Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2164.250850826850.0
YOR323C (PRO2)45645519640.0
Scas_663.345745019520.0
Kwal_26.706745745719470.0
KLLA0A03982g44745518540.0
CAGL0F00693g45545518260.0
ADR351C45245117300.0
Scas_717.74522141810.076
Sklu_2412.499650780.22
Sklu_1149.2296137760.25
Kwal_26.7725295228740.47
AGL119C45971701.6
YGL157W34751665.1
Sklu_1839.246871665.6
YBR238C73147657.6
Sklu_1367.264447648.5
CAGL0K07007g73629649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2164.2
         (508 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement        1038   0.0  
YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   761   0.0  
Scas_663.3                                                            756   0.0  
Kwal_26.7067                                                          754   0.0  
KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   718   0.0  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   707   0.0  
ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   671   0.0  
Scas_717.74                                                            36   0.076
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           35   0.22 
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         34   0.25 
Kwal_26.7725                                                           33   0.47 
AGL119C [4193] [Homologous to ScYDR190C (RVB1) - SH] (483651..48...    32   1.6  
YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknow...    30   5.1  
Sklu_1839.2 YDR190C, Contig c1839 2207-3613 reverse complement         30   5.6  
YBR238C (YBR238C) [417] chr2 complement(695064..697259) Protein ...    30   7.6  
Sklu_1367.2 YBR238C, Contig c1367 1879-3813                            29   8.5  
CAGL0K07007g 686868..689078 highly similar to sp|P38330 Saccharo...    29   9.8  

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/508 (100%), Positives = 508/508 (100%)

Query: 1   MLLHHSCRFSTLLSSHVTELIKIVNIFLLITHFWSLNFISTKTKAQEKHETMSSTAEKIA 60
           MLLHHSCRFSTLLSSHVTELIKIVNIFLLITHFWSLNFISTKTKAQEKHETMSSTAEKIA
Sbjct: 1   MLLHHSCRFSTLLSSHVTELIKIVNIFLLITHFWSLNFISTKTKAQEKHETMSSTAEKIA 60

Query: 61  QKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLSDSLIKRL 120
           QKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLSDSLIKRL
Sbjct: 61  QKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLSDSLIKRL 120

Query: 121 DLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVIFESRPEV 180
           DLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVIFESRPEV
Sbjct: 121 DLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVIFESRPEV 180

Query: 181 IANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQLIETRQD 240
           IANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQLIETRQD
Sbjct: 181 IANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQLIETRQD 240

Query: 241 VSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLEKAKRITL 300
           VSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLEKAKRITL
Sbjct: 241 VSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLEKAKRITL 300

Query: 301 DAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSKLKENGKL 360
           DAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSKLKENGKL
Sbjct: 301 DAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSKLKENGKL 360

Query: 361 DEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAIITENKEDA 420
           DEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAIITENKEDA
Sbjct: 361 DEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAIITENKEDA 420

Query: 421 EFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSYQYQIRGT 480
           EFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSYQYQIRGT
Sbjct: 421 EFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSYQYQIRGT 480

Query: 481 GQVASDYLGAGGNKAFIHKDLDLNTIRL 508
           GQVASDYLGAGGNKAFIHKDLDLNTIRL
Sbjct: 481 GQVASDYLGAGGNKAFIHKDLDLNTIRL 508

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/455 (80%), Positives = 408/455 (89%)

Query: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113
           S++++IA+ AR AGNILKT+S+E RS ILY IHD LKANA +IE+ANK+DL  AKET L+
Sbjct: 2   SSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLA 61

Query: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173
           DSL+KRLDLFKGDKFE MLQGIKDVAELEDPVGK+KMARELD+ LTLYQVTAPVGVLLVI
Sbjct: 62  DSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVI 121

Query: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233
           FESRPEVIANITALSIKSGNAAILKGGKESVNTFREM++I+N  IA+ +  TGVP G+VQ
Sbjct: 122 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQ 181

Query: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293
           LIETRQDVSDLLDQD YIDLVVPRGSNALVR+IK +TKIPVLGHADGICSIYLDEDADL 
Sbjct: 182 LIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLI 241

Query: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353
           KAKRI+LDAKTNYPAGCNA+ET+LINP    WWEVLENLTLEG V +H TKD+K AY  K
Sbjct: 242 KAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDK 301

Query: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413
           L E GKL EA++ K V+A+E +DFDKEFLSLD A KFV+ST+ A+QHIN HSS+HTDAI+
Sbjct: 302 LNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIV 361

Query: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473
           TENK +AE F+KGVDSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLVSY
Sbjct: 362 TENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSY 421

Query: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDLDLNTIRL 508
           QYQIRG GQVASDYLGAGGNKAF+HKDLD+ T+ L
Sbjct: 422 QYQIRGDGQVASDYLGAGGNKAFVHKDLDIKTVTL 456

>Scas_663.3
          Length = 457

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/450 (80%), Positives = 404/450 (89%)

Query: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113
           S+A++IAQ+AR+AGN LKT+S++ RS ILY I D LKA A  IE ANK+DLQNAKET+LS
Sbjct: 2   SSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHLS 61

Query: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173
           DSL+KRLDLFKGDKFETMLQGIKDVA+LEDPVGKIKMARELDE LTLYQVTAPVGVLLVI
Sbjct: 62  DSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLVI 121

Query: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233
           FESRPEVIANITAL IKSGNA ILKGGKESVNTFREMSRIIN  I +NEK TGVP GAVQ
Sbjct: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAVQ 181

Query: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293
           LIETRQDV+DLLDQD YIDLVVPRGSNALVR IK STKIPVLGHADGICS+Y+DE+ADLE
Sbjct: 182 LIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADLE 241

Query: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353
           KAKRI  DAKTNYPAGCNA+ET+LINP+  NWWEVLEN+T +G+V +H   DVK+AY+ K
Sbjct: 242 KAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLDK 301

Query: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413
           L + G  D+ ++   V+ +E  DFDKEFLSLDCAVKFV+ST+EA++HIN+HSS+HTDAI+
Sbjct: 302 LTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAIV 361

Query: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473
           TENK+ AE FLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY
Sbjct: 362 TENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 421

Query: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDLDL 503
           QYQIRG GQ+A DYLGAGGN+AFIHKDLD+
Sbjct: 422 QYQIRGNGQIAGDYLGAGGNRAFIHKDLDV 451

>Kwal_26.7067
          Length = 457

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/457 (77%), Positives = 415/457 (90%)

Query: 52  MSSTAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETN 111
           MSS +E IA+ ARL GN+LKT+S+E RS +LY IHDGLKANA SI++ANK DL+ AKE N
Sbjct: 1   MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN 60

Query: 112 LSDSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLL 171
           L+DSL +RLDLFKGDKF+TML GIKDVAELEDPVGKIK+ARELDENL LYQVTAPVG LL
Sbjct: 61  LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL 120

Query: 172 VIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGA 231
           VIFESRPEVIANIT+L+IKSGNAAILKGGKESV+TFRE+SRIINT+I+ENE  +G+P+  
Sbjct: 121 VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV 180

Query: 232 VQLIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDAD 291
           +QLIETRQDVSDLL QD YIDLVVPRGSN LVR+IK STKIPVLGHADGICSIYLDE+AD
Sbjct: 181 IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD 240

Query: 292 LEKAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYV 351
           L+KA RIT+DAKT+YPAGCNA+ET+LINP +  WW+VLENL+  G+V +H+T+DVK +Y 
Sbjct: 241 LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF 300

Query: 352 SKLKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDA 411
           +KL E+ +LD+ + +K V+AN +EDFDKEFLSLDCAVKFVSST++AV HINLHSSKHTDA
Sbjct: 301 AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA 360

Query: 412 IITENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 471
           IITENK +AE+F+KGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 420

Query: 472 SYQYQIRGTGQVASDYLGAGGNKAFIHKDLDLNTIRL 508
           SYQYQ+RG GQ+ASDY+G+GG +AF+HK+LD++T++L
Sbjct: 421 SYQYQLRGDGQIASDYVGSGGKRAFVHKNLDISTVQL 457

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/455 (76%), Positives = 394/455 (86%), Gaps = 9/455 (1%)

Query: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113
           S +E IA+ AR AGNILKTLSDE+RS ILY IHDGLKANA SIE ANK+DL+ AK TNLS
Sbjct: 2   SVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLS 61

Query: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173
           DSL+KRLDLFKGDKFETMLQGI DVA L+DPVGK+  ARE+DENLTLYQ+TAPVGVLLVI
Sbjct: 62  DSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLVI 121

Query: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233
           FESRPEVIANITALSIKSGNAAILKGGKES+NTF+EMSRI+N ++ +NEK T VP GAVQ
Sbjct: 122 FESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181

Query: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293
           LIETR+DVSDLL QD YIDLV+PRGSNALVRQIK STKIPVLGHADGICSIY+DE AD+ 
Sbjct: 182 LIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADIG 241

Query: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353
           KAKRI +DAKTNYPAGCNAVET+LINP L++WWEVL +L +E  V +H++K+VK+ Y   
Sbjct: 242 KAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSL-IENGVTLHVSKEVKKQY--- 297

Query: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413
                K   +    IV+ +E++DFDKEFLSLD AV FV ST+ AV HIN HSSKHTDAI+
Sbjct: 298 -----KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIV 352

Query: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473
           TEN E+AE+FLK VDSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 353 TENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 412

Query: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDLDLNTIRL 508
           QYQ+RG GQ+ASDYLGAGG KAF+HKDLD+ +I +
Sbjct: 413 QYQLRGNGQIASDYLGAGGKKAFVHKDLDVKSISI 447

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/455 (74%), Positives = 393/455 (86%), Gaps = 1/455 (0%)

Query: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113
           S+AEKIA++AR+AGN+LKT+SDE RSKILY I D L    + IE ANK DL+ A+   L+
Sbjct: 2   SSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGLA 61

Query: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173
           DSL+KRLDLFKGDKF+ MLQGI DVA+LEDPVGK+KMARE+D  L LYQVTAPVGV+LVI
Sbjct: 62  DSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILVI 121

Query: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233
           FESRPEVIANITAL IKSGNA ILKGGKESVNTF+ M++++N  I + +  TGVP GAVQ
Sbjct: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQ 181

Query: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293
           LIETRQDVSDLL QD YIDLVVPRGSN+LVRQIK STKIPVLGHADGICSIY+D DADLE
Sbjct: 182 LIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADLE 241

Query: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353
           KAKRI LDAKTNYPAGCNA+E +L+NP    W +VL +L  EG V +H T DVKEA++ K
Sbjct: 242 KAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLKK 301

Query: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413
           L+++GKL++ ++ KIV+A +  DFDKEFLSLDCAVKF+ +T +A+ HIN HSSKHTDAII
Sbjct: 302 LQDSGKLNDDIKAKIVDAKDG-DFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360

Query: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473
           TE+KEDAE FLKG+DSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420

Query: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDLDLNTIRL 508
           QYQIRG GQVASDYLGAGGNKAF+HKD+D+  I+L
Sbjct: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDIDVTNIKL 455

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/451 (71%), Positives = 381/451 (84%), Gaps = 5/451 (1%)

Query: 52  MSSTAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETN 111
           MS+ AE IA+KAR+AGN+LKTLS+EQR+ +L  IHDGL A  E I KAN+ DL+ A + N
Sbjct: 1   MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN 60

Query: 112 LSDSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLL 171
           L+ +L++RL+LFKGDKFE MLQGI DVA LEDPVGK++M RELDE LTLY+VTAPVGV+L
Sbjct: 61  LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML 120

Query: 172 VIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGA 231
           +IFESRPEVIANI+AL IKSGNA ILKGGKE+VNTFRE++ +IN ++AE+E  TGVP  A
Sbjct: 121 IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA 180

Query: 232 VQLIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDAD 291
           VQL+E+R +VSDLL QD YIDLVVPRGSNALV+QIK STKIPVLGHADGICSIYLD DAD
Sbjct: 181 VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADAD 240

Query: 292 LEKAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYV 351
           L KAKRI LD+KTNY A CNA E++LINP    W EVL +L + GNV +H+T DVKEA+ 
Sbjct: 241 LAKAKRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF 300

Query: 352 SKLKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDA 411
           +   +    D AL+  +V+A E  DF +EFLSLD AVKF+ S QEAV HIN HSSKHTDA
Sbjct: 301 AYAGD----DAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDA 355

Query: 412 IITENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 471
           I+TE K+ A+FFLKG+DS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 356 IVTECKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 415

Query: 472 SYQYQIRGTGQVASDYLGAGGNKAFIHKDLD 502
           +YQYQ+RGTGQVASDY+GAGG++AF+HKDLD
Sbjct: 416 TYQYQVRGTGQVASDYIGAGGDRAFVHKDLD 446

>Scas_717.74
          Length = 522

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 62/141 (43%), Gaps = 15/141 (10%)

Query: 186 ALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQLIETRQDVSDLL 245
           A +I +GN+ ILK  + + +T   M RII           G P G VQ+++   D +  L
Sbjct: 145 AHAIGAGNSVILKPSERTAHTALVMQRIIEE--------AGFPDGLVQVVQGAIDETQRL 196

Query: 246 DQDAYIDLVVPRGS---NALVRQIKCSTKIPVLGHADGICSIYLDE---DADLEKA-KRI 298
                +D++   GS    +++ Q       P +    G    ++ E   D +L+ A KRI
Sbjct: 197 ITSKDLDMIFYTGSPTVGSIIAQEAAKNLTPCVLELGGKSPTFITENFNDKNLKTALKRI 256

Query: 299 TLDAKTNYPAGCNAVETILIN 319
              A  N    C + + +L++
Sbjct: 257 FFGAFGNSGQICVSPDYLLVH 277

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 402 NLHSSKHTDAIITENKEDAEFFLKGVDSSGVYWN--ASTRFADGFRYGFG 449
           N    KH++    EN+ED E  +    SS V +N  ++ R   G +YGFG
Sbjct: 115 NFFKGKHSNGRTKENEEDEEVIMSDQSSSMVTFNDLSTLRNNGGHKYGFG 164

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 216 TIIAENEKLTGVPSGAVQLIETRQDVSDLLDQDAY--IDLVVPRGSNALVRQIKCSTKIP 273
           T +   + L+G+  G +  +  RQ  +  +    Y  I ++V   +NA   +   S    
Sbjct: 157 TALVRKQGLSGLYRGVLP-VSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTF 215

Query: 274 VLGHADGICSIYLDEDADLEKAKRITLDAKTNYPAGCNAVETILINPALKNWWE----VL 329
           V+G   GI ++Y     D  K +  +LD+K  Y +  N   TI     LK +W+     L
Sbjct: 216 VVGAFSGIVTVYTTMPIDTVKTRMQSLDSK-RYSSTINCFTTIFKEEGLKAFWKGATPRL 274

Query: 330 ENLTLEGNVIVHLTKDV 346
             L L G ++  + + V
Sbjct: 275 GRLFLSGGIVFTVYEKV 291

>Kwal_26.7725
          Length = 295

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 90/228 (39%), Gaps = 54/228 (23%)

Query: 184 ITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQLIETRQDVSD 243
           ++   +K+G A +LKGG            +I  ++   + +    +GA  ++   +  +D
Sbjct: 1   MSEFKVKAGLAQMLKGG------------VIMDVVNAEQAVVAEKAGACAVMALERIPAD 48

Query: 244 LLDQDAYIDLVVPRGSNALVRQIKCSTKIPVL-----GHA------DGICSIYLDEDADL 292
           +        +  P+    ++R+I  +  IPV+     GH+        +   Y+DE   L
Sbjct: 49  MRKSGQVCRMSDPQ----MIREIMAAVSIPVMAKVRIGHSVEAQILQALEVDYIDESEVL 104

Query: 293 EKAKRITLDAKTNY--PAGCNAVETILINPALKNWWEVLENLTLEGNVIVHL-----TKD 345
             A ++    K+++  P  C A          KN  E L  +  EG  ++       T D
Sbjct: 105 TPADKVNHIRKSDFKVPYVCGA----------KNLGEALRRIN-EGAAMIRTKGEAGTGD 153

Query: 346 VKEAY---------VSKLKENGKLDEALEQKIVEANEAEDFDKEFLSL 384
           V EA          ++  KEN K  E LE+   E     D  +E +SL
Sbjct: 154 VSEAVKHITQIRGEIAWAKENLKTQEQLEEHAKELRVPVDLLQEVVSL 201

>AGL119C [4193] [Homologous to ScYDR190C (RVB1) - SH]
           (483651..485030) [1380 bp, 459 aa]
          Length = 459

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVR-QIKCSTKIPVLGHADGICSIYLDEDADL 292
           +IE R  V +L  + A +DL+   GS+  +R  ++  T   +L    G   I L   +D+
Sbjct: 379 IIEKRSKVENLQLEQAALDLLAAMGSDMSLRYALQLLTPAGILAATAGRTEILL---SDI 435

Query: 293 EKAKRITLDAK 303
           E+AK + LDAK
Sbjct: 436 EEAKMLFLDAK 446

>YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1044 bp, 347 aa]
          Length = 347

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 412 IITENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHAR 462
            + ENK   +F L  ++   V+      FAD  ++G  T  GI +  IH++
Sbjct: 183 FLKENKSSVKFTLSTINPGFVF--GPQMFADSLKHGINTSSGIVSELIHSK 231

>Sklu_1839.2 YDR190C, Contig c1839 2207-3613 reverse complement
          Length = 468

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQI-KCSTKIPVLGHADGICSIYLDEDADL 292
           +IE R  + +L  + A +DL+   G+   +R + +  +   +L H  G   I ++   D+
Sbjct: 388 IIEKRSTIENLQLEPAALDLLATMGTETSLRYVLQLLSPSGILAHTAGRTGINVN---DV 444

Query: 293 EKAKRITLDAK 303
           E+AK + LDAK
Sbjct: 445 EEAKMLFLDAK 455

>YBR238C (YBR238C) [417] chr2 complement(695064..697259) Protein
           with high similarity to S. cerevisiae Rmd9p, which may
           be involved in meiotic nuclear division, or respiration
           [2196 bp, 731 aa]
          Length = 731

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 57  EKIAQKARLAGNILKT--LSDEQRSKILYIIHDGLKANAESIEKANK 101
           + I +   L  ++L T  L+ ++ SK+++++H+GL+AN   + + NK
Sbjct: 182 DSIGRAMGLYHDLLTTPELNSDRVSKLVHLLHNGLRANRNQLTRMNK 228

>Sklu_1367.2 YBR238C, Contig c1367 1879-3813
          Length = 644

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 57  EKIAQKARLAGNILKT--LSDEQRSKILYIIHDGLKANAESIEKANK 101
           E I +   L  +++ T  L+ ++ SK+++++H+GL+AN   + + NK
Sbjct: 133 ESIGKGMGLYRDLIHTPELNSDRVSKLVHLLHNGLRANRNQLTRMNK 179

>CAGL0K07007g 686868..689078 highly similar to sp|P38330
           Saccharomyces cerevisiae YBR238c, start by similarity
          Length = 736

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 22/29 (75%)

Query: 73  LSDEQRSKILYIIHDGLKANAESIEKANK 101
           L+ ++ SK+++++H+GL+AN   + + NK
Sbjct: 174 LNSDRVSKLVHLLHNGLRANRNQLTRMNK 202

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,642,783
Number of extensions: 685108
Number of successful extensions: 2626
Number of sequences better than 10.0: 55
Number of HSP's gapped: 2707
Number of HSP's successfully gapped: 55
Length of query: 508
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 402
Effective length of database: 12,926,601
Effective search space: 5196493602
Effective search space used: 5196493602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)