPGP-ARMVNRKPTLGSIFKQSLIELMGTINSTN 656
            NETLL+ILET+D++AAKLAEK +  KKPGP  R VNRKPTLGS+FKQSL+ELM TINSTN
Sbjct: 601  NETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660

Query: 657  VHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILI 716
            VHYIRCIKPNE KEAW FDNLMVLSQLRACGVLETIRISCAGFP+RWTY+EF LRYHIL+
Sbjct: 661  VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720

Query: 717  PSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDR 776
            PS +W+K+F++ TTEE+I  LC+ IL   V DK+KYQLGNTKIFFKAGMLA+LEK R+D+
Sbjct: 721  PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTDK 780

Query: 777  LHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMV 836
            L++SS +IQ            L I ++I+  HS ++G L R ++DLEFKT AAI IQS+ 
Sbjct: 781  LNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSLY 840

Query: 837  RSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTT 896
            R +  R  TI LL +I R QSL+R+ LA+KEL  R + DAA++IQK IRAF+PR S+ T 
Sbjct: 841  RGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYITN 900

Query: 897  RRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKG 956
            RRST+VVQSLVR             EAKSV+HLKEVSYKLENKVI+LTESLA KVKENK 
Sbjct: 901  RRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENKD 960

Query: 957  MTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXXXXXXXXXX 1016
            + +RI+ELQ SLNESANI+ELL ++++E+ K + QQKD H   + EV             
Sbjct: 961  LNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVDD 1020

Query: 1017 XXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAA 1076
                       Q++LK EV+ KIEEL+K ++  ++ +TQNSDL NEV SLK+EIARL  A
Sbjct: 1021 ARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNA 1080

Query: 1077 VRXXXXXXXXXXXXXXXRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQIN 1136
            +R               +R S++S + +  SP+Q NV+S+NNG +E++ RS  S LSQIN
Sbjct: 1081 IR--NAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQIN 1138

Query: 1137 DELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGL 1196
            DELYKLL D + L +EIVEGLLK  KIP+ G A  LTRKEVLYPAR+LII+LSDMWRLGL
Sbjct: 1139 DELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRLGL 1198

Query: 1197 TKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNN 1256
            T+QSE FLAEVLSTIQ LVTNLKGD++I++GAFWLTNVRELYSF ++A +SILND++Y  
Sbjct: 1199 TEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAYIK 1258

Query: 1257 GLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAP 1316
             LNEDEYK+YVTLV+ LKDDFESLSYNIYNIWLKKLQK+LE++A+SAVVMSQSLPGFI P
Sbjct: 1259 DLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFIVP 1318

Query: 1317 ESSPFLPKLFSQSSHYKMDDIVTFFNNIYWS 1347
            ESS FLPK+FS SS YKMDDI+TFFN IYWS
Sbjct: 1319 ESSAFLPKIFSSSSSYKMDDILTFFNTIYWS 1349

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 1954 bits (5062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1356 (69%), Positives = 1116/1356 (82%), Gaps = 9/1356 (0%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60
            M YEVGTRCWYP K QGWIG E+TKHT   + + LELTLED Q VE+   +LDETK+  L
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAYAGK RGELEPHLFAIAEEAYRLMK   QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240
            FASVE+NNEENAHHNLEMSETEKKILATNPIMEAFGNAKT RNDNSSRFGKYLEILFD +
Sbjct: 181  FASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240

Query: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300
             SIIGAR+RTYLLERSRLVFQPK+ERNYHIFYQ+L+GL+++EKSQLKLT ++DYHYMNQG
Sbjct: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300

Query: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360
            G++ I+G+DDA EY  TVEALSLVGISKDTQ+QLFKILAALLHIGN+E+KK RNDASLSS
Sbjct: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360

Query: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420
            DEPNL IA +LLGID+F+FAKW+TKKQI TRSEKIVS+L Y+QA+V+RDSVAKFIYSALF
Sbjct: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420

Query: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            +WLVDNINTVLCNPEV SEI +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT KLY+
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540

Query: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TL+KPPTN VFSKPRFGQT+F+VSHYALDV+YDV+GFIEKNRDTVSDGHLEVLKAS NET
Sbjct: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600

Query: 601  LLSILETLDKHAAKLAE----KEQVNKKPGPA-RMVNRKPTLGSIFKQSLIELMGTINST 655
            LLSILET+DK+A KLAE    K++  KKPGPA R + RKPTLGS+FKQSLI+LM TINST
Sbjct: 601  LLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLMETINST 660

Query: 656  NVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 715
            NVHYIRCIKPNE KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWTY EF LRYHIL
Sbjct: 661  NVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHIL 720

Query: 716  IPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSD 775
            +PSE WS +  SD +EED+++LC+ IL   ++D  KYQ GNTKIFFKAGMLA+LEKLR+D
Sbjct: 721  VPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLRTD 780

Query: 776  RLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSM 835
            +L +SSV+IQ            L  + +I+   +   G + R + + EFK  AA+LIQS 
Sbjct: 781  KLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQSA 840

Query: 836  VRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNT 895
             R  S R+   S++ +I R+QS+ RKQ+  KELL+RR+ DAAV+IQK +R+F+PR+SF  
Sbjct: 841  YRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSFLH 900

Query: 896  TRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENK 955
             ++ TVV+QS +R            +EAKSVNHL+EVSYKLENKVI+LTESLA KVKENK
Sbjct: 901  EKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKENK 960

Query: 956  GMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXXXXXXXXX 1015
             + +R++ LQ+SLNES NIK  L  +K+ H+K L  QK  H+ ++ +V            
Sbjct: 961  ELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKEEII 1020

Query: 1016 XXXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQA 1075
                        Q  LK E+ + +EEL  A+      Q++N+DLK EV SLK+E+ARLQ+
Sbjct: 1021 SAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARLQS 1080

Query: 1076 AVRX-XXXXXXXXXXXXXXRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQ 1134
            ++R                RRFSA+S++ DG+SP+QLNV+S+NN    +D    ++ +SQ
Sbjct: 1081 SMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTED---VSALMSQ 1137

Query: 1135 INDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRL 1194
            INDELYK+ ED++SLNTEI+EGLLKG K+P TGV+V LTRKEVLYP+R+LII+LSDMWRL
Sbjct: 1138 INDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWRL 1197

Query: 1195 GLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSY 1254
            GLT QSE+FLAEVL  IQK+++NLK D MI HGAFW TNVREL+SFVV+A ESI  D++Y
Sbjct: 1198 GLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDETY 1257

Query: 1255 NNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFI 1314
            N+G+NE+EY  YV LV ELKDDFE+LS+N+YN+W+KKL+K+LE+ A+ AVV+SQSLPGF+
Sbjct: 1258 NSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFV 1317

Query: 1315 APESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350
             PE S FL K    SS YKMDD++TFFNNIYW+ ++
Sbjct: 1318 VPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKS 1353

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 1866 bits (4834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1372 (67%), Positives = 1091/1372 (79%), Gaps = 23/1372 (1%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60
            MS+EVGTRCWYP K+ GWIG E+ K+     K+ LEL LED++IV ++++ L+  KD  L
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240
            FASVE+ N     H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK+
Sbjct: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300
             SIIGARIRTYLLERSRLV+QP  ERNYHIFYQL+AGL  + K +L LT   DY YMNQG
Sbjct: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300

Query: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360
            G+ +I GIDDA+EY+ TV+AL+LVGI+K+TQ+Q+FKILAALLHIGN+EIKKTRNDASLS+
Sbjct: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360

Query: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420
            DEPNL +ACELLGID++NFAKW+TKKQI TRSEKIVSNLNY+QALVA+DSVAKFIYSALF
Sbjct: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420

Query: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            +WLV+NINTVLCNP V  +I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540
            FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQKLYQ
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDK PTN VFSKPRFGQTKF+VSHYALDV+YDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LLSILETLDKHAAKLAEKEQV------NKKPGPARMVNRKPTLGSIFKQSLIELMGTINS 654
            L++ILE L+K A KL E +++      +KKPGP R VNRKPTLGS+FKQSLIELM TINS
Sbjct: 601  LINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS 660

Query: 655  TNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHI 714
            TNVHYIRCIKPN  KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EFVLRY+I
Sbjct: 661  TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720

Query: 715  LIPSEHWSKMFSS-DTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLR 773
            LIP E W  +F   +TTEEDI  + + IL A V+DK KYQ+GNTKIFFKAGMLAYLEKLR
Sbjct: 721  LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR 780

Query: 774  SDRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQ 833
            S+++HNS V+IQ            L I  +I+   +  +GF+ RQ+V+ E K   A L+Q
Sbjct: 781  SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ 840

Query: 834  SMVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSF 893
            +  R  S R    S+L  IT LQ  +RK+L Q++L Q  + +AAV+IQ K+R FEPR  F
Sbjct: 841  AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF 900

Query: 894  NTTRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKE 953
              T++ TVVVQSL+R             +AKSVNHLKEVSYKLENKVI+LT++LA KVKE
Sbjct: 901  LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960

Query: 954  NKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNE-VQXXXXXXXX 1012
            NK MT RI+ELQ  + ESA ++E L + K EH   +  QK + D++  + ++        
Sbjct: 961  NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQK-SKDMELQKTIENNLQSTEQ 1019

Query: 1013 XXXXXXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIAR 1072
                            DELK E + ++EEL + KKT  E+QT N DL+NEVKSLK+EIAR
Sbjct: 1020 TLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKEEIAR 1079

Query: 1073 LQAAVRXXXXXXXXXXXXXXXRRFSAHSSVADGT-------SPRQLNVISMN---NGGIE 1122
            LQ A+                      +S  +         SP  LN+ S +   +G   
Sbjct: 1080 LQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNH 1139

Query: 1123 DDA----RSTASALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVL 1178
             D+    R      +QIN+ELY+LLEDT+ LN EI EGLLKGF++P+ GVA++L++++V+
Sbjct: 1140 IDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVV 1199

Query: 1179 YPARILIIVLSDMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELY 1238
            YPARILIIVLS+MWR GLTKQSESFLA+VL+TIQK+VT LKG+D+I  G FWL NVRELY
Sbjct: 1200 YPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELY 1259

Query: 1239 SFVVFAQESILNDDSYNNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLER 1298
            SFVVFA  SIL ++++ NG+ ++EYKEYV+LVTELKDDFE+LSYNIYNIWLKKLQK L++
Sbjct: 1260 SFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQLQK 1319

Query: 1299 KAISAVVMSQSLPGFIAPESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350
            KAI+AVV+S+SLPGF A E+S FL K+F+ +  Y MDDI+TFFN+IYW  ++
Sbjct: 1320 KAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKS 1371

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 1853 bits (4801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 914/1367 (66%), Positives = 1093/1367 (79%), Gaps = 19/1367 (1%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60
            MS+EVGTRCWYP K+ GWIG E+TK+      + +EL LED + V IE++ L +  D+ L
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAGK+RGE+EPHLFAIAEEAYRLMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240
            FASVE+ N     H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK+
Sbjct: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300
             SIIGA+IRTYLLERSRLV+QP++ERNYHIFYQ++AGL+ +EK++L L G EDY+YMNQG
Sbjct: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300

Query: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360
            G+ +I+G+DD +EY TTV+AL+LVGIS +TQ  +FKILAALLHIGN+EIKKTRNDASLSS
Sbjct: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360

Query: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420
            DE NL IACELLGIDSFNFAKWITKKQI TRSEKIVSNLNY+QALVARDSVAKFIYSALF
Sbjct: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420

Query: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            +WLV+NINTVLCNP V  ++ SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQKLYQ
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDKPPTN VFSKPRFGQTKFVVSHYALDV+YDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LLSILETLDKHAAKL-----AEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINST 655
            L++IL+TL+++A KL     AE+E    KPGP R V RKPTLGS+FKQSLIELM TI ST
Sbjct: 601  LINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRST 660

Query: 656  NVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 715
            N HYIRCIKPN  KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWT+NEF+LRY+IL
Sbjct: 661  NAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL 720

Query: 716  IPSEHWSKMFS-SDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRS 774
            +P+  WS +F+  D TE+D+  LC  IL   V++K+KYQ+GNTKIFFKAGMLA+LEKLRS
Sbjct: 721  LPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRS 780

Query: 775  DRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQS 834
            D++H SSVLIQ            L I+S+I +   R +G + R  +D EFK +AA  IQS
Sbjct: 781  DKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQS 840

Query: 835  MVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFN 894
            ++R    R++ +S++S+I  +Q  VRK+L +K    + + DAAV+IQ K+R+F+PR++F 
Sbjct: 841  LLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAFL 900

Query: 895  TTRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKEN 954
              RR TVVVQSL+R             +AKSVNHLKEVSYKLENKV++LT++LA KVKEN
Sbjct: 901  EDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKVKEN 960

Query: 955  KGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXXXXXXXX 1014
            K ++AR+ ELQ SL ESA ++E L   K +H   L +QKD    +  +++          
Sbjct: 961  KSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQV 1020

Query: 1015 XXXXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQ 1074
                          +E KA  ++ +EEL K K    E QT NSDL+NEV SLK+E++RLQ
Sbjct: 1021 EEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRLQ 1080

Query: 1075 AAVRXXXXXXXXXXXXXXXRRFSAHSSVADGTS---PRQLNVISMN--------NGGIED 1123
              +                +      +V +GT      +LNV  +N        N G+ D
Sbjct: 1081 TQI-SLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGM-D 1138

Query: 1124 DARSTASALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARI 1183
               S ++AL+QIN+EL++LLED + LN EI +GLLK F++P  GV ++L+R++V+YPARI
Sbjct: 1139 SYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARI 1198

Query: 1184 LIIVLSDMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVF 1243
            LII+LS+MWR GLTKQSE FLA+VL+TIQK+VT LKG+D+I  GAFWL NVRELYSFVVF
Sbjct: 1199 LIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVF 1258

Query: 1244 AQESILNDDSYNNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISA 1303
            AQ SIL ++S+ +G+ +DEYKEYV+LVTELK+DFESLSYNIYNIWLKKLQ++L++KA++A
Sbjct: 1259 AQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNA 1318

Query: 1304 VVMSQSLPGFIAPESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350
            VV+S++LPGF A +S   L K+FS    Y MDDI+TFFN+IYWS ++
Sbjct: 1319 VVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKS 1365

>Scas_663.26
          Length = 1567

 Score = 1825 bits (4726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 904/1376 (65%), Positives = 1091/1376 (79%), Gaps = 27/1376 (1%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60
            MS+EVGTRCWYP K+QGWIG E+TK+      + +ELTLEDN++V +E++ L   KD  L
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDR++QLY
Sbjct: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120

Query: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAY+GKRRGE+EPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEQNNEENA---HHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            FAS ++ N  N     H  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYM 297
            DKE +IIGA++RTYLLERSRLV+QPK+ERNYHIFYQ+LAGL  + K +L LT  +DY YM
Sbjct: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300

Query: 298  NQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDAS 357
            NQGGE +I GIDD  EY  T++AL+LVG++ +TQ  +FKILAALLHIGN+EIKKTRND+S
Sbjct: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360

Query: 358  LSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYS 417
            LSSDEPNL IACELLG+D  NFAKWITKKQI TRSEKIVSNLNY+QALVARDSVAKFIYS
Sbjct: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420

Query: 418  ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALF+WLV NINTVLCNP V  +I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 537
            QHVFKLEQEEY+KEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 481  QHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYALDV+YDVEGFIEKNRDTVSDGHLEVLKA+T
Sbjct: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600

Query: 598  NETLLSILETLDKHAAKLAEKEQVN--------KKPGPARMVNRKPTLGSIFKQSLIELM 649
            N+TL +ILE++++ A K+ E ++          KKP P R V RKPTLGS+FK SLIELM
Sbjct: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660

Query: 650  GTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFV 709
             TINSTNVHYIRCIKPN  KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWT+NEF+
Sbjct: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720

Query: 710  LRYHILIPSEHWSKMF-SSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAY 768
            LRY+ILIP   W+ +F  +D TE+D+ +LC+ IL A V+DK+KYQ+GNTKIFFKAGMLAY
Sbjct: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780

Query: 769  LEKLRSDRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQA 828
             EKLRS +++++ VLIQ            + + +S+    + S+G + RQ+V+ E +  A
Sbjct: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840

Query: 829  AILIQSMVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFE 888
            A LIQ+M R  S R+    ++S+I +LQS +R++L Q+E+  + + +AA+SIQ +IRAF 
Sbjct: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900

Query: 889  PRQSFNTTRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLA 948
            PR+++ + RR T+VVQSL+R             +AKSV+HLKEVSYKLENKVIQLT++LA
Sbjct: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960

Query: 949  EKVKENKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXX 1008
             KVKEN+ ++ R++ELQ ++   + +++ L +QK E+ K L  QKD   +    ++    
Sbjct: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020

Query: 1009 XXXXXXXXXXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKD 1068
                                 E++AE + +++EL + K   TE +TQNSDL +E+KSLK+
Sbjct: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080

Query: 1069 EIARLQAAVRXXXXXXXX----XXXXXXXRRFSAHSSVA-DGTSPRQLNVI--------- 1114
            E+A LQ ++                    R  S H   A +  SP QL  I         
Sbjct: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV 1140

Query: 1115 SMNNGGIEDDARSTASALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTR 1174
            S+N  G++DD  +T + L+QIN+ELY+LLE T  LN EI EGLLKGF++P+ GVA++L+R
Sbjct: 1141 SVNGYGMDDDIINT-NTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSR 1199

Query: 1175 KEVLYPARILIIVLSDMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNV 1234
            ++V+YPARILIIVLS+MWR GLTKQSESFLA+VL+TIQK+VT LKG D+I  GAFWL NV
Sbjct: 1200 RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANV 1259

Query: 1235 RELYSFVVFAQESILNDDSYNNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQK 1294
            RELYSFVVFAQ SIL ++S+  G+N++EY EYV+LVTELK+DFESLSYNIYNIWLKKLQK
Sbjct: 1260 RELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWLKKLQK 1319

Query: 1295 DLERKAISAVVMSQSLPGFIAPESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350
            DL++KAI+AVV+S+SLPGF A ES+ FL K+F+    Y MDDI+TFFNNI+W  ++
Sbjct: 1320 DLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKS 1375

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/1302 (51%), Positives = 861/1302 (66%), Gaps = 63/1302 (4%)

Query: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDR- 59
            MS+EVGT+CWYP K+QGWIGGE+TK+        LEL LED + V IE+ +  E  DD  
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSF-ENDDDHP 59

Query: 60   -LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQ 118
             LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+V+ 
Sbjct: 60   TLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDH 119

Query: 119  LYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIM 178
            LYS++MIQ Y+ KR+ ELEPHLFAIAEEAYR M ++K NQT+VVSGESGAGKTVSAKYIM
Sbjct: 120  LYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIM 179

Query: 179  RYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFD 238
            RYFASV+++N  N    +EMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+ILFD
Sbjct: 180  RYFASVQESN--NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFD 237

Query: 239  KEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMN 298
            +  +I G++IRTYLLE+SRLV+QP++ERNYHIFYQ+L GL    K +L L+  +DYHY N
Sbjct: 238  ENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTN 297

Query: 299  QGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASL 358
            QGG+  I GID+A EY+ T +ALSLVGI+ +TQ  +FKILA LLHIGN+E+K TRNDASL
Sbjct: 298  QGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASL 357

Query: 359  SSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSA 418
            SS+E NL IACELLGID FNFAKWI KKQI TRSEKIV+NLNYNQAL+ARDSVAKFIYS 
Sbjct: 358  SSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYST 417

Query: 419  LFEWLVDNINTVLCNPEVASE--INSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 476
            LF+WLVDNIN  L +PE+  +  + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQEF
Sbjct: 418  LFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEF 477

Query: 477  NQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQ 536
            NQHVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDE+W  
Sbjct: 478  NQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWAS 537

Query: 537  KLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAS 596
            KLY   +KPP+N VFSKPRFGQTKF+VSHYA+DV Y+VEGFIEKNRD+VS GHL+V KA+
Sbjct: 538  KLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKAT 597

Query: 597  TNETLLSILETLDKHAAKLAEKEQVNKKPG-PARMVNRKPTLGSIFKQSLIELMGTINST 655
            TN     IL+  +  +    E++   KK   PAR+  +KPTLGS+FK+SL ELM  INST
Sbjct: 598  TNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINST 657

Query: 656  NVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 715
            NVHYIRCIKPN  K+ W FDNLMVLSQLRACGVLETIRISCAGFPSRWT++EFV RY +L
Sbjct: 658  NVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLL 717

Query: 716  IPSEHWSK-MFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRS 774
                 WS  +++ D  +E I + C++IL A + D  KYQ+GNTKIFFKAGMLA+LEKLR+
Sbjct: 718  TDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRT 777

Query: 775  DRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQS 834
            ++++   ++IQ            L  + SI+   S+    L R +VD E KT+AAIL+Q+
Sbjct: 778  NKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQT 837

Query: 835  MVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFN 894
             +R+   R    + +  I +LQ   +++L    + ++    AAV IQ  IR++  +  + 
Sbjct: 838  NIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYR 897

Query: 895  TTRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKEN 954
            T +RS+++VQS +R             E +  N        L  + I+   S    ++  
Sbjct: 898  TLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEML 957

Query: 955  KGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQXXXXXXXXXX 1014
                 R+ +L Q      ++  + + Q+ E+  ++          +N+            
Sbjct: 958  NDSYTRLTQLLQ-----GDLSNIPSKQRQEYETIVN--------GYNDKISKLKTLQVEI 1004

Query: 1015 XXXXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQ 1074
                         + +  + +++ ++ L   K        + S L +EVKS+K E+A ++
Sbjct: 1005 MNTLNKKNALKERKKKQSSLIQSHMQSLAAIKG------NKPSRLSDEVKSMKQELAFIE 1058

Query: 1075 AAVRXXXXXXXXXXXXXXXRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQ 1134
              +                +             P+ +NVI   +G               
Sbjct: 1059 NVIAQDFTTTYSANKNDKVKGLGI---AGQQVKPKLVNVIRRESG--------------- 1100

Query: 1135 INDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRL 1194
             N +L +LL D      E+ EG LK   +       E+    VL P  ++  V+S + R 
Sbjct: 1101 -NPDLLELLMDLNCYTLEVTEGYLKKVNV------TEVNGDNVLGPIHVITTVVSSLVRN 1153

Query: 1195 GLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSY 1254
            GL  QS  F+++VL T++ +V +L  D+ +L G FWL+N+  L +F   A +  L +   
Sbjct: 1154 GLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFA--ANQKTLYEA-- 1209

Query: 1255 NNGLNEDEYKEYVTLV--TELKDDFESLSYNIYNIWLKKLQK 1294
             NG +E   K+ +TL+   +L+++   +   IY+ WL K  K
Sbjct: 1210 -NGGDE---KDKLTLIYLNDLENETLKVFDKIYSTWLVKFMK 1247

>Scas_592.13*
          Length = 1419

 Score = 1254 bits (3244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/975 (62%), Positives = 745/975 (76%), Gaps = 16/975 (1%)

Query: 1   MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLD-----ET 55
           MS+EVGTRCWYP+ + GWIG E+TK+      + +ELT E   ++ IE++ L+     E 
Sbjct: 1   MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 56  KDDRLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115
             + LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD+
Sbjct: 61  NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 116 VEQLYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAK 175
           VE+LYS +MIQAYA K R E+ PH+FAIAEEAYR M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 121 VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 176 YIMRYFASVEQ---NNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKY 232
           YIMR+FASVE+   N E ++ H  EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 181 YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 233 LEILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVE 292
           L+ILFD   +IIG+ I+TYLLERSRLVFQP SERNYHIFYQ+L+GL+++ K QL LT  E
Sbjct: 241 LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 293 DYHYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKT 352
           D+ Y+NQGGE+ I GIDD+ EY TT+E+LS VGI  + Q Q+FKILAALLHIGN+EIKKT
Sbjct: 301 DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 353 RNDASLSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVA 412
           R DA+LSS +P+L  ACELLG+D   F+KWITKKQINTRSEKI+SNL++NQALVARDSVA
Sbjct: 361 RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 413 KFIYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472
           KFIYS+LF+WLV NIN VLC  +V+  INSFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 421 KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 473 QQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 532
           QQEFN HVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 481 QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 533 TWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEV 592
           +WT KLYQT +KPP+NTVF KPRFGQ KF++SHYA+DV+Y+V+GFIEKN+DT+S+  LEV
Sbjct: 541 SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 593 LKASTNETLLSILETLDKHAAKLAEKEQVNKKPGPA--RMVNRKPTLGSIFKQSLIELMG 650
           LKA+TN TL +I E      ++   K  + ++ G    + +NRKPTLGSIFK+SL+ELM 
Sbjct: 601 LKATTNPTLATIFE-----FSEAENKTNITEQAGTIQRKTINRKPTLGSIFKRSLVELME 655

Query: 651 TINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVL 710
           TINSTNVHYIRCIKPN  KEAW FDNLMVLSQLRACGVLETI+ISCAGFPSRW + EF+ 
Sbjct: 656 TINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQ 715

Query: 711 RYHILIPSEHWSKMFSS-DTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYL 769
           RY++L P++ W ++ +  + + ED+   C  IL   ++ K KYQ+G TKIFFKAG+LAYL
Sbjct: 716 RYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYL 775

Query: 770 EKLRSDRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAA 829
           EK+RSD++   +VLIQ            L  + SI+N  S   G  +RQ+VD E KT AA
Sbjct: 776 EKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAA 835

Query: 830 ILIQSMVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEP 889
            L+Q++ RST  R++    L  I  +Q+ +R+ L    + +  +  +A+ IQ KIRA  P
Sbjct: 836 TLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSP 895

Query: 890 RQSFNTTRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAE 949
           +  + T +  T+++Q+LVR             +A+S   LK  +  ++ ++I   E L  
Sbjct: 896 KHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELIS 955

Query: 950 KVKENKGMTARIQEL 964
            +KEN   T   + L
Sbjct: 956 NIKENDAKTTEYKSL 970

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
           cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
           cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/940 (56%), Positives = 698/940 (74%), Gaps = 15/940 (1%)

Query: 1   MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLD-----ET 55
           M++EVGTRCWYP  + GWI  E++K+     K+ L+ TLED  +++++++++D       
Sbjct: 1   MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 56  KDDRLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115
           +   +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF +
Sbjct: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119

Query: 116 VEQLYSQDMIQAYAG-KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSA 174
           +E+LYS DMI+ Y+    R EL+PHLFAIA +AY  M +  +NQTIVVSGESGAGKTVSA
Sbjct: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179

Query: 175 KYIMRYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLE 234
           KYIMRYFAS++ NN   A    EMS+ EKKILATNPIMEAFGNAKT RNDNSSRFGKYL+
Sbjct: 180 KYIMRYFASLDDNN---AAVVSEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQ 236

Query: 235 ILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDY 294
           I+FD + +IIGA+IRTYLLERSRLVFQ +SERNYHIFYQLLAGL    K +L ++  E +
Sbjct: 237 IMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQF 296

Query: 295 HYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRN 354
           +Y+NQG + +I G+DDA+E+Q T+ ALS++GI+   Q ++FKILA LLHIGN+EIK++  
Sbjct: 297 YYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQSST 356

Query: 355 DASLSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKF 414
            +S+S DEPNL +ACELLG+D + F+KW+TKK+I TRSEKIV+NL   QALV RDSV+KF
Sbjct: 357 SSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKF 416

Query: 415 IYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 474
           IYS LF+WLV+ INT+L   EV+ ++ SFIGVLDIYGFEHFE NSFEQFCINYANEKLQQ
Sbjct: 417 IYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476

Query: 475 EFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETW 534
           EFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+DE+W
Sbjct: 477 EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536

Query: 535 TQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLK 594
           TQKLYQTLDKPP N VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  + VLK
Sbjct: 537 TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596

Query: 595 ASTNETLLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINS 654
            S N+TL+S+ +  ++ +    +   +++     +++N+KPTLG +FK+SL ELM  IN+
Sbjct: 597 NSQNDTLISLTKPTEETSTPPPQTASISR----PKLINKKPTLGFMFKKSLGELMEIINN 652

Query: 655 TNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHI 714
           TNVHYIRC+KPN  K AW FD+ MVLSQLRACG+LETI+ISCAGFPSRW++ EF+ RY++
Sbjct: 653 TNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRYYM 712

Query: 715 LIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRS 774
           L+ +  WS + SS++  E     C+ ILGA     +K Q+G TKIFFK+G+LA LE LR 
Sbjct: 713 LVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESLRL 772

Query: 775 DRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQS 834
            ++   ++ IQ            L I++ +R+  +R    L R  V+ + KT+ A+++Q+
Sbjct: 773 KKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQA 832

Query: 835 MVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFN 894
            +RS   R +    L  I  LQ   R  LAQ+ L + ++  A++ IQ  IR ++ +  + 
Sbjct: 833 TLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQYR 892

Query: 895 TTRRSTVVVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSY 934
             R++   +Q+L R            +E++ V  +  V+Y
Sbjct: 893 YFRKNYQAIQALSRSMLARSLMLKLRSESE-VTQINGVTY 931

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  523 bits (1347), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 303/784 (38%), Positives = 467/784 (59%), Gaps = 73/784 (9%)

Query: 10  WYPDKQQGWIGGEITKHTNLSNKHQ-------LELTLEDNQIVEIESETLDETKDDRLPL 62
           W PD ++ ++ G++     + NK         + +  ++ +++E+E+  +          
Sbjct: 9   WVPDAEEVFVKGQLVSTKTIKNKQNKDEKVCLVRVNGKEREVLEVETAAV---------- 58

Query: 63  LRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQ 122
             NP   +  +D++ L++LNE +VL+ ++ RY    IYTYSG+ L+A NP+  + ++Y+Q
Sbjct: 59  --NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQ 115

Query: 123 DMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFA 182
           D +  Y G  + + EPH+FA+AE+AYR +   +Q+Q+++V+GESGAGKT + K I++Y A
Sbjct: 116 DYVNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLA 175

Query: 183 SVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEIS 242
           S+  ++E+ AH NLE    E+KIL  NPI+E+FGNA+T RN+NSSRFGK+++I FD+   
Sbjct: 176 SI-TSDEKLAHTNLE--SFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGK 232

Query: 243 IIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLT--GVEDYHYMNQG 300
           I GA I  YLLE+SR++ Q   ERNYH+FYQLL+G+   +   L+L    + DY Y+   
Sbjct: 233 INGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYLRDS 292

Query: 301 GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRND-ASLS 359
             + I G+DDA ++ + + A ++VG  +D  + +F+ +A +LHIGNVE   TR + A++ 
Sbjct: 293 NPS-IPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQATIK 351

Query: 360 SDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSAL 419
           +D   +A  C+L+G+D   F   + K +     E +  + N  Q+    +S+++ +Y  L
Sbjct: 352 ND---VAPLCKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKL 408

Query: 420 FEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 479
           F  +V  IN  L   +  S   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H
Sbjct: 409 FAHIVRRINRSL---DHGSMTENYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHH 465

Query: 480 VFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDETWT 535
           +F LEQ EYVKE+I+W FI++  D +  I+LIE   N  GILS+LDEES LP  +DE++ 
Sbjct: 466 MFVLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDESFY 525

Query: 536 QKLYQTLD-KPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLK 594
            KL    D K P    F + +  Q  FV+ HYA DV Y+V+ ++ KN+D ++D  L +L 
Sbjct: 526 SKLMSAWDGKSPK---FKRSKLQQC-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLTLLS 581

Query: 595 ASTNETLLSIL-ETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTIN 653
            S+N+ +     E    H +K A               NR        K+ L  L+  ++
Sbjct: 582 ESSNKLISEFYTEQSRGHFSKTAS--------------NR-------HKEQLTLLLDQLS 620

Query: 654 STNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYH 713
           ST+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + EF  RY 
Sbjct: 621 STDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQRYK 680

Query: 714 ILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLR 773
           IL         FS+++ +      C  +L  I  D   Y++GNTK+FFKAG+LA LE  +
Sbjct: 681 ILGADPK----FSNNSKKN-----CEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLETQK 731

Query: 774 SDRL 777
            +++
Sbjct: 732 EEKI 735

>Scas_688.22
          Length = 1876

 Score =  521 bits (1341), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 296/790 (37%), Positives = 473/790 (59%), Gaps = 64/790 (8%)

Query: 9   CWYPDKQQGWIGGEITKHTNLSN-KHQLELTLEDNQIVEIESETLDETKDDRLPLLRNPP 67
            W PD  + +   E+ +  ++ N +  +E  +   +I+E   E L   K +  P   NP 
Sbjct: 8   VWIPDPDKIFTLAEVARIESVKNARTNVEEEMATVRIMET-GEELQIEKSNLSP--SNPT 64

Query: 68  ILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQA 127
             +  ++++ L++LNE +VLH ++ RY    IYTYSG+ L+A NP+  + ++Y+Q+ I  
Sbjct: 65  SFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYTQEYINL 123

Query: 128 YAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQN 187
           Y G  + + +PH++AIAEEAY+ +  +KQ+Q+++V+GESGAGKT + K I++Y AS+  N
Sbjct: 124 YNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYLASITSN 183

Query: 188 NEENAHHNLEMSET----------EKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
             + +  +L +S+           E KIL +NPI+E+FGNA+T RN+NSSRFGK+++I F
Sbjct: 184 KSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEF 243

Query: 238 DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLT--GVEDYH 295
           D+   I GA I  YLLE+SR++ Q   ERNYHIFYQLLAGL+ +E  +L+LT   V DY 
Sbjct: 244 DERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSKSVSDYK 303

Query: 296 YMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRND 355
           Y+++   + I G++DA+++Q  ++A + VG + +    ++++L+ +LHIGNV+    ++ 
Sbjct: 304 YLSKSNPS-IPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDFTSEKSQ 362

Query: 356 ASLSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFI 415
            +   ++P  +   +LLG+    F   +   +     E +  + N +QA    +S+++ +
Sbjct: 363 QATFKNDP--STLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILNSLSRTL 420

Query: 416 YSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQE 475
           Y  LF ++V+ IN  L +  + +   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ 
Sbjct: 421 YEKLFSFIVERINNSLDHSSMTA---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQF 477

Query: 476 FNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSD 531
           FN H+F LEQ EY+KE I+W+F++F  D Q  IDLIENK    G+L LLDEES LP  SD
Sbjct: 478 FNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESILPNSSD 537

Query: 532 ETWTQKLYQTLDKPPTNTVFSKPRFGQTK----FVVSHYALDVSYDVEGFIEKNRDTVSD 587
           +++  KL  T D+         P+F ++K    FV+ HYA +V Y++EG++ KN+D +S+
Sbjct: 538 DSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSKNKDPLSE 590

Query: 588 GHLEVLKASTNETLLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIE 647
             + +L +STNE + S     +K           N +    R      T  +  ++  + 
Sbjct: 591 CMISMLSSSTNEIVTSFFNESNK-----------NVRGSSFR------TASARHREQQML 633

Query: 648 LMGTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNE 707
           L+  + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + E
Sbjct: 634 LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFKE 693

Query: 708 FVLRYHILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLA 767
           F  RY +L    H++  F  +         C  +L ++  D   Y++G +K+FFKAG+LA
Sbjct: 694 FFQRYRLLSDENHFATGFKKN---------CEILLSSLHLDPSLYKIGTSKLFFKAGVLA 744

Query: 768 YLEKLRSDRL 777
            LE  +  R+
Sbjct: 745 ELETKKDQRI 754

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  518 bits (1334), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 310/800 (38%), Positives = 475/800 (59%), Gaps = 45/800 (5%)

Query: 9   CWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRLPLLR---- 64
            W PD+++ ++ GE+       NK     T ++ QI  +    LD T+   L  +R    
Sbjct: 13  VWIPDEKEVFVKGELMSTDINKNK----FTGQEEQIGIVHP--LDSTEVSNLVQVRISDV 66

Query: 65  ---NPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYS 121
              NP   +  E+++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS
Sbjct: 67  FPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNL-NLYS 125

Query: 122 QDMIQAYAGKR------------RGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAG 169
           +D I  Y  K               +L PH+FAIAEEAY  + ++ ++Q+I+V+GESGAG
Sbjct: 126 EDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAG 185

Query: 170 KTVSAKYIMRYFASVEQNNEEN---AHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNS 226
           KT + K I++Y AS+   +  N      +  +   E KIL +NPI+E+FGNA+T RN+NS
Sbjct: 186 KTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNS 245

Query: 227 SRFGKYLEILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQL 286
           SRFGK+++I F++   I GA I  YLLE+SR+V Q   ERNYHIFYQLL+GL + E   L
Sbjct: 246 SRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNL 305

Query: 287 KLTG--VEDYHYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHI 344
           +L    V+DY  ++   +  I GI+D E ++  + AL+++G SKD    +F+++A +L I
Sbjct: 306 RLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLI 365

Query: 345 GNVEIKKTRNDASLSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQA 404
           GN+E    R  A  +S + +++  C  LG+D  +F   I + +     E +  + N  QA
Sbjct: 366 GNIEFVSDR--AEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQA 423

Query: 405 LVARDSVAKFIYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFC 464
               +++++ +Y  LF ++VD IN    N +  S   ++IG+LDI GFE FE NSFEQ C
Sbjct: 424 KFILNALSRNLYERLFGYIVDMINK---NLDHGSATLNYIGLLDIAGFEIFENNSFEQLC 480

Query: 465 INYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK---LGILSLL 520
           INY NEKLQQ FN H+F LEQ EY+KE I+W +I++  D Q  IDLIE+K    G+L LL
Sbjct: 481 INYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLL 540

Query: 521 DEESRLPAGSDETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEK 580
           DEE+ LP  +DE++  KL  T D+   ++ F + R  +  F++ HYA DV Y VEG++ K
Sbjct: 541 DEEAVLPKSTDESFYSKLISTWDQ--NSSKFKRSRL-KNGFILKHYAGDVEYTVEGWLSK 597

Query: 581 NRDTVSDGHLEVLKASTNETLLSILETL-DKHAAKLAEKEQVNKKPGPARMVNRKPTLGS 639
           N+D ++D  L +L +S N+ +  + +   +K ++   E    N++   +   +   T  S
Sbjct: 598 NKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSS 657

Query: 640 IFKQSLIELMGTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGF 699
             ++  I L+  + ST+ H++RCI PN VK+   F+  ++L QLR  GVLE IR++  G+
Sbjct: 658 RHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGY 717

Query: 700 PSRWTYNEFVLRYHILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKI 759
           P+R  + EF  RY IL P    +  FSS   +   +  C  +L ++  D + Y++GNTK+
Sbjct: 718 PNRIAFQEFFQRYRILYPENSTTTTFSS-KLKASTKQNCEFLLTSLQLDTKVYKIGNTKL 776

Query: 760 FFKAGMLAYLEKLRSDRLHN 779
           FFKAG+LA LEK +  +L+N
Sbjct: 777 FFKAGVLADLEKQKDVKLNN 796

>Kwal_23.5534
          Length = 1907

 Score =  506 bits (1302), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 350/1076 (32%), Positives = 562/1076 (52%), Gaps = 115/1076 (10%)

Query: 9    CWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRLPLLRNPPI 68
             W PD +Q ++  ++     + NK       +D + V +     ++          NP  
Sbjct: 4    VWIPDAEQVFVRAQLVDEKTVRNKQN-----KDEKWVVVRVNGREQEVAFEEVYAVNPST 58

Query: 69   LEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAY 128
             +  +D++ L++LNEP+VLH ++ RYA  NIYTYSG+ L+A NP+  + ++YSQD +  Y
Sbjct: 59   FDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDYVNLY 117

Query: 129  AGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNN 188
             G  + + +PH+FAIAEEAY+ + +++++Q+I+V+GESGAGKT + K I++Y AS+   +
Sbjct: 118  HGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI--TS 175

Query: 189  EENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGARI 248
            ++    +      E+KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I GA +
Sbjct: 176  DDKLSPDTSQESFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKINGAHV 235

Query: 249  RTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEE--KSQLKLTGVEDYHYMNQGGEAQIK 306
              YLLE+SR++ Q   ERNYHIFYQ+L+G++ +E  +  L+   ++DY Y+     + I 
Sbjct: 236  DWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYLRNSNPS-IP 294

Query: 307  GIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSSDEPNLA 366
            G+DD+++++T + +  +VG S+D    +   ++ +LHIGN+E    R  A  +S + ++ 
Sbjct: 295  GVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQASFDGSVE 352

Query: 367  IACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALFEWLVDN 426
              C LLG+   +F   + K +     + +    N +QA    +S+++ +Y  LF  +V  
Sbjct: 353  TLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLFAHIVQR 412

Query: 427  INTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQE 486
            IN    N +  S   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F LEQ 
Sbjct: 413  INN---NLDHGSMTENYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFVLEQN 469

Query: 487  EYVKEEIEWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDETWTQKLYQTL 542
            EY+KE ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DE++  KL +T 
Sbjct: 470  EYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYSKL-ETF 528

Query: 543  DKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNETLL 602
                  +   K    Q  FV+ HYA DV Y+V+G++ KN+D + +  L++L  S+NE + 
Sbjct: 529  --YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNSSNELIR 586

Query: 603  SILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYIRC 662
                  D   +                      T     +  L  L+  ++ST  H++RC
Sbjct: 587  GFYSEKDSRGSSF-------------------KTTSIRHRDQLKSLLDRLSSTEPHFVRC 627

Query: 663  IKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEHWS 722
            I PN+ K+A  F+  ++L QLR  GVLE IRI+  G+P+R  + EF  RY IL     + 
Sbjct: 628  IIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYKILSDEYRF- 686

Query: 723  KMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDRLHNSSV 782
                S+T++++    C  +L ++  D   +++GN+K+FFKAG+LA LE            
Sbjct: 687  ----SNTSKKN----CEIVLSSLRLDPSVFKVGNSKLFFKAGVLASLE------------ 726

Query: 783  LIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMVRSTSTR 842
                                      ++ EG ++    D+  K  A I   ++ RSTS +
Sbjct: 727  --------------------------AKKEGRIS----DMASKLNARINGNAVRRSTSQK 756

Query: 843  NKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRA-FEPRQSFNTTRRSTV 901
             K    L A   L S         E  Q+   D   S+  KI+   E  Q  + TR+   
Sbjct: 757  LKK---LQAAQVLGSAF-------ETYQKMMGDPWFSLYVKIKPLLESTQEISKTRKIAE 806

Query: 902  VVQSLVRXXXXXXXXXXXXTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKGMTARI 961
             V++L               E KS   +   S K   ++   ++ LA+K K+   + A+ 
Sbjct: 807  QVKNLEEKLKTLELQNQALGEEKSAISVNLASVK--ERLATESQELAQKQKDLDSVLAKE 864

Query: 962  QELQQSLNESANIKELLNSQKD-------EHSKVLQQQKDAHDVQFNEVQXXXXXXXXXX 1014
             EL+Q LNES  +++ +  +KD       + S  L++Q  A   +  E+Q          
Sbjct: 865  AELKQKLNESNELQQEIMQKKDTELKLKLDESNKLREQTFAE--KEAELQQKFDESEKLR 922

Query: 1015 XXXXXXXXXXXXXQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEI 1070
                           E +A+     EE  K++  + +  ++N  LKN+V +L  +I
Sbjct: 923  QHFLAEKEALQKEYSEARAKADQNREETEKSQSLYKKLLSENDQLKNQVTNLTTKI 978

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  503 bits (1295), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 297/781 (38%), Positives = 455/781 (58%), Gaps = 61/781 (7%)

Query: 8   RCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRLPLLRNPP 67
           + W  D+++ ++ G++ +   + NK   E  +    +V +  +  + ++DD   +  NP 
Sbjct: 7   KVWVSDEREVFVQGQLVERKVVKNKQGQEQAV---AVVSVNGKETEFSEDDVASV--NPS 61

Query: 68  ILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQA 127
             +  +DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  + ++YS   I+ 
Sbjct: 62  TFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNSYIKL 120

Query: 128 YAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQN 187
           Y G  + + +PH+FA+AE+AY+ + + KQ+Q+I+V+GESGAGKT + K I++Y AS+   
Sbjct: 121 YHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI--T 178

Query: 188 NEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGAR 247
            ++    N      E+KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I GA 
Sbjct: 179 TDDKILLNQTNESFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEYGKINGAH 238

Query: 248 IRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVE-----DYHYMNQGGE 302
           I  YLLE+SR++     ERNYHIFYQ+L+G++   K +L+  G+E     DY Y+     
Sbjct: 239 IEWYLLEKSRVIQAHARERNYHIFYQILSGMS---KQELRAIGLESNSIVDYQYLRHSNP 295

Query: 303 AQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRND-ASLSSD 361
           + I GIDD + YQ  V A   VG +KD    + K ++ +LHIGNVE    R++ AS+ +D
Sbjct: 296 S-IPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQASIKND 354

Query: 362 EPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALFE 421
              +   C+LLG+   +F   + K +     E +    N +QA    +S+++ +Y  LFE
Sbjct: 355 ---IKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLYEKLFE 411

Query: 422 WLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVF 481
           ++V+ IN  L   E  S    FIG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F
Sbjct: 412 YIVNQINKSL---EHGSMTEYFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMF 468

Query: 482 KLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK----LGILSLLDEESRLPAGSDETWTQ 536
            LEQ EY KE+I+W+FI++  D Q  IDLIE K     GIL +L+EES LP  SD ++  
Sbjct: 469 VLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSSDASFYS 528

Query: 537 KLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAS 596
           KL  + D   T   F + +     F++ HYA DV Y+V  ++ KN+D +++  L+VL   
Sbjct: 529 KLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLLQVLNDC 585

Query: 597 TNETLLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTN 656
            N  +                    ++  G +       T  +  ++ L  L+  + +T+
Sbjct: 586 ANPLVSQFF---------------ADRIRGSSFR-----TSSNKHREQLHTLIEQLGNTD 625

Query: 657 VHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILI 716
            H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + EF  RY IL 
Sbjct: 626 PHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFFQRYKILS 685

Query: 717 PSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDR 776
                   F++++ +      C  +L ++  D   Y++GNTK+FFKAG+LA LE L+  R
Sbjct: 686 DECR----FTNNSKKN-----CEILLSSLHLDPTIYKVGNTKLFFKAGVLANLELLKEQR 736

Query: 777 L 777
           L
Sbjct: 737 L 737

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  490 bits (1261), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 300/784 (38%), Positives = 449/784 (57%), Gaps = 51/784 (6%)

Query: 8   RCWYPDKQQGWIGGEITKHTNLSNK-----HQLELTLEDNQIVEIESETLDETKDDRLPL 62
           R W PD  + ++ G++     + +K      Q+ L  +DN     + ET      +  P+
Sbjct: 6   RVWVPDPVEIFVRGDLLNTDIVKDKFTGVEQQVGLVKKDN-----DGETATFKISEIFPV 60

Query: 63  LRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQ 122
             NP   +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS 
Sbjct: 61  --NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYSN 118

Query: 123 DMIQAY-AGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYF 181
             I++Y +       +PH+F +AE AYR +K+ KQ+Q+I+V+GESGAGKT + K I++Y 
Sbjct: 119 STIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQYL 178

Query: 182 ASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEI 241
           AS+  ++ E   +N EM     KIL +NP++E+FGNA+T RN+NSSRFGK+++I FD+  
Sbjct: 179 ASITSDSFE-VSNNFEM-----KILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQSG 232

Query: 242 SIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEE-KSQLKLTGVEDYHYMNQG 300
            I GA I  YLLE+SR+  + ++ERNYHIFYQLL G + ++ +S  KL+  +  HY    
Sbjct: 233 KINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQILA 292

Query: 301 GEAQ-IKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVE-IKKTRNDASL 358
                I G+DDA E+Q  + AL  VG  KD    +FKI+A +LH GN+E + +    AS 
Sbjct: 293 NSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQASF 352

Query: 359 SSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSA 418
            SD   ++    LLG+   +F   I K +     E +    N NQA    +S+ + +Y  
Sbjct: 353 KSD---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYEH 409

Query: 419 LFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQ 478
           LF ++VD IN  L +  + +   ++IG+LDI GFE FE NSFEQ CINY NEKLQQ FN 
Sbjct: 410 LFGYIVDTINMSLNHGSMTA---NYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFNH 466

Query: 479 HVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSDETW 534
           H+F LEQ EY+KE I+W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D ++
Sbjct: 467 HMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSSF 526

Query: 535 TQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLK 594
             KL  T  +  T   F + +     FV+ HYA DV Y V G++ KN+D +++  + +L 
Sbjct: 527 YSKLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVNILS 583

Query: 595 ASTNETLLSILETLDKHAAKLAEKEQVNKKP--------GPARMVNRKPTLGSIFKQSLI 646
            S+N  +       +  ++  +   ++            G  R  N K  L S  ++   
Sbjct: 584 VSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGR-TNLKTAL-SRHREQQS 641

Query: 647 ELMGTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYN 706
            L+  +  TN H++RCI PN  K +  FD  ++L QLR  GVLE IRI+  G+P+R  + 
Sbjct: 642 SLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRILFK 701

Query: 707 EFVLRYHILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGML 766
           EF  RY IL  SEH  K  SSD    + +   + ++  +  D   Y++G +K+FFKAG L
Sbjct: 702 EFYERYRIL--SEHLDK--SSDAI--NYKQSSQILISELHLDPTTYKVGTSKLFFKAGTL 755

Query: 767 AYLE 770
           A LE
Sbjct: 756 AELE 759

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  452 bits (1162), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 277/748 (37%), Positives = 411/748 (54%), Gaps = 53/748 (7%)

Query: 47  IESETLDETKDDRLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIV 106
           I+  T D TK   +             DLT LS +++ A+   +K R+    IYTY G V
Sbjct: 21  IKKATFDATKKKEV----------GVSDLTLLSSISDDAINQNLKKRFENGTIYTYIGHV 70

Query: 107 LIATNPFDRVEQLYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGES 166
           LI+ NPF R   +Y+  ++++Y GK R E+ PH+FAIAE  Y  +K   +NQ +++SGES
Sbjct: 71  LISVNPF-RDLGIYTDAVLESYKGKNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGES 129

Query: 167 GAGKTVSAKYIMRYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNS 226
           GAGKT +AK IM+Y A+       ++ H   + + +  +LATNP++E+FG AKT RN+NS
Sbjct: 130 GAGKTEAAKRIMQYIAAA------SSTHEASIGKIKDMVLATNPLLESFGCAKTLRNNNS 183

Query: 227 SRFGKYLEILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQL 286
           SR GKYLEI F+++      +I  YLLE+ R+V Q ++ERN+HIFYQ   G ++  +   
Sbjct: 184 SRHGKYLEIRFNEQFEPCAGQITNYLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNF 243

Query: 287 KLTGVEDYHYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGN 346
            +   + Y Y +  G   +  IDD  +YQ T++A+ ++G+S++ Q Q+F++L+A+L IGN
Sbjct: 244 GVLQPDQYIYTSASGCTSVDTIDDLHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGN 303

Query: 347 VEIKKTRNDASLSSDEPNLAIACELLGIDSFNFAKWITKKQINT-----RSEKIVSNLNY 401
           V   +     +   D         L+ +DS    K + ++ + T     R       LN 
Sbjct: 304 VTFVENNEGNAEVRDTSVTDFVAYLMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNV 363

Query: 402 NQALVARDSVAKFIYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFE 461
            QA   RD++AK IY+ LF+W+VD +N  L        + S IG+LDIYGFE FE NSFE
Sbjct: 364 VQATAVRDALAKAIYNNLFDWIVDRVNVSL--KAFPGAVKS-IGILDIYGFEIFEHNSFE 420

Query: 462 QFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENK--LGILSL 519
           Q CINY NEKLQQ F Q   K EQEEY KE+I+W+ I++ DN+   DLIE+K   GI + 
Sbjct: 421 QICINYVNEKLQQIFIQLTLKSEQEEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFAT 480

Query: 520 LDEESRLPAGSDETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIE 579
           LD+             Q   Q L+   TN  F       +KFV+ HYA DV+YD+ G  +
Sbjct: 481 LDDSVATAHADSNAADQAFAQRLNLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTD 537

Query: 580 KNRDTVSDGHLEVLKASTNETLLSIL-ETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLG 638
           KN+D +     E+++ +TN  L +I  +T+DK + +                  R PT G
Sbjct: 538 KNKDQLVKDLAELVQTTTNPFLSTIFPDTIDKSSKR------------------RPPTAG 579

Query: 639 SIFKQSLIELMGTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAG 698
           +   +S  EL+ T++     YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AG
Sbjct: 580 NKIIKSANELVETLSKAQPSYIRTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAG 639

Query: 699 FPSRWTYNEFVLRYHILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTK 758
           F  R T+ +FV R+++L P   ++  +   T + D     + IL        +YQLG TK
Sbjct: 640 FAYRQTFEKFVERFYLLSPKCSYAGDY---TWQGDTLGAVKQILQDASIPTTEYQLGVTK 696

Query: 759 IFFKAG-MLAYLEKLRSDRLHNSSVLIQ 785
           +F K    L  LE +R    +N +  IQ
Sbjct: 697 VFIKTPETLFALEHMRDRYWYNMAARIQ 724

>Kwal_26.7587
          Length = 1250

 Score =  447 bits (1151), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 269/726 (37%), Positives = 401/726 (55%), Gaps = 47/726 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPF-RDLGIYTDSVLRSYVG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEE 190
           K R E+ PH+FAIAE  Y  MK   +NQ +++SGESGAGKT +AK IM+Y A+  +    
Sbjct: 96  KNRLEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASET--- 152

Query: 191 NAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGARIRT 250
              H+  + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       I  
Sbjct: 153 ---HSDSIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITN 209

Query: 251 YLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQGGEAQIKGIDD 310
           YLLE+ R+V Q K ERN+HIFYQ   G ++  +    +   E Y Y +  G   +  IDD
Sbjct: 210 YLLEKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDD 269

Query: 311 AEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSSDEPNLAIACE 370
             ++Q T+ A+S++GI++  Q ++F+ LAA+L IGN+   +     +   D         
Sbjct: 270 LSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDSFNFAKWITKKQINT-----RSEKIVSNLNYNQALVARDSVAKFIYSALFEWLVD 425
           LL +DS    + + ++ + T     R       LN  QA   +D++AK IY+ LF+W VD
Sbjct: 330 LLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWTVD 389

Query: 426 NINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L   +     N  IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 390 RVNLSL---QALPGANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 486 EEYVKEEIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDETWTQKLYQTLD 543
           EEY +E+IEW+ I++ DN+   DLIE +   GI++ +++         +   Q   Q L 
Sbjct: 447 EEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRL- 505

Query: 544 KPPTNTVFSKPRF--GQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNETL 601
               N   S P F    +KF++ HYA DV+YD+ G  +KN+D +    +E++K S+NE L
Sbjct: 506 ----NLFSSNPHFELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFL 561

Query: 602 LSILET-LDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYI 660
            S+  T +DK++ +                  R P+ G    +S  EL+ T++     YI
Sbjct: 562 CSLFPTVVDKNSKR------------------RPPSAGDKIIKSANELVETLSKAQPSYI 603

Query: 661 RCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEH 720
           R IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  +++FV R+++L P   
Sbjct: 604 RTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPQCS 663

Query: 721 WSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAG-MLAYLEKLRSDRLHN 779
           ++  +   T + D  +  + IL        +YQLG +K+F K    L  LE +R    HN
Sbjct: 664 YAGDY---TWQGDTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALETMRDKYWHN 720

Query: 780 SSVLIQ 785
            +  IQ
Sbjct: 721 MAARIQ 726

>Scas_721.119
          Length = 1232

 Score =  445 bits (1144), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 279/753 (37%), Positives = 403/753 (53%), Gaps = 59/753 (7%)

Query: 45  VEIESETLDETKDDRLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSG 104
            +I+  T D TK   +             DLT LS +++  +   +K R+    IYTY G
Sbjct: 21  AKIKKATFDATKKKEV----------GVSDLTLLSKISDETINDNLKKRFMNGTIYTYIG 70

Query: 105 IVLIATNPFDRVEQLYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSG 164
            VLI+ NPF R   +Y+  ++++Y GK R E+ PH+FAIAE  Y  MK+  +NQ +++SG
Sbjct: 71  HVLISVNPF-RDLGIYTDAIVESYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISG 129

Query: 165 ESGAGKTVSAKYIMRYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRND 224
           ESGAGKT +AK IM+Y AS    + E+      + + +  +LATNP++E+FG AKT RN+
Sbjct: 130 ESGAGKTEAAKRIMQYIASASTTHSES------IGKIKDMVLATNPLLESFGCAKTLRNN 183

Query: 225 NSSRFGKYLEILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKS 284
           NSSR GKYLEI F+ +       I  YLLE+ R+V Q K+ERN+HIFYQ   G ++  + 
Sbjct: 184 NSSRHGKYLEIRFNSQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQ 243

Query: 285 QLKLTGVEDYHYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHI 344
              +   E Y Y +  G   +  IDD  +Y+ T++A+ ++G+ ++ Q Q+F++LAA+L I
Sbjct: 244 TFGVQKPEQYIYTSASGCTSVDTIDDVNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWI 303

Query: 345 GNVEIKKTRNDASLSSDEPNLAIACELLGIDSFNFAKWITKKQINT-----RSEKIVSNL 399
           GNV   +     +   D         LL ID+    K + ++ + T     R       L
Sbjct: 304 GNVSFVENEEGNAQVRDTSVTDFVAYLLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPL 363

Query: 400 NYNQALVARDSVAKFIYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNS 459
           N  QA   RD++AK IY+ LFEW+V  +N  L   +     +  IG+LDIYGFE FE NS
Sbjct: 364 NIVQATAVRDALAKAIYNNLFEWIVGRVNVSL---QAYPGADRSIGILDIYGFEIFEHNS 420

Query: 460 FEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENK--LGIL 517
           FEQ CINY NEKLQQ F Q   K EQE Y +E+I+W+ I++ DN+   DLIE K   GI 
Sbjct: 421 FEQICINYVNEKLQQIFIQLTLKSEQETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIF 480

Query: 518 SLLDEESRLPAGSDETWTQKLYQTLDKPPTNTVFSKPRF--GQTKFVVSHYALDVSYDVE 575
           + +++             Q   Q L     N   S P F     KFV+ HYA DV+YDV 
Sbjct: 481 AAMNDSVATAHADSNAADQAFAQRL-----NMFSSNPHFELRSNKFVIKHYAGDVTYDVN 535

Query: 576 GFIEKNRDTVSDGHLEVLKASTNETLLSILET-LDKHAAKLAEKEQVNKKPGPARMVNRK 634
           G  +KN+D +    +E++  +TN  L  I    +DK + +                  R 
Sbjct: 536 GITDKNKDQLQKDLVELIATTTNPFLSGIFPVEVDKESKR------------------RP 577

Query: 635 PTLGSIFKQSLIELMGTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRI 694
           PT G    +S  EL+ T++     YIR IKPN+ K    +D+  VL Q++  G+ E +RI
Sbjct: 578 PTAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRI 637

Query: 695 SCAGFPSRWTYNEFVLRYHILIPSEHWSKMFSSDTT-EEDIRDLCRTILGAIVEDKQKYQ 753
             AGF  R T+ +FV R+++L P  H S  ++ D T + +  D  + IL        +YQ
Sbjct: 638 RRAGFAYRQTFEKFVERFYLLSP--HCS--YAGDYTWQGETLDAVQHILNDASIPASEYQ 693

Query: 754 LGNTKIFFKAG-MLAYLEKLRSDRLHNSSVLIQ 785
           LG T +F K    L  LE +R    HN +  IQ
Sbjct: 694 LGTTSVFIKTPETLFALEHMRDRYWHNMAARIQ 726

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  443 bits (1139), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 273/725 (37%), Positives = 398/725 (54%), Gaps = 45/725 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++  Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPF-RDLGIYTDAVMNEYKG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEE 190
           K R E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAA------ 149

Query: 191 NAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGARIRT 250
           ++ H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       I  
Sbjct: 150 SSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITN 209

Query: 251 YLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQGGEAQIKGIDD 310
           YLLE+ R+V Q K+ERN+HIFYQ   G ++  +    +   E Y Y    G    + IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDD 269

Query: 311 AEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSSDEPNLAIACE 370
            ++YQ T++A+ ++G+ ++ Q Q+F++LAA+L IGNV   +     +   D         
Sbjct: 270 LQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDSFNFAKWITKKQINT-----RSEKIVSNLNYNQALVARDSVAKFIYSALFEWLVD 425
           LL IDS    K + ++ + T     R       LN  QA   RD++AK IY+ LF+W+V 
Sbjct: 330 LLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVS 389

Query: 426 NINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L   +        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 390 RVNKSL---QAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 486 EEYVKEEIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDETWTQKLYQTLD 543
           E Y +E+I+W+ I++ DN+   DLIE +   GI + +++             Q   Q L+
Sbjct: 447 ETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLN 506

Query: 544 KPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNETLLS 603
              TN  F        KFV+ HYA DV+YD++G  +KN+D +    +E++  +TN  L +
Sbjct: 507 LFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLAT 563

Query: 604 IL-ETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYIRC 662
           I  +T+D+ + +                  R PT G    +S  +L+ T++     YIR 
Sbjct: 564 IFPDTVDRESKR------------------RPPTAGDKIIKSANDLVETLSKAQPSYIRT 605

Query: 663 IKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEHWS 722
           IKPNE K    +D+  VL Q++  G+ E +RI  AGF  R  + +FV R+++L P  H S
Sbjct: 606 IKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSP--HCS 663

Query: 723 KMFSSDTT-EEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAG-MLAYLEKLRSDRLHNS 780
             ++ D T + D  D  + IL      +Q+YQLG T +F K    L  LE +R    HN 
Sbjct: 664 --YAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNM 721

Query: 781 SVLIQ 785
           +  IQ
Sbjct: 722 AARIQ 726

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  436 bits (1120), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 268/723 (37%), Positives = 393/723 (54%), Gaps = 41/723 (5%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 130
              DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+ D +++Y G
Sbjct: 37  GVSDLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPF-RDLGIYTDDTMKSYQG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEE 190
           K R E  PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAT------ 149

Query: 191 NAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGARIRT 250
           ++ H+  +S+ +  +LATNP++E+FG AKT RN+NSSR GKYLEI FD         I  
Sbjct: 150 SSTHSESISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITN 209

Query: 251 YLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQGGEAQIKGIDD 310
           YLLE+ R+V Q K+ERN+HIFYQ   G   E +    +   E Y Y +      ++ +DD
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDD 269

Query: 311 AEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSSDEPNLAIACE 370
            EE+  T+ A+  +G++K  Q Q+F+ LAA+L IGN+   +     +   D+        
Sbjct: 270 VEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAY 329

Query: 371 LLGIDSFNFAKWITKKQINT-----RSEKIVSNLNYNQALVARDSVAKFIYSALFEWLVD 425
           LL +      K + ++ I T     R     S LN  QA   RD++AK IY+ LFEW+V+
Sbjct: 330 LLEVQEELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVE 389

Query: 426 NINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L   +     +  IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 390 RVNNSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 486 EEYVKEEIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDETWTQKLYQTLD 543
           + Y KE+I W+ IE+ DN+   DLIE K   GI + +++         +   Q   Q L+
Sbjct: 447 DTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRLN 506

Query: 544 KPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNETLLS 603
              TN  F      Q KFVV HYA DV+YD+ G  +KN+D +    +E+L  ++N  +  
Sbjct: 507 LFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVRE 563

Query: 604 ILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYIRCI 663
           I            ++ Q + +        R PT G    +S  EL+ T++     YIR I
Sbjct: 564 I----------FPDQPQTDSR-------RRPPTSGDKIIKSANELVETLSKAQPSYIRTI 606

Query: 664 KPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEHWSK 723
           KPN+ K + ++D+  VL Q++  G+ E +RI  AGF  R  + +FV R+++L P   ++ 
Sbjct: 607 KPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQCSYAG 666

Query: 724 MFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFK-AGMLAYLEKLRSDRLHNSSV 782
            +  D    +  D  + IL        +Y++G T+IF K    L  LE +R    +N + 
Sbjct: 667 DYVWDG---ETLDAVKLILQDASIPTTEYEIGVTQIFIKHPETLFALENMRDKYWYNMAA 723

Query: 783 LIQ 785
            IQ
Sbjct: 724 RIQ 726

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  434 bits (1115), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 263/724 (36%), Positives = 400/724 (55%), Gaps = 43/724 (5%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 130
              DLT L+ +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 38  GVSDLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPF-RDLGIYTDAIMKSYQG 96

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEE 190
           K R E+ PH++AI+E  Y  +K   +NQ +++SGESGAGKT +AK IM Y A+       
Sbjct: 97  KNRLEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAAT------ 150

Query: 191 NAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGARIRT 250
           ++ H+  + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       I  
Sbjct: 151 SSTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 210

Query: 251 YLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQGGEAQIKGIDD 310
           YLLE+ R+V Q  +ERN+HIFYQ   G ++  +    +   E Y Y +      +  IDD
Sbjct: 211 YLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDD 270

Query: 311 AEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSSDEPNLAIACE 370
            ++++ T++A+ ++G++++ Q Q+F++LAA+L IGN+   +     +   D         
Sbjct: 271 VKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAY 330

Query: 371 LLGIDSFNFAKWITKKQINT-----RSEKIVSNLNYNQALVARDSVAKFIYSALFEWLVD 425
           LL +DS +  K + ++ + T     R       LN  QA   RD++AK IY+ LFEW+VD
Sbjct: 331 LLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVD 390

Query: 426 NINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L         +  IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 391 RVNKSL---HAYPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 447

Query: 486 EEYVKEEIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDETWTQKLYQTLD 543
           + Y +E+I+W+ I++ DN+   DLIE K   GI + +++             Q   Q L 
Sbjct: 448 DTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRLS 507

Query: 544 KPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNETLLS 603
              +N  F +    Q KFV+ HYA DV+YDV G  +KN+D +    +E++  +TN  L +
Sbjct: 508 LFSSNPHFEQ---RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLTT 564

Query: 604 ILET-LDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNVHYIRC 662
           +    +DK           NK+        R PT G    +S  EL+ T++     YIR 
Sbjct: 565 LFPNQVDKD----------NKR--------RPPTAGDKIIKSANELVETLSKAQPSYIRT 606

Query: 663 IKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSEHWS 722
           IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  + +FV R+++L P   ++
Sbjct: 607 IKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLSPRCSYA 666

Query: 723 KMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAG-MLAYLEKLRSDRLHNSS 781
             +   T   DI +  R IL   +  +++YQLG T++F K    L  LE +R    HN +
Sbjct: 667 GDY---TWTGDILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENMRDKFWHNMA 723

Query: 782 VLIQ 785
             IQ
Sbjct: 724 ARIQ 727

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  427 bits (1098), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 283/820 (34%), Positives = 427/820 (52%), Gaps = 85/820 (10%)

Query: 56  KDDRLPLLRNPPILEAT-----------EDLTSLSYLNEPAVLHAIKARYAQLNIYTYSG 104
           KD + P  R+  I +AT            DLT LS +++ ++   +K R+    IYTY G
Sbjct: 11  KDVKEPKKRSAKIKKATFDANKKKEVGISDLTLLSKISDESINENLKKRFKNGIIYTYIG 70

Query: 105 IVLIATNPFDRVEQLYSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSG 164
            VLI+ NPF R   +Y+  ++++Y GK R E+ PH+FAIAE  Y  +K+  +NQ +++SG
Sbjct: 71  HVLISVNPF-RDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISG 129

Query: 165 ESGAGKTVSAKYIMRYFASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRND 224
           ESGAGKT +AK IM+Y A+   +      H+  + + +  +LATNP++E+FG AKT RN+
Sbjct: 130 ESGAGKTEAAKRIMQYIAAASNS------HSESIGKIKDMVLATNPLLESFGCAKTLRNN 183

Query: 225 NSSRFGKYLEILFDKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKS 284
           NSSR GKYLEI F+ +       I  YLLE+ R+V Q K+ERN+HIFYQ   G ++  K 
Sbjct: 184 NSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQ 243

Query: 285 QLKLTGVEDYHYMNQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHI 344
              +   E Y Y    G      +   ++Y+ T+EA+  +G+ ++ Q Q+F++LAA+L I
Sbjct: 244 MFGVQMPEQYIYTAAAGCTSADQL-MRKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWI 302

Query: 345 GNVEIKKTRNDASLSSDEPNLAIACELLGIDSFNFAKWITKKQINT-----RSEKIVSNL 399
           GN+   +     +   D         LL +D+    K + ++ + T     R       L
Sbjct: 303 GNISFIENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPL 362

Query: 400 NYNQALVARDSVAKFIYSALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNS 459
           N  QA   RD++AK IY+ LF+W+VD +N  L   +     +  IG+LDIYGFE FE NS
Sbjct: 363 NPVQATAVRDALAKAIYNNLFDWIVDRVNVSL---QAFPGADKSIGILDIYGFEIFEHNS 419

Query: 460 FEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIE--NKLGIL 517
           FEQ CINY NEKLQQ F Q   K EQE Y +E+I+W+ I++ DN+   DLIE  N  GIL
Sbjct: 420 FEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGIL 479

Query: 518 SLLDEESRLPAGSDETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGF 577
           + +++             Q   Q L+   +N  F        KFV+ HYA DV+YD+ G 
Sbjct: 480 AAMNDSIATAHADSNAADQAFAQRLNLFNSNPYF---ELRANKFVIKHYAGDVTYDINGI 536

Query: 578 IEKNRDTVSDGHLEVLKASTNETLLSIL-ETLDKHAAKLAEKEQVNKKPGPARMVNRKPT 636
            +KN+D +    +E++  +TN  L +I  + +DK + +                  R PT
Sbjct: 537 TDKNKDQLQKDLIELIGTTTNTFLSTIFPDDVDKDSKR------------------RPPT 578

Query: 637 LGSIFKQSLIELMGTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISC 696
            G    +S  EL+ T++     YIR IKPN+ K    +D+  VL Q++  G+ E +RI  
Sbjct: 579 AGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRR 638

Query: 697 AGFPSRWTYNEFVLRYHILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGN 756
           AGF  R T+ +FV R+++L P   ++  ++ D    D  +  + IL   +  ++++QLG 
Sbjct: 639 AGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDG---DTLEAVKLILRDAMIPEKEFQLGV 695

Query: 757 TKIFFKAG-MLAYLEKLRSDRLHNSSVLIQXXXXXXXXXXXXLAIISSIRNFHSRSEGFL 815
           T +F K    L  LE +R    +N +  IQ                 + R F        
Sbjct: 696 TSVFIKTPESLFALEDMRDKYWYNMAARIQR----------------AWRRF-------- 731

Query: 816 TRQKVDLEFKTQAAILIQSMVRSTSTRNKTISLLSAITRL 855
                 L+ +  AAI IQ  +R     NK + L    T+L
Sbjct: 732 ------LQRRIDAAIKIQRTIREKKGGNKYVKLRDYGTKL 765

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  426 bits (1094), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 271/734 (36%), Positives = 399/734 (54%), Gaps = 63/734 (8%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 130
              DLT LS +++  +   +K R+   +IYTY G VLI+ NPF R   +Y+  +++ Y G
Sbjct: 36  GVSDLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPF-RDLGIYTDQVLETYKG 94

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEE 190
           + R E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+   ++E 
Sbjct: 95  RNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEA 154

Query: 191 NAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKEISIIGARIRT 250
                  +   +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +      +I  
Sbjct: 155 ------SIGRIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITN 208

Query: 251 YLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQGGEAQIKGIDD 310
           YLLE+ R+V Q K+ERN+HIFYQ   G ++  +    +   E Y Y +  G   +  IDD
Sbjct: 209 YLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDD 268

Query: 311 AEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSSDEPNLAIA-- 368
             +Y+ T+EA++++G+S+  Q ++F++L+A+L IGNV          +  DE N  IA  
Sbjct: 269 LNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTF--------MEDDEGNAKIADT 320

Query: 369 ------CELLGIDSFNFAKWITKKQINT-----RSEKIVSNLNYNQALVARDSVAKFIYS 417
                   LL +D+    K + ++ I T     R       LN  QA   RD++AK IY+
Sbjct: 321 SITDFVAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYN 380

Query: 418 ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            LFEW+VD +N  L   +        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F 
Sbjct: 381 NLFEWIVDRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFI 437

Query: 478 QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDETWT 535
           Q   K EQEEY KE+I+W+ I++ DN+   +LIE K   GI + L++             
Sbjct: 438 QLTLKSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAAD 497

Query: 536 QKLYQTLDKPPTNTVFSKPRF--GQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVL 593
           Q   Q L     N   S P F    +KFV+ HYA DV+YD+ G  +KN+D +    +E+L
Sbjct: 498 QAFAQRL-----NLFTSNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELL 552

Query: 594 KASTNETLLSIL-ETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTI 652
            +++N  L +I  +T DK + ++                    T G    +S  EL+ T+
Sbjct: 553 NSTSNTFLATIFPDTGDKDSKRIPS------------------TAGDKIIRSANELVDTL 594

Query: 653 NSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 712
           +     YIR IKPN+ K    +D+  VL Q++  G+ E +RI  A +  R  +++FV R+
Sbjct: 595 SKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERF 654

Query: 713 HILIPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAG-MLAYLEK 771
           ++L P   ++  +   T + +  D    IL        +YQLG TK+F K    L  LE 
Sbjct: 655 YLLSPQCSYAGDY---TWQGNTLDAVNLILRDTSIPVTEYQLGVTKVFIKTPETLFALEN 711

Query: 772 LRSDRLHNSSVLIQ 785
           +R    HN +  IQ
Sbjct: 712 MRDKYWHNMASRIQ 725

>CAGL0F01331g complement(136707..138878) similar to sp|P32606
           Saccharomyces cerevisiae YOR017w PET127, hypothetical
           start
          Length = 723

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 15  QQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETL--DETKDDRLPLLRNPPILEAT 72
           QQG +  +       + KH   +    N I +I  ET+  DE KD +LP  R P +    
Sbjct: 69  QQGILPSQTQSINTWNKKHDQRIDFRLN-ISDINHETVRTDEFKDSKLPFKRPPSLGHGL 127

Query: 73  EDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIV 106
           +     S L++P  LH++  R ++  IY YS I+
Sbjct: 128 K-----SVLHQPVSLHSL--RDSRTGIYNYSKIL 154

>Kwal_55.22033
          Length = 488

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 92  ARYAQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAGKRRGEL--EPHLFAIAE---- 145
           A Y +   ++  G   +    F  VE LYS+ MI  ++G    E   EP+ + + E    
Sbjct: 258 AEYTKPVFFSEFGCNKVTPRSFGEVEALYSKSMINTFSGGLVYEFTQEPNQYGLVEIKSD 317

Query: 146 EAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEENAHHNLEMSETEKKI 205
            +  ++ + K  Q+   + ES   KT+    +    AS    N E  + NLE++ T  + 
Sbjct: 318 GSAHMLSDFKALQSRYAAIESSEYKTIRNNAV-SLMASAPFPNCEKDYENLEVTATIPQN 376

Query: 206 LA 207
           LA
Sbjct: 377 LA 378

>Kwal_56.23638
          Length = 4922

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 155  KQNQTIVVSGESGAGKTVSAKYIMRYFASVEQNNEENAHHNLEMSE 200
            + N+ I++ GE+G GKT   + I RY+    +    NAH N E  +
Sbjct: 1361 QNNEPILLVGETGCGKTTVCQLIARYYG--HRLVTINAHQNTETGD 1404

>CAGL0F08327g complement(829426..832404) similar to sp|P07276
            Saccharomyces cerevisiae YGR258c RAD2 structure-specific
            nuclease of the nucleotide excision repairosome, start by
            similarity
          Length = 992

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query: 1111 LNVISMNNGG---IEDDARSTASALSQINDELYKLL--EDTKSLNTEIVEGLLKGFKI-- 1163
            +NV  MN+GG   +ED+  +  S LS   D+ YKL+  E+  SL    V+G      I  
Sbjct: 259  INVTGMNDGGASKLEDEDSNGGSRLSSTKDKEYKLVKTENGWSLGFGDVDGSEANKAILL 318

Query: 1164 --PETGVAVELTR 1174
              PE  VA+++ +
Sbjct: 319  DDPEHSVAIKMEK 331

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
           of the abundant RSC chromatin remodeling complex [2658
           bp, 885 aa]
          Length = 885

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 60  LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQ 96
           +P L + P+  A E  T L+++  PA+ H + + Y Q
Sbjct: 138 VPSLESKPVTSANESSTPLNWVQGPAIFHMLTSPYTQ 174

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,218,701
Number of extensions: 1802707
Number of successful extensions: 8343
Number of sequences better than 10.0: 104
Number of HSP's gapped: 8369
Number of HSP's successfully gapped: 122
Length of query: 1350
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1236
Effective length of database: 12,649,657
Effective search space: 15634976052
Effective search space used: 15634976052
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)