Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2164.446546520360.0
KLLA0A03938g4201572293e-20
YAL028W5281421932e-15
Kwal_26.70633781681832e-14
Scas_592.145491371824e-14
CAGL0G06314g6531341673e-12
Scas_663.275591351485e-10
YOR324C6021341477e-10
AER074W643111730.63
YLR424W708139720.89
KLLA0B01804g324266702.0
Sklu_2438.530530673.2
CAGL0M13233g110738674.0
CAGL0G02959g918149656.5
Scas_703.23134137648.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2164.4
         (465 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement        788   0.0  
KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...    93   3e-20
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...    79   2e-15
Kwal_26.7063                                                           75   2e-14
Scas_592.14                                                            75   4e-14
CAGL0G06314g complement(603668..605629) some similarities with s...    69   3e-12
Scas_663.27                                                            62   5e-10
YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protei...    61   7e-10
AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH] complement(...    33   0.63 
YLR424W (YLR424W) [3800] chr12 (973391..975517) Protein containi...    32   0.89 
KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyce...    32   2.0  
Sklu_2438.5 YER083C, Contig c2438 11801-12718 reverse complement       30   3.2  
CAGL0M13233g complement(1299424..1302747) similar to sp|P35724 S...    30   4.0  
CAGL0G02959g 272520..275276 similar to sp|P53253 Saccharomyces c...    30   6.5  
Scas_703.23                                                            29   8.2  

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/465 (85%), Positives = 397/465 (85%)

Query: 1   MISIDRKQRALFPQLYENNRGIHHNRVLQPPMMTSCGTVPSFSLNDVPMGPLGKSSFSGT 60
           MISIDRKQRALFPQLYENNRGIHHNRVLQPPMMTSCGTVPSFSLNDVPMGPLGKSSFSGT
Sbjct: 1   MISIDRKQRALFPQLYENNRGIHHNRVLQPPMMTSCGTVPSFSLNDVPMGPLGKSSFSGT 60

Query: 61  GNSISKPRQSDTPDYTSASTGKFSDCIFHLPDXXXXXXXXXXXXXXXXXXXXXXXXXXXI 120
           GNSISKPRQSDTPDYTSASTGKFSDCIFHLPD                           I
Sbjct: 61  GNSISKPRQSDTPDYTSASTGKFSDCIFHLPDSTSSPRGSTSSSSSFSSSSSSSSSSSSI 120

Query: 121 PFASTVSVGFATTEVPRAVRRKSDLAMGSSPLKAQPSTRARSSSHLLPAPSTISQSAPYN 180
           PFASTVSVGFATTEVPRAVRRKSDLAMGSSPLKAQPSTRARSSSHLLPAPSTISQSAPYN
Sbjct: 121 PFASTVSVGFATTEVPRAVRRKSDLAMGSSPLKAQPSTRARSSSHLLPAPSTISQSAPYN 180

Query: 181 KSFTLSSSALPIRHKKNLSTASAIELTAQNGKRLVHQFLKDPSQKDGELEKEGLFKDGXX 240
           KSFTLSSSALPIRHKKNLSTASAIELTAQNGKRLVHQFLKDPSQKDGELEKEGLFKDG  
Sbjct: 181 KSFTLSSSALPIRHKKNLSTASAIELTAQNGKRLVHQFLKDPSQKDGELEKEGLFKDGLL 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXVFYYDLKRTLTSVSTTSVNEPLCEKTPDYNIVDYKEYIV 300
                                VFYYDLKRTLTSVSTTSVNEPLCEKTPDYNIVDYKEYIV
Sbjct: 241 IRPLTRSSSSLSSPMRNSLPRVFYYDLKRTLTSVSTTSVNEPLCEKTPDYNIVDYKEYIV 300

Query: 301 NEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVKENYLVE 360
           NEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVKENYLVE
Sbjct: 301 NEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVKENYLVE 360

Query: 361 LETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMESIVKLKQ 420
           LETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMESIVKLKQ
Sbjct: 361 LETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMESIVKLKQ 420

Query: 421 LVADSKKNMTFSDRLKEYKGXXXXXXXXXXXXXXXXXXRRYFSKS 465
           LVADSKKNMTFSDRLKEYKG                  RRYFSKS
Sbjct: 421 LVADSKKNMTFSDRLKEYKGILWDFLAIIIIAILIWILRRYFSKS 465

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 92/157 (58%)

Query: 284 CEKTPDYNIVDYKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIR 343
           C+  P+Y  +DY ++I  ++   E  +K+ +  V+  +E     +   +S L K + ++ 
Sbjct: 238 CKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLH 297

Query: 344 TRIVELHYEVKENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLA 403
             I ++ ++ K+ YL +L   FN +DSESF+S+L  ++  H+S L+ LE +  + ++ L 
Sbjct: 298 MDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELE 357

Query: 404 RQKNALEDMESIVKLKQLVADSKKNMTFSDRLKEYKG 440
            +K  L  +E+++KL  ++ D K+NM  S++LKEY G
Sbjct: 358 AKKLQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYG 394

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 85/142 (59%)

Query: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354
           Y+ +I  ++ + E+++K+++ D +   E  +  +      + KELR +R+R +     V+
Sbjct: 361 YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE 420

Query: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414
           E+YL+ L+  F+  + ESF ++L + I  +++ L+ LE R+ + KD LA +K  +  MES
Sbjct: 421 EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKMES 480

Query: 415 IVKLKQLVADSKKNMTFSDRLK 436
           ++ L+  +  SKKN+TF+ + +
Sbjct: 481 LLSLENSLMISKKNVTFASKYR 502

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (87%)

Query: 73  PDYTSASTGKFSDCIF 88
           PDYTSAST  FSDC+F
Sbjct: 93  PDYTSASTAMFSDCMF 108

>Kwal_26.7063
          Length = 378

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 1/168 (0%)

Query: 296 KEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVKE 355
           ++Y  NE+ KF+  I++ +  +    E  +  +   L  L++ +R  ++ I ++   +++
Sbjct: 208 QQYFANELSKFDHYIRDLMASI-SSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQD 266

Query: 356 NYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMESI 415
             +  L   F + D  SFIS+    I  +  SL   E RI   K  L  QK  +  +E+ 
Sbjct: 267 QDIKMLRKSFESEDESSFISRFSAAIATYSESLASFEKRIGKCKVDLTTQKATVHKLETT 326

Query: 416 VKLKQLVADSKKNMTFSDRLKEYKGXXXXXXXXXXXXXXXXXXRRYFS 463
           +KL +++ DS+ NM F DR++EYKG                  +RYF+
Sbjct: 327 IKLNEMIQDSQSNMCFLDRIREYKGLIYDFCALILLIALIVVLKRYFA 374

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 24 HNRVLQPPMMTSCGTVPSFSLNDVPMGPLGKSSFSGTGNSISKPRQSDTPDYTSASTGKF 83
          +N+ ++ P+      VPS S ND+P      S      N++++       DYTSAS GKF
Sbjct: 13 YNQDIRRPL----ARVPSISNNDLPRHSF-HSRCEVERNAMTQH------DYTSASAGKF 61

Query: 84 SDCIF 88
          S+C+F
Sbjct: 62 SECLF 66

>Scas_592.14
          Length = 549

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 83/137 (60%)

Query: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354
           Y+ +I   + K E+++K  + D++  +E  + ++ Q   T   +L++++ +I+ L   V+
Sbjct: 383 YQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISLQKLVR 442

Query: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414
            +YLV L+  F+  +  SF + L EI+ ++++ L+ LE R+++S + L  QK  ++ ME+
Sbjct: 443 NDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETMKRMEN 502

Query: 415 IVKLKQLVADSKKNMTF 431
           ++ L+  +  S+KN ++
Sbjct: 503 LINLENSLKLSQKNASW 519

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 59  GTGNSISKPRQSDTPDYTSASTGKFSDCIFH 89
             G+  S   +S  PDYTSA+TG FSD IF+
Sbjct: 114 ANGHRESATLRSGKPDYTSANTGMFSDHIFN 144

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 76/134 (56%)

Query: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354
           Y+++I + + K ES IKN +  V+   E  ++++  +   L  +L+ ++++I+ L   + 
Sbjct: 486 YQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGLKNTIA 545

Query: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414
             YL  L+  F+  + ESF SQL + ++E++  LE LE ++   +  L  QK  +  MES
Sbjct: 546 NEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETMRKMES 605

Query: 415 IVKLKQLVADSKKN 428
           ++ L+  +  SKKN
Sbjct: 606 LLYLENSLMVSKKN 619

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 15/17 (88%)

Query: 73  PDYTSASTGKFSDCIFH 89
           PDYTS +TG FS+C+F+
Sbjct: 208 PDYTSVNTGAFSECMFN 224

>Scas_663.27
          Length = 559

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 72/135 (53%)

Query: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354
           Y+ +I N + +FE ++K  +   +   E  +  +      L   L+ ++ RI EL+  + 
Sbjct: 391 YQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDELYDVIN 450

Query: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414
           E YL +++T FN  D  SF  +L   ++  +  LE+LE R++  +  L  Q+  +  +++
Sbjct: 451 EKYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQLKLQEQRETMRQLDN 510

Query: 415 IVKLKQLVADSKKNM 429
           ++ ++  + +SKKN+
Sbjct: 511 LILIENSLLESKKNV 525

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 15/17 (88%)

Query: 73  PDYTSASTGKFSDCIFH 89
           PDY++AS G FSDCIF+
Sbjct: 117 PDYSAASLGTFSDCIFN 133

>YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protein
           of the endoplasmic reticulum membrane [1809 bp, 602 aa]
          Length = 602

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 78/134 (58%)

Query: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354
           Y+ +I   + K E+ ++  + D +   E  ++ + Q    L  EL  +   +  L   V 
Sbjct: 432 YQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLLDEMTTLRTTVI 491

Query: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414
             +LV+L++ F+  D+++FI++L   ++E ++ L+ LE R++  ++ L +QK++L +M+S
Sbjct: 492 NQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLREMDS 551

Query: 415 IVKLKQLVADSKKN 428
           +++LK ++  SK N
Sbjct: 552 LIELKNVLNKSKNN 565

>AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH]
           complement(775019..776950) [1932 bp, 643 aa]
          Length = 643

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 25/111 (22%)

Query: 333 STLEKELRRIRTRIVELHYEVKENYLVEL-ETHFN-----ATDSESFISQL-------DE 379
           S L  +L+ +R+++ +L +E KE  L +L E +       + D E F ++L        E
Sbjct: 263 SNLSADLQVLRSKVEKLSHENKE--LAQLNEAYLGKFQQLSADREIFNNRLSAEFQTAQE 320

Query: 380 IIQEHLSSLEKLEVRIKNSKD-------VLARQK---NALEDMESIVKLKQ 420
            +++H S+LEK  VRI+ ++D       VL  QK   + LED+E ++ L+Q
Sbjct: 321 TLKKHNSNLEKDLVRIRTARDELLSKVAVLEAQKSKSDMLEDLEKMLALQQ 371

>YLR424W (YLR424W) [3800] chr12 (973391..975517) Protein containing
           one G-patch domain, which are found in RNA processing
           proteins [2127 bp, 708 aa]
          Length = 708

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 62/139 (44%), Gaps = 28/139 (20%)

Query: 297 EYIVNEIDKFESI---IKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEV 353
           E I+ E+D   ++    K+ V ++L           Q L  +EK L  IR R   L  +V
Sbjct: 174 ESILKELDPLNAVPKPKKDVVVEIL-----------QELLGIEKSLEAIRQRTSPLEVQV 222

Query: 354 KENY-----LVELET-------HFNATDSESFISQL--DEIIQEHLSSLEKLEVRIKNSK 399
           KE Y     L ELE        H +  D    I +L  DE+I    S L + E+ I+   
Sbjct: 223 KEYYGQERLLSELEVTLRDESKHVSLYDKIGAILKLSDDELIDRLTSCLLRKELLIEFDL 282

Query: 400 DVLARQKNALEDMESIVKL 418
           D L +  + L+++  I++L
Sbjct: 283 DHLEKPNDILDELTQIIEL 301

>KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyces
            cerevisiae YDR457w TOM1 E3 ubiqitin ligase required for
            G2/M transition, start by similarity
          Length = 3242

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 18   NNRGIHHNRVLQPPMMTSCGTVPSFSLNDVPMGPLGKSSFSGTGNSISKPRQSDTPD--Y 75
            N RG HHNR    P + S G     S N +   PLG        + I+  +  DTP   +
Sbjct: 2118 NRRGRHHNRTAIAPSIISLGGESDRSRN-MLTNPLGPHGMEEVEDIITNNQLEDTPARRF 2176

Query: 76   TSASTG 81
             S  TG
Sbjct: 2177 GSGITG 2182

>Sklu_2438.5 YER083C, Contig c2438 11801-12718 reverse complement
          Length = 305

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 282 PLCEKTPDYNIVDYKEYIVNEIDKFESIIK 311
           P  +KTPD  +V Y EY VN +  +  +IK
Sbjct: 152 PQQQKTPDNTMVSYHEYKVNRLKAWNILIK 181

>CAGL0M13233g complement(1299424..1302747) similar to sp|P35724
           Saccharomyces cerevisiae YKL064w MNR2, hypothetical
           start
          Length = 1107

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 140 RRKSDLAMGSSPLKAQPSTRARSSSHLLPAPSTISQSA 177
           R  S+ +  ++PL  + +T + S+SHL+  PS +S SA
Sbjct: 552 RGSSNFSGANTPLNTKANTPSHSNSHLIKNPSNMSNSA 589

>CAGL0G02959g 272520..275276 similar to sp|P53253 Saccharomyces
           cerevisiae YGR089w, hypothetical start
          Length = 918

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 32/149 (21%)

Query: 302 EIDKFESIIKNTVTD-------VLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354
           EID F S I+N  T+       V  +K   ++ S  T+   E+EL+++     E   EV+
Sbjct: 742 EIDHFRSKIENNATNEEKNASKVESLKIA-LQQSNSTILAWEEELKQLS----EKQIEVE 796

Query: 355 ENYLVELETHF---------------NATDSESFISQLDEIIQEHLSSLEKLEVRIKNSK 399
           E YL++ + H                     +  + +L E +Q+    LEKL  R     
Sbjct: 797 EKYLIQKDLHLRKQLEFSKEEEKLKALVKVKKENVERLQEEVQQLTGKLEKLNARNSKVS 856

Query: 400 DVLARQKNALEDMESIVKLKQLVADSKKN 428
             + +Q  A++D      + QL    +KN
Sbjct: 857 KEVEQQNKAIDDF-----INQLAKAIEKN 880

>Scas_703.23
          Length = 1341

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 128 VGFATTEVPRAVRRKSDLAMGSSPLKAQPSTRARSSS 164
           +GF  T +P      + L + S+PL  QPS  A  SS
Sbjct: 590 IGFINTPIPSQQHTLTPLPLTSNPLSRQPSNSANHSS 626

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,907,784
Number of extensions: 521464
Number of successful extensions: 2647
Number of sequences better than 10.0: 138
Number of HSP's gapped: 2615
Number of HSP's successfully gapped: 170
Length of query: 465
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 360
Effective length of database: 12,961,219
Effective search space: 4666038840
Effective search space used: 4666038840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)