Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2124.11830183095860.0
Kwal_27.119511869182978880.0
KLLA0E08107g1829182677180.0
YBR208C (DUR1,2)1835182872400.0
Scas_721.401834182669310.0
CAGL0M05533g1834182765830.0
ADR051C1819182661740.0
Kwal_14.180311744467193e-77
YBR218C (PYC2)11804597193e-77
CAGL0K06787g11754597176e-77
KLLA0C05764g11734607113e-76
Scas_686.1711764597061e-75
AAR162C11714877024e-75
YGL062W (PYC1)11784846882e-73
CAGL0F06941g11804626767e-72
Sklu_1458.111324386472e-68
Scas_563.1212164466473e-68
KLLA0F06072g22315065882e-60
Scas_720.7422315065863e-60
CAGL0L10780g22335065854e-60
AAR071W22315065765e-59
YMR207C (HFA1)21234765739e-59
YNR016C (ACC1)22335065702e-58
Kwal_23.615722305085684e-58
KLLA0A09845g4694192652e-23
Kwal_23.42494652172572e-22
YMR293C4644442501e-21
CAGL0M13585g4671692482e-21
ABR140C4632392473e-21
Scas_684.254821672421e-20
Kwal_56.222955831791985e-15
Sklu_2417.115911791734e-12
Sklu_2417.105911791734e-12
YJL130C (URA2)22143001673e-11
CAGL0L05676g22113001621e-10
KLLA0E15444g22283001612e-10
Scas_582.4*21933001612e-10
ACR263C22403001602e-10
Sklu_1884.25461411548e-10
Scas_721.665731471467e-09
KLLA0F03190g11173161442e-08
Sklu_2331.122203001424e-08
Sklu_2136.36171271395e-08
Sklu_2413.411222601405e-08
Kwal_33.1406122213001406e-08
Kwal_55.1978311212521361e-07
YDR242W (AMD2)5491291342e-07
KLLA0B08800g5701251306e-07
Kwal_34.157245561261281e-06
CAGL0C04917g11133041253e-06
Kwal_27.104385691361163e-05
Sklu_2072.34503741111e-04
KLLA0D12628g5781381055e-04
Scas_691.1911172311056e-04
ABR157W11133491056e-04
YJR109C (CPA2)11183041048e-04
Scas_712.17793121900.035
Kwal_14.783128043830.27
KLLA0E09768g40545810.33
Sklu_2372.4128043771.1
YHR014W (SPO13)29150741.8
Kwal_27.1260225757732.6
KLLA0C18975g128643742.8
KLLA0B03762g77263724.1
Sklu_1870.5347176714.3
YKL215C128643716.7
Scas_617.742058699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2124.1
         (1830 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         3697   0.0  
Kwal_27.11951                                                        3043   0.0  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  2977   0.0  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  2793   0.0  
Scas_721.40                                                          2674   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  2540   0.0  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  2382   0.0  
Kwal_14.1803                                                          281   3e-77
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   281   3e-77
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   280   6e-77
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   278   3e-76
Scas_686.17                                                           276   1e-75
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   275   4e-75
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   269   2e-73
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   265   7e-72
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         253   2e-68
Scas_563.12                                                           253   3e-68
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   231   2e-60
Scas_720.74                                                           230   3e-60
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   229   4e-60
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   226   5e-59
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   225   9e-59
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   224   2e-58
Kwal_23.6157                                                          223   4e-58
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...   106   2e-23
Kwal_23.4249                                                          103   2e-22
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...   100   1e-21
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...   100   2e-21
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...   100   3e-21
Scas_684.25                                                            98   1e-20
Kwal_56.22295                                                          81   5e-15
Sklu_2417.11 , Contig c2417 20071-21846                                71   4e-12
Sklu_2417.10 , Contig c2417 20071-21846                                71   4e-12
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    69   3e-11
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    67   1e-10
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    67   2e-10
Scas_582.4*                                                            67   2e-10
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    66   2e-10
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         64   8e-10
Scas_721.66                                                            61   7e-09
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    60   2e-08
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            59   4e-08
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                58   5e-08
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          59   5e-08
Kwal_33.14061                                                          59   6e-08
Kwal_55.19783                                                          57   1e-07
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    56   2e-07
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    55   6e-07
Kwal_34.15724                                                          54   1e-06
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    53   3e-06
Kwal_27.10438                                                          49   3e-05
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                47   1e-04
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    45   5e-04
Scas_691.19                                                            45   6e-04
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    45   6e-04
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    45   8e-04
Scas_712.17                                                            39   0.035
Kwal_14.783                                                            37   0.27 
KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...    36   0.33 
Sklu_2372.4 YKL215C, Contig c2372 8103-11945                           34   1.1  
YHR014W (SPO13) [2300] chr8 (132039..132914) Meiosis-specific pr...    33   1.8  
Kwal_27.12602                                                          33   2.6  
KLLA0C18975g complement(1684573..1688433) similar to sp|P28273 S...    33   2.8  
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...    32   4.1  
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            32   4.3  
YKL215C (YKL215C) [3060] chr11 complement(26828..30688) Protein ...    32   6.7  
Scas_617.7                                                             31   9.2  

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 3697 bits (9586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1797/1830 (98%), Positives = 1797/1830 (98%)

Query: 1    MSVDTLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKV 60
            MSVDTLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKV
Sbjct: 1    MSVDTLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKV 60

Query: 61   LQSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIG 120
            LQSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIG
Sbjct: 61   LQSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIG 120

Query: 121  KTNLDQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGR 180
            KTNLDQFATGLVGTRSPYGKTPCVFSDKHV           VGRGIVPIALGTDTAGSGR
Sbjct: 121  KTNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGR 180

Query: 181  VPAALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEY 240
            VPAALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEY
Sbjct: 181  VPAALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEY 240

Query: 241  SRPLPSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLA 300
            SRPLPSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLA
Sbjct: 241  SRPLPSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLA 300

Query: 301  LARCLYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGI 360
            LARCLYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGI
Sbjct: 301  LARCLYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGI 360

Query: 361  LQKVDQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGF 420
            LQKVDQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGF
Sbjct: 361  LQKVDQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGF 420

Query: 421  RPDGLPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDI 480
            RPDGLPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDI
Sbjct: 421  RPDGLPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDI 480

Query: 481  SPEDSVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRV 540
            SPEDSVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRV
Sbjct: 481  SPEDSVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRV 540

Query: 541  GEETGSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTV 600
            GEETGSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTV
Sbjct: 541  GEETGSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTV 600

Query: 601  DITKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPD 660
            DITKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPD
Sbjct: 601  DITKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPD 660

Query: 661  KYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV 720
            KYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV
Sbjct: 661  KYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV 720

Query: 721  EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMV 780
            EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMV
Sbjct: 721  EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMV 780

Query: 781  KSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDG 840
            KSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDG
Sbjct: 781  KSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDG 840

Query: 841  YGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFI 900
            YGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFI
Sbjct: 841  YGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFI 900

Query: 901  YDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIE 960
            YDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIE
Sbjct: 901  YDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIE 960

Query: 961  ARLYAENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRND 1020
            ARLYAENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRND
Sbjct: 961  ARLYAENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRND 1020

Query: 1021 AIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGA 1080
            AIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGA
Sbjct: 1021 AIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGA 1080

Query: 1081 YTTVQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTET 1140
            YTTVQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTET
Sbjct: 1081 YTTVQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTET 1140

Query: 1141 XXXXXXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSR 1200
                      CSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSR
Sbjct: 1141 IIAISGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSR 1200

Query: 1201 STFALGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTI 1260
            STFALGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTI
Sbjct: 1201 STFALGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTI 1260

Query: 1261 GVTCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSN 1320
            GVTCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSN
Sbjct: 1261 GVTCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSN 1320

Query: 1321 AHDYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPIS 1380
            AHDYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPIS
Sbjct: 1321 AHDYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPIS 1380

Query: 1381 YQVARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGD 1440
            YQVARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGD
Sbjct: 1381 YQVARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGD 1440

Query: 1441 RYILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALL 1500
            RYILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALL
Sbjct: 1441 RYILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALL 1500

Query: 1501 DTLVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVA 1560
            DTLVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVA
Sbjct: 1501 DTLVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVA 1560

Query: 1561 EVNDITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVV 1620
            EVNDITHKDVENMLYSAR            APCAVPLDPRHRFLGSKYNPSRTYTKNGVV
Sbjct: 1561 EVNDITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVV 1620

Query: 1621 GIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEEL 1680
            GIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEEL
Sbjct: 1621 GIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEEL 1680

Query: 1681 DRFTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVAN 1740
            DRFTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVAN
Sbjct: 1681 DRFTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVAN 1740

Query: 1741 QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMV 1800
            QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMV
Sbjct: 1741 QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMV 1800

Query: 1801 VPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            VPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ
Sbjct: 1801 VPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830

>Kwal_27.11951
          Length = 1869

 Score = 3043 bits (7888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1450/1829 (79%), Positives = 1616/1829 (88%), Gaps = 1/1829 (0%)

Query: 2    SVDTLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVL 61
            SV+TLGWS QDW+ FH ++TPE S   L +L+ +QKSAPEDPAWISL+++ +L HQW++L
Sbjct: 42   SVNTLGWSVQDWLGFHAEATPEASLAALSALIGAQKSAPEDPAWISLVSQEHLEHQWRIL 101

Query: 62   QSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGK 121
            QSK +K++LPLYGVPIAVKDNID+ G  TTAACP F Y PS DSTVVALL+DAGAIVIGK
Sbjct: 102  QSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGK 161

Query: 122  TNLDQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRV 181
            TNLDQFATGLVGTRSPYGKTPCVFS++HV           VGRGIVP+ALGTDTAGSGRV
Sbjct: 162  TNLDQFATGLVGTRSPYGKTPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDTAGSGRV 221

Query: 182  PAALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYS 241
            PAALNNLIGLKP+KG+FSCSGVVPACKSLDCVS+FA+NL DAERCFKVMA+PD E DEYS
Sbjct: 222  PAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYS 281

Query: 242  RPLPSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLAL 301
            R +P+NPLQKY K+ TIA+P ++PWY ETEN   YA AIENLK  GA +V +DFEPLL L
Sbjct: 282  RAMPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLEL 341

Query: 302  ARCLYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGIL 361
            ARCLYEGAWVAERYEAT+DFFA NP ESSLDPTVT IIK    YDAAD+FRYEY+RQGIL
Sbjct: 342  ARCLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGIL 401

Query: 362  QKVDQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFR 421
            QKV + L+ IDVLCVPTCP NPTF ++ A PV +NSRQGTWTNFVNLAD+AALAVP GFR
Sbjct: 402  QKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFR 461

Query: 422  PDGLPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDIS 481
             DGLP G+TLIGK FTD+ALLELANRYF++AFP  SRT+GKF++  +TT+D+ L+GP  S
Sbjct: 462  SDGLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDN-LQGPPFS 520

Query: 482  PEDSVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVG 541
             EDS+KLAVVGAHLKGLPL+WQLEKVNA Y+GSPKTS NY+LYALPKTGP+LKPGLRRV 
Sbjct: 521  TEDSIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVD 580

Query: 542  EETGSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVD 601
             E G+QIQLEVYSVPK+ FG FISMVPEPLGIGSVELESGEWVKSFICEEFGYTQ GT D
Sbjct: 581  SEGGAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKD 640

Query: 602  ITKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDK 661
            IT+ G FK Y+D L +EE++ KKPFETVL+ANRGEIAVRIIKTLKKL I+SVAVYSDPDK
Sbjct: 641  ITELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDK 700

Query: 662  YSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVE 721
            YSQHV DAD+ VAL GRTAAETYLDIDKII AAK+T  +AIIPGYGFLSENA+F+D+C  
Sbjct: 701  YSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCAS 760

Query: 722  EGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVK 781
            EGIVFVGP+G+AIRKLGLKHSAREIAEKAGVPLVPGSGLV + +EA+EIA  LEYPVMVK
Sbjct: 761  EGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVK 820

Query: 782  STAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGY 841
            STAGGGGIGLQKVDSE +IERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDG 
Sbjct: 821  STAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGK 880

Query: 842  GKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIY 901
            GKAIAIGERDCSLQRRNQK+IEETPAPNL E TR +MR+A+E+LGSLLKY+CAGTVEFIY
Sbjct: 881  GKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIY 940

Query: 902  DERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEA 961
            DERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWML IAA   PDF++  I VTGASIEA
Sbjct: 941  DERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEA 1000

Query: 962  RLYAENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDA 1021
            RLYAENP KDFRPSPG LTDV FPEWARVDTWVSKGTT+SAEYDPTLAKIIVHGKDR++A
Sbjct: 1001 RLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEA 1060

Query: 1022 IMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAY 1081
            I K+N+ALNET +YGCITNIDYLRSIASSEMFKTAKVATK+LDSYDY+P AFE+TSPGAY
Sbjct: 1061 IQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAY 1120

Query: 1082 TTVQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETX 1141
            TTVQDYPGRV +WRIGVPPSGPMD+YSFRLANRIVGNHYKAPAIE+TLNGPK+LFHT+  
Sbjct: 1121 TTVQDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAV 1180

Query: 1142 XXXXXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRS 1201
                     C++N   + QNKP+ V +GD L +GKLS GCRAYLAIRGGIDVPEYLGSRS
Sbjct: 1181 IAITGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRS 1240

Query: 1202 TFALGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIG 1261
            TFALGNMGGYNGRVLKLGDVLFLNQPEL SS +P P Y+P  PPA+LLP IS  KEW IG
Sbjct: 1241 TFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIG 1300

Query: 1262 VTCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNA 1321
            VTCGPHGSPDFFKPESVEEFFSE+WKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNA
Sbjct: 1301 VTCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNA 1360

Query: 1322 HDYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISY 1381
            HDYVYSLGAINFTGDEPVIIT+DGPSLGGFVCQAVVPE ELWKVGQVKPGD IQFVP+SY
Sbjct: 1361 HDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSY 1420

Query: 1382 QVARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDR 1441
            + AR LKESQD AIET E+G L+TLTS+L+LP  E+PVL QLP+ S  SPKVTYRQAGDR
Sbjct: 1421 ETARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDR 1480

Query: 1442 YILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLD 1501
            Y+LVEYGEN+MDLNI+YR+N+LINLV K+KT+GIVEMSQGVRSVL+E+DGYKISQ ALL+
Sbjct: 1481 YVLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLE 1540

Query: 1502 TLVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAE 1561
            TL+AYE EI+FD+NWSIKSK+FKLPLAFEDS+TLECV RYQETIRSKAPWLPNNVDF+A+
Sbjct: 1541 TLIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIAD 1600

Query: 1562 VNDITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVG 1621
            VN I+H DVE+MLY AR            APCAVPL+P HRFLGSKYNPSRTYTKNG VG
Sbjct: 1601 VNGISHSDVEDMLYQARFLVLGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVG 1660

Query: 1622 IGGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELD 1681
            IGGMYMCIYAMDSPGGYQLVGRTIPIWDKL+LG+HS +HPWLLTPFDQVE+Y V+E+EL+
Sbjct: 1661 IGGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELN 1720

Query: 1682 RFTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQ 1741
            +FTE+CENG+FPVQVEES FDH  YLKWI+ N E I EFQ  Q G KA+EFA+LIQ +N 
Sbjct: 1721 KFTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNA 1780

Query: 1742 ELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVV 1801
            ELE +  ++ AVEEE+PEDAEMVYSEYSGRFWKP+VS GD V  GDGL++VEAMKTEM+V
Sbjct: 1781 ELEKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMV 1840

Query: 1802 PAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
             A K GKVLK+VHKNGDMV+AG +V VIQ
Sbjct: 1841 SAPKGGKVLKVVHKNGDMVEAGDVVVVIQ 1869

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 2977 bits (7718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1419/1826 (77%), Positives = 1594/1826 (87%), Gaps = 2/1826 (0%)

Query: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64
            TLGWS QDW+ FH KSTP  S   L +LLKSQK APEDPAWISLI   +L HQW +LQSK
Sbjct: 4    TLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNILQSK 63

Query: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124
            +NK++LPLYGVPIAVKDNID KG PTTAACP++ Y P+ DS VV LL+DAGA+VIGKTNL
Sbjct: 64   SNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTNL 123

Query: 125  DQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAA 184
            DQFATGLVGTRSPYGKTPCVF+DK+V           VGRGIVP++LGTDTAGSGRVPAA
Sbjct: 124  DQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRVPAA 183

Query: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244
            LNNLIGLKPTKG FSC GVVPACKSLDCVSVFA+NLSDAE  FKVM KPDL  DEYSR  
Sbjct: 184  LNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSREF 243

Query: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304
            P NP+ +YPK++TIAIPKEVPW+GETENPKLY KA+ +LK  GA IV +DFEPLL LARC
Sbjct: 244  PKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELARC 303

Query: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364
            LYEGAWVAERY AT+DF ATNPPESSLD TV +IIK A K+DAAD+F++EY+RQGILQKV
Sbjct: 304  LYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGILQKV 363

Query: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424
            +  LKDIDVLCVPTCPLNP  EEVA EPVLVNSRQGTWTNFVNLAD+AALAVP+GFR DG
Sbjct: 364  NLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSDG 423

Query: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484
            LP G+TLIGKKF+D+ALL+LA R+F VAFP  SRT+GKF+DR++T  +DEL GP     +
Sbjct: 424  LPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITV-EDELDGPSKDTLN 482

Query: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544
             VKLAVVGAHLKGLPL+WQL+K NATYL SPKTS NYKLYALPK GP+LKPGLRRV + T
Sbjct: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542

Query: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604
            GSQIQLEVYSVP + FG+FI+MVPEPLGIGSVELESGEWVKSFICEEFGYTQ+GTVDITK
Sbjct: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602

Query: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664
            +GGFK YI+ ++  EA+ KKPFETVLIANRGEIAVRI+KTLK++ I+SVAVYSDPDKYSQ
Sbjct: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662

Query: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724
            HV DAD  VAL+GRTAAETYLDIDKII AAK T AQAIIPGYGFLSENA+F+D+C +E I
Sbjct: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722

Query: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784
            VFVGPSG+AIRKLGLKHSAREIAE+A VPLVPGSGL+  AKEAKE+A KLEYPVMVKSTA
Sbjct: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKSTA 782

Query: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844
            GGGGIGLQKVDSE++IERVFETVQHQGK+YFGD+GVF+ERFV NARHVEIQMMGDG+GKA
Sbjct: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842

Query: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904
            IAIGERDCSLQRRNQK+IEETPAPNL E TR KMR A+E LGSLLKYKCAGTVEFIYDE+
Sbjct: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902

Query: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964
            RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAA+D+PDF++  I V+GASIEARLY
Sbjct: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962

Query: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024
            AENP KDFRPSPG LT V FP WARVDTWV KGT VSAEYDPTLAKIIVHGKDRNDAIMK
Sbjct: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022

Query: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084
            +N+ALNET VYGCITNIDYLRSIASS+MFK AKVATK+LDS+DYKPCAFEV +PGA T+V
Sbjct: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082

Query: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETXXXX 1144
            QDYPGR GYWRIGVPPSGPMD+YSFRLANR+VGN+ K+PA+E+TLNGPK+LFHTET    
Sbjct: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142

Query: 1145 XXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204
                  C+LND  I QN+PI+V RGD L++GK++VGCRAYL+IRGGIDVPEYLGSRSTFA
Sbjct: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202

Query: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264
            +GNMGGYNGR+LKLGDVLFLNQPEL+ SSLP P +EPQA P +LLP +S +K+W IGVTC
Sbjct: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262

Query: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324
            GPHGS D FK E +E+FF++KWKVHYNSNRFGVRLIGPKPKWAR DGGE GLHPSNAHDY
Sbjct: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322

Query: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384
            VYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV EAELWKVGQ+ PGD+IQFVP+SY VA
Sbjct: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382

Query: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444
            RQLKESQD +I+  E+G L  L+ D ILP YE+P+L  LPKKS+LSPKVTYRQAGDRYIL
Sbjct: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442

Query: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504
            VEYGE + DLNI YRIN+LI+ V +H+TVGIVEMSQGVRSVLIE+DG KI+Q ALL  L+
Sbjct: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502

Query: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564
            AYESEIQFDKNW++KSKIFKLP+AFEDSKTL+CVTRY+ETIRS+APWLPNNVDF+A+VND
Sbjct: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562

Query: 1565 ITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624
            I   DV+NMLYSA+            +PCAVPLDPRHR+LG+KYNPSRTYT  GVVGIGG
Sbjct: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622

Query: 1625 MYMCIY-AMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRF 1683
            MYMCIY A  SPGGYQLVGRTI  WDKL +G H  +HPWLLTPFDQVEFYPV+EEEL+  
Sbjct: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682

Query: 1684 TEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQEL 1743
             ED +NGKF + VEES+FDHK YL WINENI+SI  FQ++QGG KADEFARLIQVAN EL
Sbjct: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742

Query: 1744 ESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPA 1803
            + S  +K    EEYP+DAE++YSEY+GRFWKP+ + GD V  GDG++I+EAMKTEMVV A
Sbjct: 1743 KKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVVGA 1802

Query: 1804 KKSGKVLKIVHKNGDMVDAGGIVAVI 1829
             KSGKV KI+HKNGDMV+AG +VAVI
Sbjct: 1803 TKSGKVYKILHKNGDMVEAGDLVAVI 1828

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 2793 bits (7240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1328/1828 (72%), Positives = 1535/1828 (83%), Gaps = 9/1828 (0%)

Query: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64
            +LGWS QDWIDFH  S+ + S   L SLL SQ  AP D AWISLI++ NL HQ+++L+S+
Sbjct: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71

Query: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124
             NK+ LPLYGVPIAVKDNID +G PTTAACP+F Y PS DS VV LL++AGAI++GKTNL
Sbjct: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131

Query: 125  DQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAA 184
            DQFATGLVGTRSPYGKTPC FS +HV           V RGIVPIALGTDTAGSGRVPAA
Sbjct: 132  DQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 191

Query: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244
            LNNLIGLKPTKG+FSC GVVPACKSLDCVS+FA+NLSDAERCF++M +PD +NDEYSRP 
Sbjct: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251

Query: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304
             SNPL+K+  NVTIAIPK +PWYGET+NP L++ A+ENL   GA+++ IDFEPLL LARC
Sbjct: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311

Query: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364
            LYEG WVAERY+A + F  + PP+ SLDPTV SII+ A KY A D F +EY+RQGILQKV
Sbjct: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371

Query: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424
             + L+ +DVLCVPTCPLNPT ++VA EPVLVNSRQGTWTNFVNLAD+AALAVPAGFR DG
Sbjct: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431

Query: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484
            LP G+TLIGKKFTD+ALLELANRYF+  FP GSRT+G F    V   +D+L GPD  P  
Sbjct: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491

Query: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544
            S+KLAVVGAHLKGLPL+WQLEKVNATYL + KTSK Y+L+ALPK GP+LKPGLRRV +  
Sbjct: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551

Query: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604
            GSQI+LEVYSVPKE FG FISMVPEPLGIGSVELESGEW+KSFICEE GY  KGTVDITK
Sbjct: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611

Query: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664
            YGGF+ Y + LK++E++ KK F+TVLIANRGEIAVRIIKTLKKL IRSVAVYSDPDKYSQ
Sbjct: 612  YGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671

Query: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724
            HV DAD+ V L+G TAA+TYLD++KII AAK TNAQAIIPGYGFLSENA+F+D C   GI
Sbjct: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731

Query: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784
             FVGPSG+ IR LGLKHSAR+IA+KAGVPLVPGS L+TS +EAK++A +LEYPVMVKSTA
Sbjct: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAELEYPVMVKSTA 791

Query: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844
            GGGGIGLQKVDSE +IE +FETV+HQG+ +FGD+GVFLERF+ENARHVE+Q+MGDG+GKA
Sbjct: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851

Query: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904
            IA+GERDCSLQRRNQK+IEETPAPNL E TR  +R+AAESLGSLL YKCAGTVEFIYDE+
Sbjct: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911

Query: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWM+RIAA+DAPDF+S  + V G S+EARLY
Sbjct: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971

Query: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024
            AENP K+FRPSPGLL DV FP+WARVDTWV KGT +S EYDPTLAKIIVHGKDR+DAI K
Sbjct: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031

Query: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084
            +N+AL ET VYGCITNIDYL+SI +S+ F  AKV+T IL+SY Y+P A E+T PGA+T++
Sbjct: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091

Query: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETXXXX 1144
            QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGN Y+ PAIE+TL GP I+FH ET    
Sbjct: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151

Query: 1145 XXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204
                  C+L+ + I Q+KP++V RG  L+IGKL+ GCRAYL IRGGIDVP+YLGS STF 
Sbjct: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211

Query: 1205 LGNMGGYNGRVLKLGDVLFL--NQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGV 1262
            LGN+GGYNGRVLKLGDVLFL  N+   +   L      PQ  P +L+P+IS+ KEW IGV
Sbjct: 1212 LGNVGGYNGRVLKLGDVLFLPSNEENKSVECL------PQNIPQSLIPQISETKEWRIGV 1265

Query: 1263 TCGPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAH 1322
            TCGPHGSPDFFKPES+EEFFSEKWKVHYNSNRFGVRLIGPKPKWAR +GGEGG+HPSN H
Sbjct: 1266 TCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTH 1325

Query: 1323 DYVYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQ 1382
            DYVYSLGAINFTGDEPVIIT DGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVP+SY+
Sbjct: 1326 DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYE 1385

Query: 1383 VARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRY 1442
             +R LKESQD AI++L+  KL+ L S  ILP++E P+L Q+ K + LSPKV YRQAGDRY
Sbjct: 1386 SSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRY 1445

Query: 1443 ILVEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDT 1502
            +LVEYG+N+M+ NI+YRI  LI+LV K+KT+GIVEMSQGVRSVLIE+DGYK++Q  LL  
Sbjct: 1446 VLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKV 1505

Query: 1503 LVAYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEV 1562
            LVAYE+EIQFD+NW I S I +LP+AFEDSKTL CV RYQETIRS APWLPNNVDF+A V
Sbjct: 1506 LVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANV 1565

Query: 1563 NDITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGI 1622
            N I+  +V +MLYSAR            +PCAVPLDPRHRFLGSKYNPSRTYT+ G VGI
Sbjct: 1566 NGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGI 1625

Query: 1623 GGMYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDR 1682
            GGMYMCIYA +SPGGYQLVGRTIPIWDKL L + S E PWL+ PFDQVEFYPVSEE+LD+
Sbjct: 1626 GGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAA-SSEVPWLMNPFDQVEFYPVSEEDLDK 1684

Query: 1683 FTEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQE 1742
             TEDC+NG + V +E+SVFDH+ YL+WIN N +SIT FQ+ Q G +A+EFA+LIQ AN E
Sbjct: 1685 MTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSE 1744

Query: 1743 LESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVP 1802
            L+ S T K   EE++PE AE+VYSEYSGRFWK + S GD +  G GL+I+EAMK EM++ 
Sbjct: 1745 LKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEMIIS 1804

Query: 1803 AKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            A KSGK++KI H NGDMVD+G IVAVI+
Sbjct: 1805 APKSGKIIKICHGNGDMVDSGDIVAVIE 1832

>Scas_721.40
          Length = 1834

 Score = 2674 bits (6931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1280/1826 (70%), Positives = 1495/1826 (81%), Gaps = 4/1826 (0%)

Query: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64
            TLGWS +DWI+FH   T + S+  L  L++ Q+ AP DPAW+SL +   L  QW++LQ +
Sbjct: 9    TLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQWQILQHR 68

Query: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124
            + K+ LPLYGVP+A+KDNID++G PTTAACP+F Y P  DS VV LL++AGAI+IGKTNL
Sbjct: 69   SGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAIIIGKTNL 128

Query: 125  DQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAA 184
            DQFATGLVGTRSPYGKTPCVFSDKHV           V RGIVPIALGTDTAGSGRVPAA
Sbjct: 129  DQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 188

Query: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244
            LNNLIGLKPTKG FSC GVVPACKSLDCVSVF++NLSDAE CFK++ + DLENDEYSR  
Sbjct: 189  LNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSRTY 248

Query: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304
            P +PL+K+  +VTI IPK++ WYGE ENP LY  AI+ L+ +GA+I  IDFEPLL LARC
Sbjct: 249  PRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEPLLELARC 308

Query: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364
            LYEG WVAERY A KDF   NP     D  V SII +A K+ A D+F++EY+RQG+LQK+
Sbjct: 309  LYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQGLLQKI 368

Query: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424
            D+ L++ID LCVPTCPLNPTFE+V+ EP+LVNSRQGTWTNFVNLADMAALA+P+GFR DG
Sbjct: 369  DKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIPSGFRSDG 428

Query: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484
            LP G+TLIGKKFTDFALL+LA  YF++A+P  SRTFG F +  V   DD++ GP IS  D
Sbjct: 429  LPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTE-GVEINDDKVSGPVISSSD 487

Query: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544
            S+KLAVVGAHLKGLPL+WQLEKVNAT++ S KTSKNY+LYALP+TGPILKPGLRRV EE 
Sbjct: 488  SIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGLRRVNEE- 546

Query: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604
            G  IQ+E YS+P ENFG FISMVPEPLGIGSVELE+GEWVKSFICEE GYT KG+V+ITK
Sbjct: 547  GFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKGSVNITK 606

Query: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664
            YGGFK Y+ FL +   K KKPF TVL+ANRGEIAVRIIKTLKK+ I+SVA++S PD+YSQ
Sbjct: 607  YGGFKTYLKFL-ETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQ 665

Query: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724
            HVIDADL V L G +AA+TYL+I+KII AAK T AQAIIPGYGFLSENA+F+++C  EGI
Sbjct: 666  HVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGI 725

Query: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784
             FVGPSG+ +R LGLKHSAREIA+KA VPLVPGS L+T+A EAKEIA KLEYP+MVKSTA
Sbjct: 726  TFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTA 785

Query: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844
            GGGGIGLQKV+SE++IER+FETV+HQG AYFGDSGVF+ERF+ENARHVE+Q+MGDG G A
Sbjct: 786  GGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNA 845

Query: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904
            +AIGERDCSLQRRNQKIIEETPAPNL ETTR K+R+AA+ LGSLLKYKCAGTVEFIYDE 
Sbjct: 846  LAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEI 905

Query: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964
            RDEFYFLEVN RLQVEHPITEMVTG+DLVEWML IAAD APDF    I V G ++EARLY
Sbjct: 906  RDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAMEARLY 965

Query: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024
            AENP  DF+PSPG L +V FP+WAR+DTWVSKGT V+ EYDPTLAKIIVHGKDR+DA+ K
Sbjct: 966  AENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALEK 1025

Query: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084
            +NKAL ET V GCITNIDYLRSI+SSEMF+ AKV+T IL+SYDYKP A E+  PG++T++
Sbjct: 1026 LNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPGSHTSI 1085

Query: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETXXXX 1144
            QDYPGR G WRIGVPPSGPMDA+SFRLAN+IVGN++KAPA E+TLNGP ILFH +     
Sbjct: 1086 QDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHIDAIIGI 1145

Query: 1145 XXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204
                  C LN+  IEQ KPI V  GD L+IGKL  GCRAYLAIRGG+DVPEYLGS+STF 
Sbjct: 1146 TGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGSKSTFT 1205

Query: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264
            LGN GGY+GR LK+GD LF++Q +L    LPG  Y  Q    +LLP +  DK+W IGV C
Sbjct: 1206 LGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWKIGVLC 1265

Query: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324
            GPHGSPDFFKPE V+ FFSEKWKVHYNSNRFGVRL GPKP WARKDGGEGGLHPSNAHDY
Sbjct: 1266 GPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPSNAHDY 1325

Query: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384
            VYSLGAINFTGDEPVI+T DGPSLGGFVC AVV E+ELWKVGQVKPGD IQFVPIS++ A
Sbjct: 1326 VYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPISFESA 1385

Query: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444
            R+L +SQD AI TLE   L+TL   + LPT EDPVL  LP++  +SP++TYRQAGDRYIL
Sbjct: 1386 RELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAGDRYIL 1445

Query: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504
            VEYGEN MDLNI YRI+ LI LV  + T GIVEMSQGVRSVLIE+D Y ISQ  LL  L+
Sbjct: 1446 VEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQLLTLLL 1505

Query: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564
            AYE E+ + +NW++ SK+ +LP+AFEDSKT+ CV RYQETIRS APWLPNN DFVA +N 
Sbjct: 1506 AYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFVANING 1565

Query: 1565 ITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624
            ITHKDV +++YSAR            +PCAVPLDPRHR LGSKYNPSRT+T+ G VG+GG
Sbjct: 1566 ITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGAVGLGG 1625

Query: 1625 MYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRFT 1684
            M+MCIYA  SPGGYQL+GRTIPIWDKL L S S E PWLL PFDQ+EFYPVSE+ELDR T
Sbjct: 1626 MFMCIYAASSPGGYQLMGRTIPIWDKLLLLS-SSEQPWLLNPFDQIEFYPVSEKELDRLT 1684

Query: 1685 EDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQELE 1744
            +D + GK+ V   +  F+H +YLKW++EN +SITEFQ  Q G  A++FA+LI+++N EL+
Sbjct: 1685 DDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSNAELD 1744

Query: 1745 SSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAK 1804
             +   +     +YPE++ M+YSEYSGRFWKP+V+ G+ V  G GL+I+EAMKTEM+VP  
Sbjct: 1745 ENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTL 1804

Query: 1805 KSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
              GKVLKIVHKNG MVD+G +V VI+
Sbjct: 1805 HDGKVLKIVHKNGSMVDSGDLVVVIE 1830

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 2540 bits (6583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1205/1827 (65%), Positives = 1450/1827 (79%), Gaps = 4/1827 (0%)

Query: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64
            ++GWS QDWIDFH KSTP+ SY +LL L+K+Q+ APEDPAWIS+  E+ L  QW++LQS+
Sbjct: 9    SIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQQWQLLQSR 68

Query: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124
              K++LPLYGVPIAVKDNID+KG PTTAACP+F Y P+ DSTVV LLK AGAI+IGKTNL
Sbjct: 69   HEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIIIGKTNL 128

Query: 125  DQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAA 184
            DQFATGLVGTRSPYG+TPCVFSDKHV           V RGIVPIALGTDTAGSGRVPAA
Sbjct: 129  DQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 188

Query: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244
            LNN+IGLKPT+G+FSCSGVVPACKSLDCVSVF+MNLSDAE+C K+M K D+ENDEYSR  
Sbjct: 189  LNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSF 248

Query: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304
            P+NPLQ + KN+T+AIPK V WYGE ENP LY +AI+N K  GA I  IDFEPLL LARC
Sbjct: 249  PANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLLELARC 308

Query: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364
            LYEG WVAERY AT+ F  T+P +S+LDP V  IIK+ATK+DAAD+F YEY+RQGIL+KV
Sbjct: 309  LYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQGILRKV 368

Query: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424
            +  L+DIDVLCVPTCPLNP+FEEV  EP+LVNSRQGTWTNFVNLAD++ALA+P GFR DG
Sbjct: 369  EVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDG 428

Query: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484
            LP GVTLI KKF D+ALL+LA R+    +P G+R +G F+DR V  KDD L GP +S +D
Sbjct: 429  LPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDD 488

Query: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544
            S+ LAVVGAHL+GLPL+WQLEKVNAT++ S KT+K Y+LYALPK GP+LKPGLRR+   T
Sbjct: 489  SIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGT 548

Query: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604
            GSQI+LE+YSVPKE FGEFIS VPEPLGIGSVELE+G+WVKSFICEE GY   G++DI+ 
Sbjct: 549  GSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISH 608

Query: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664
            YGGF+ YI+ +       K  F+TVL+ANRGEIAVRIIKTLK + I+S+A+YS  DKYSQ
Sbjct: 609  YGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQ 668

Query: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724
            HV+D D+  AL+G T  ETYL ++KII  AK  +  AIIPGYGFLSENA FAD+C +EGI
Sbjct: 669  HVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGI 728

Query: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784
             F+GP GE IRKLGLKHSARE+A+ AGVPLVPGS LV +A EA  IA  + YPVMVKSTA
Sbjct: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTA 788

Query: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844
            GGGGIGLQKVD+E ++ + FETV+HQG +YFGDSGVF+E+F++NARHVE+Q+MGDG GK 
Sbjct: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848

Query: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904
            +A+GERDCSLQRRNQK+IEETPAPNL   TR KM  AAE LG+ L Y+ AGTVEFIYDE+
Sbjct: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908

Query: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964
            RD+FYFLEVN RLQVEHPITEMVTGLDLVEWM++I+A   P  +  NI   GASIE R+Y
Sbjct: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVY 968

Query: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024
            AENP KDFRPSPG L DV FP   RVDTWV KGT +S E+DPTLAKIIVHGKDRN+AI+K
Sbjct: 969  AENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILK 1028

Query: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084
            M KALNET +YGC+TN+DYL+S+ SSEMF+ A+++T  L++Y+Y P A E+  PGA TT+
Sbjct: 1029 MKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI 1088

Query: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETXXXX 1144
            QDYPGRV YWRIGVPP GPMD YSFRLANRIVGN  + P IE+TL GP I F++++    
Sbjct: 1089 QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSI 1148

Query: 1145 XXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204
                  C L++K I   +PI V  G  L+IGK+  G RAYLAIRGGIDVP+Y+GS STF 
Sbjct: 1149 AGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFT 1208

Query: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264
            +GN+GG+NGR LK GDVL L Q   +   +P P + P+  P  + P I +D  WTIGV  
Sbjct: 1209 MGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLA 1268

Query: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324
            GPHG+PD F+ E + EFF  +WKVHYNSNRFGVRLIGPKPKW+R DGGEGGLHPSN HDY
Sbjct: 1269 GPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDY 1328

Query: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384
            VYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV EAE+WKVGQ+KPGD+I F PI +Q A
Sbjct: 1329 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSA 1388

Query: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444
            R LKE+QD  I  +    LQ L+   +L + EDP+L Q   +   SPKV YRQAGDRYIL
Sbjct: 1389 RNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYIL 1448

Query: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504
            +EYG++  +LN+ YRI  LI+++ +  T GI EMSQGVRSVL+EYDGY+ISQ  LL TL+
Sbjct: 1449 IEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLI 1508

Query: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564
            AYE ++  +KNWS+KS+IF+LP+AFED +TL CV RYQETIRSKAPWLPNNVDFVAEVN+
Sbjct: 1509 AYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNN 1568

Query: 1565 ITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624
            +TH D+  ++Y+ R            +PCA+PLDPR+R LGSKYNPSRT+TK GVVGIGG
Sbjct: 1569 LTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGG 1628

Query: 1625 MYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRFT 1684
             YMCIYA DSPGGYQLVGRTIPIWD+L L S   E PWLL+PFDQ+EFYPVSEE++D +T
Sbjct: 1629 SYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDE-PWLLSPFDQIEFYPVSEEQIDEYT 1687

Query: 1685 EDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQELE 1744
            ++ +NG + + V++ VFDH +YLKW+ +NIE+I E Q++Q G    +FA+ IQ AN +L+
Sbjct: 1688 DEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLK 1747

Query: 1745 SSTTNKSAVEEEYPE-DAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPA 1803
             +TT    +E+   E D E ++SEY+GRFWKP+V  G ++ K  G+ ++EAMKTEM+V +
Sbjct: 1748 QTTT--EVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSS 1805

Query: 1804 KKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
               GK+ K + KNGDMVDAG  VA+IQ
Sbjct: 1806 SVVGKLKKFLFKNGDMVDAGDPVAIIQ 1832

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 2382 bits (6174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1142/1826 (62%), Positives = 1418/1826 (77%), Gaps = 15/1826 (0%)

Query: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64
            T+GW++Q W +FH +++ + S   LL+L  +++ A    AWIS+ ++ ++ HQW+VLQS+
Sbjct: 7    TVGWTSQQWREFHRRASADASLARLLALAHAERDA--GAAWISVASDEHIEHQWRVLQSR 64

Query: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124
             ++Q+LPLYGVP+AVKDNID +G  TTAACP+F Y  + D+T V LL+DAGA+++GKTN+
Sbjct: 65   GDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTNM 124

Query: 125  DQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAA 184
            DQFATGLVGTRSPYG     FS  H            V RG VP+ LGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTAGSGRVPAA 184

Query: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244
            LNNL+G+KPT+G  SC+GVVPAC+SLDCVSVFA +++DA RC +++A+PD  +D YSRP 
Sbjct: 185  LNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-GSDPYSRPS 243

Query: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304
            P++  ++      + +P+E  W+GE++N KL+A A + ++  GA +V +D +PLL L R 
Sbjct: 244  PADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGRS 303

Query: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364
            LYEG WVAERY A + F++  PP  +LDPTVT II +A  Y AAD F +  +RQ ++  +
Sbjct: 304  LYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAAI 363

Query: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424
            +  L  +D L VPTCPLNPT   +AAEP+LVN+RQG WTNFVNLAD+AA+A+PAGFR DG
Sbjct: 364  EAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRDG 423

Query: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484
            LPQGVTL+G+KF+D ALLEL +R  +V   +  R  G     Q   +D+ + G +   + 
Sbjct: 424  LPQGVTLVGRKFSDLALLELGSRLLRVEDAE-PRRCGALPAGQALCEDEVVSGSE-ERDS 481

Query: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544
            +V LAVVGAHL+GL L+WQL++V A ++   +T+ +Y+LYALPKTGP+LKP LRRV    
Sbjct: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541

Query: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604
            G+ I+LE YSVP+  FG F++MVP PL IGSVELESGE++KSF+CEE GY Q GTVDIT 
Sbjct: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601

Query: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664
             GGF++Y++ L+++   V KPF+TVL+ANRGEIAVRII+TLK+L IRSVAVYSDPD++SQ
Sbjct: 602  LGGFRRYVEHLRRQR-DVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660

Query: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724
            HV DAD+ VAL G +AAETYLDIDKI+ AAK T+ QAIIPGYGFLSENA FA++C  EGI
Sbjct: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720

Query: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784
            VFVGPSG++IRKLGLKH ARE+A  AGVPL  G+GL+ SA  A E   ++ YP+MVKSTA
Sbjct: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780

Query: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844
            GGGGIGLQ+VDS  E+   FE VQ QG+ YF DSGVFLE F+  ARHVE+Q+MGDG+G+ 
Sbjct: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840

Query: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904
            +A+GERDCSLQRRNQKIIEETPAPNL   TR KMRQAA+ L S +KYKCAGTVEF+YDE+
Sbjct: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900

Query: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWMLRIAA+  PDF+ A + + G S+EAR+Y
Sbjct: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFD-AGVEIEGVSMEARVY 959

Query: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024
             ENP K F PSPGLLT+V FP WARVDTW+ KGT V+AEYDPTLAKIIVHGKDR DA+ K
Sbjct: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019

Query: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084
            +  AL+ET + GC+TN+DYL+SIASSE F+ A V T++L+ ++Y P AFEV  PGAYTT+
Sbjct: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079

Query: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETXXXX 1144
            QDYPGRVGYWRIGVPPSGPMD+YSFRLANR+VGN  KA A+E+TLNGP++ FH++     
Sbjct: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139

Query: 1145 XXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204
                   +LN KP+ Q  P+ + +GD L IGKL  G RAYLA+RGGIDVPE+LGSRSTFA
Sbjct: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199

Query: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264
            +G +GG+NGRVL  GDVLF+N+    SS   G   +    P+ L P I  +  W IG+ C
Sbjct: 1200 MGGIGGHNGRVLAPGDVLFINKD---SSVAVG---DTVTIPSGLQPVIPRES-WKIGLVC 1252

Query: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324
            GPHGSPDFFK E++EEFFS  WKVHYNSNRFG+RLIGPKPKWAR DGGE GLHPSN HDY
Sbjct: 1253 GPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDY 1312

Query: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384
            VYS+GAINFTGDEPVII ++GPSLGGFVC AVVPEAELWKVGQ+KPGD+I+FVPIS   A
Sbjct: 1313 VYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTA 1372

Query: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444
            R LK SQDAA++ L+      L   ++LP+Y+DPVL++L K+S L PKVT+RQ+GDRYIL
Sbjct: 1373 RALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYIL 1432

Query: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504
            +EYGEN+MD+NI+YRI QL  +V K+K  GIVEMSQG+RS+L+EY+GY ISQ  LL  L 
Sbjct: 1433 IEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLS 1492

Query: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564
            AYE EI FD +W +K+K+F+LP+AFEDSKTLE V RYQETIRS APWLP+N DFVA VN 
Sbjct: 1493 AYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG 1552

Query: 1565 ITHKDVENMLYSARXXXXXXXXXXXXAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624
            IT  DV ++LYSA             APCAVPLDPR R LG+KYNPSRTYT NGVVGIGG
Sbjct: 1553 ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGG 1612

Query: 1625 MYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRFT 1684
            MYMCIY  DSPGGYQL+GRTIPIW++L+LG   ++HPWLLTPFDQVEFYPVSEE ++  T
Sbjct: 1613 MYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELT 1672

Query: 1685 EDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQELE 1744
            E+ ENG F ++V+E+VFD+  Y +W+ +N ESI  F++ Q G +A EFARLI+VAN +LE
Sbjct: 1673 EEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLE 1732

Query: 1745 SSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAK 1804
            ++   K A   EYPEDA MVYSEY+GRFWK +VS GD V +GD LVI+EAMKTEMVV A 
Sbjct: 1733 TA-VRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEMVVSAT 1791

Query: 1805 KSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
              G+V+ I+H NGDMVDAG +V V++
Sbjct: 1792 ADGEVINILHANGDMVDAGNLVVVLK 1817

>Kwal_14.1803
          Length = 1174

 Score =  281 bits (719), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 171/446 (38%), Positives = 260/446 (58%), Gaps = 11/446 (2%)

Query: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685
            +L+ANRGEI +RI ++  +L++++VA+YS  D+ S H + AD    +  +   T    YL
Sbjct: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79

Query: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745
             ID+I++ AK+ N   I PGYGFLSEN+EFA K  E GI ++GPS E I  +G K SAR 
Sbjct: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139

Query: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804
            +A KA VP+VPG+ G + S +EA+    +  YPV++K+  GGGG G++ V   ++I   F
Sbjct: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIADAF 199

Query: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864
            +    + K  FG+   F+ERF+   +H+E+Q++ DGYG  + + ERDCS+QRR+QK++E 
Sbjct: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259

Query: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924
             PA  L +  R  +   A  L S+  YK AGT EF+ D+ ++  YF+E+N R+QVEH IT
Sbjct: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHTIT 318

Query: 925  EMVTGLDLVEWMLRIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981
            E +TG+D+V   ++IAA  +          I   G +I+ R+  E+PAK+F+P  G +  
Sbjct: 319  EEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRIEV 378

Query: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038
                     R+D   +  G+ +S  YD  L K    G        KM +AL E  + G  
Sbjct: 379  YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 438

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064
            TNI +L ++ ++ +F      T  +D
Sbjct: 439  TNIPFLLTLLTNPVFIDGTYWTTFID 464

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 40/72 (55%)

Query: 1759 EDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGD 1818
             D+  + +  +G   +  V  G  V +G  + ++ AMK EMV+ +   G+V +++ K+G+
Sbjct: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGE 1155

Query: 1819 MVDAGGIVAVIQ 1830
             VDA  ++  ++
Sbjct: 1156 NVDASDLLVYLE 1167

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  281 bits (719), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 168/459 (36%), Positives = 259/459 (56%), Gaps = 14/459 (3%)

Query: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685
            +L+ANRGEI +RI ++  +L++R++A+YS  D+ S H + AD    +      T    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82

Query: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745
             +D+II+ AK      I PGYGFLSEN+EFADK V+ GI ++GP  E I  +G K SAR 
Sbjct: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142

Query: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804
            +A +A VP VPG+ G + + +EA +  N+  YPV++K+  GGGG G++ V   +++   F
Sbjct: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAF 202

Query: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864
            +    + +  FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QK++E 
Sbjct: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924
             PA  L    R  +   A  L  +  Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321

Query: 925  EMVTGLDLVEWMLRIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981
            E +TG+D+V   ++IAA             I   G SI+ R+  E+P+K+F+P  G L  
Sbjct: 322  EEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV 381

Query: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038
                     R+D   +  G T+S  YD  L K    G        KM +AL E  + G  
Sbjct: 382  YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 441

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077
            TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 442  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 477

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791
            R I+VA+  Q ++S    K+ V + +   A M     +G   +  V  G  V KG+ + +
Sbjct: 1077 RKIRVADKSQNIQSVAKPKADVHDTHQIGAPM-----AGVIIEVKVHKGSLVKKGESIAV 1131

Query: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            + AMK EMVV +   G+V  +  K+G+ VDA  ++ V++
Sbjct: 1132 LSAMKMEMVVSSPADGQVKDVFIKDGESVDASDLLVVLE 1170

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  280 bits (717), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 173/459 (37%), Positives = 257/459 (55%), Gaps = 14/459 (3%)

Query: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685
            +L+ANRGEI +RI ++  +L++R+VA+YS  D+ S H + AD    +      T    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82

Query: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745
             ID+II  AK      I PGYGFLSENAEFADK  + GI ++GP  E I  +G K SAR 
Sbjct: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142

Query: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804
            +A KA VP VPG+ G + + +EA++  NK  YPV++K+  GGGG G++ V   +++   F
Sbjct: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVADAF 202

Query: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864
            +  + +    FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QK++E 
Sbjct: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924
             PA  L    R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321

Query: 925  EMVTGLDLVEWMLRIAADDA-PDFE--SANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981
            E +TG+DLV   ++IAA  + P        I   G +I+ R+  E+PAK+F+P  G L  
Sbjct: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 381

Query: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038
                     R+D   +  G  +S  YD  L K    G        KM +AL E  + G  
Sbjct: 382  YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 441

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077
            TNI +L ++ +  +F +    T  +D     P  F + S
Sbjct: 442  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFHMVS 477

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%)

Query: 1777 VSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            V  G  V KG  + ++ AMK EMV+ +   G V  ++ K+G+ VDA  ++ V++
Sbjct: 1116 VHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDGENVDASDLLVVLE 1169

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  278 bits (711), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 173/460 (37%), Positives = 264/460 (57%), Gaps = 16/460 (3%)

Query: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685
            +L+ANRGEI +RI +T  +L++++VA+YS  D+ S H + AD    +  +   T    YL
Sbjct: 21   LLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYL 80

Query: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745
             ID+II  AK      I PGYGFLSEN+EFA+K    GI +VGP    I  +G K SAR 
Sbjct: 81   AIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARN 140

Query: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804
            +AEKA VP+VPG+ G + + +EA+   +K  +PV++K+  GGGG G++ V   ++I   F
Sbjct: 141  LAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGGGRGMRVVREGDDISDAF 200

Query: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864
            +  + +    FG+   F+ERF++  +H+E+Q++ D YG  + + ERDCS+QRR+QK++E 
Sbjct: 201  QRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV 260

Query: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924
             PA  L E  R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 261  APAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 319

Query: 925  EMVTGLDLVEWMLRIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981
            E +TG+D+V   ++IAA    +        I   G +I+ R+  E+P+K+F+P  G + D
Sbjct: 320  EEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTGRI-D 378

Query: 982  VHFP---EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGC 1037
            V+        R+D   +  G+ +S  YD  L K    G        KM +AL E  + G 
Sbjct: 379  VYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGV 438

Query: 1038 ITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077
             TNI +L ++ +  +FK+ +  T  +D     P  FE+ S
Sbjct: 439  KTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMVS 475

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 7/99 (7%)

Query: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791
            R + VA+  Q++ES +  K+   + +      + S  +G   +  V  G  + KG  + +
Sbjct: 1074 RKVSVADRSQKVESVSKPKADAHDPF-----QIGSPMAGVVVEVKVHKGSLIAKGQPVAV 1128

Query: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            + AMK EMV+ +   G+V +++ K+G+ VDA  ++ V++
Sbjct: 1129 LSAMKMEMVISSPADGQVKEVLVKDGENVDASDLLVVLE 1167

>Scas_686.17
          Length = 1176

 Score =  276 bits (706), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 174/459 (37%), Positives = 257/459 (55%), Gaps = 14/459 (3%)

Query: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685
            +L+ANRGEI +RI ++  +L++R+VA+YS  D+ S H + AD    +      T    YL
Sbjct: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81

Query: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745
             ID+II  AK      I PGYGFLSEN+EFADK  + GI ++GP  E I  +G K SAR 
Sbjct: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141

Query: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804
            +A +A VP VPG+ G + S KEA++   +  YPV++K+  GGGG G++ V    +I   F
Sbjct: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGGRGMRVVREGEDINDAF 201

Query: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864
            +    +    FGD   F+ERF+++ +H+E+Q++GD YG  + + ERDCS+QRR+QK++E 
Sbjct: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261

Query: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924
             PA N+    R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320

Query: 925  EMVTGLDLVEWMLRIAADDA---PDFESANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981
            E +TG+DLV   ++IAA  +          I   G +I+ R+  E+PAK+F+P  G L  
Sbjct: 321  EEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 380

Query: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038
                     R+D   +  G  +S  YD  L K    G        KM +AL E  + G  
Sbjct: 381  YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077
            TNI +L ++ +  +F +    T  +D     P  F++ S
Sbjct: 441  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFKMVS 476

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791
            R I+V +  Q++E+    K+   + Y   A M     +G   +  V  G  V KG+ + +
Sbjct: 1075 RKIRVVDRSQKVETIAKPKADAHDPYQIGAPM-----AGVVVEVKVHKGSLVKKGEAVAV 1129

Query: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            + AMK EMV+ +   G+V +++  NG+ VDA  ++ V++
Sbjct: 1130 LSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLE 1168

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  275 bits (702), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 178/487 (36%), Positives = 274/487 (56%), Gaps = 26/487 (5%)

Query: 603  TKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKY 662
            ++  GF+++ + L ++          VL+ANRGEI +RI +T  +L++ +VAVYS  D+ 
Sbjct: 3    SQLAGFRRHSNLLGEKN--------KVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54

Query: 663  SQHVIDADLGVALNGR----TAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADK 718
            S H   AD    + GR    T    YL ID+I++ A+D +   I PGYGFLSENAEFA K
Sbjct: 55   SMHRQKADEAYMI-GREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAK 113

Query: 719  CVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYP 777
                GI ++GP    I  +G K SAR +A  A VP VPG+ G ++S +EA+E   K  YP
Sbjct: 114  VEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYP 173

Query: 778  VMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMM 837
            V++K+  GGGG G++ V   ++I   F+  + + +  FG+   F+ERF++  +H+E+Q++
Sbjct: 174  VIIKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLL 233

Query: 838  GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTV 897
             D YG  + + ERDCS+QRR+QK++E  PA  L +  R  +   A  L     Y+ AGT 
Sbjct: 234  ADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTA 293

Query: 898  EFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPD---FESANIVV 954
            EF+ D +++  YF+E+N R+QVEH ITE +TG+D+V   ++IAA  + +        I  
Sbjct: 294  EFLVD-KQNRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITT 352

Query: 955  TGASIEARLYAENPAKDFRPSPGLLTDVHFP---EWARVDTWVS-KGTTVSAEYDPTLAK 1010
             G +I+ R+  E+P+K+F+P  G L DV+        R+D   +  G  +S  YD  L K
Sbjct: 353  RGFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVK 411

Query: 1011 IIVHGKDRNDAIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKP 1070
                G        KM +AL E  + G  TNI +L ++ +  +F +    T  +D     P
Sbjct: 412  CSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TP 468

Query: 1071 CAFEVTS 1077
              FE+ +
Sbjct: 469  QLFEMVA 475

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791
            R + VA+  Q+LE+ +  K+   +++   A M     +G   +  V  G  VTKG  + +
Sbjct: 1074 RKVSVADKSQKLETVSKLKADAHDQFQVGAPM-----AGVIIEVKVHKGSAVTKGQPVAV 1128

Query: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            + AMK EMV+ +   G+V  +   +G+ V+A  ++  ++
Sbjct: 1129 LSAMKMEMVISSPSDGQVKDVFVSDGETVEASDLLVQLE 1167

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  269 bits (688), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 173/484 (35%), Positives = 266/484 (54%), Gaps = 22/484 (4%)

Query: 604  KYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYS 663
            K+ G +   + L ++          +L+ANRGEI +RI +T  +L++++VA+YS  D+ S
Sbjct: 5    KFAGLRDNFNLLGEKN--------KILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLS 56

Query: 664  QHVIDADLGVALN---GRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV 720
             H   AD    +      T    YL ID+II  A+      I PGYGFLSEN+EFADK V
Sbjct: 57   THKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVV 116

Query: 721  EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVM 779
            + GI ++GP  E I  +G K SAR +A KA VP VPG+ G + + +EA +  N+  YPV+
Sbjct: 117  KAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176

Query: 780  VKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGD 839
            +K+  GGGG G++ V   +++   F+    + +  FG+   F+ERF++  +H+E+Q++ D
Sbjct: 177  IKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 236

Query: 840  GYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEF 899
             +G  + + ERDCS+QRR+QK++E  PA  L    R  +   A  L     Y+ AGT EF
Sbjct: 237  NHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEF 296

Query: 900  IYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDA-PDFE--SANIVVTG 956
            + D  ++  YF+E+N R+QVEH ITE +TG+D+V   ++IAA  + P        I   G
Sbjct: 297  LVDN-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRG 355

Query: 957  ASIEARLYAENPAKDFRPSPGLLTDVHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIV 1013
             +I+ R+  E+PAK+F+P  G +           R+D   +  GT +S  YD  L K   
Sbjct: 356  FAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSC 415

Query: 1014 HGKDRNDAIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAF 1073
             G        KM +AL E  + G  TNI +L ++ ++ +F      T  +D     P  F
Sbjct: 416  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLF 472

Query: 1074 EVTS 1077
            ++ S
Sbjct: 473  QMVS 476

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 1734 RLIQVANQELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVE 1793
            R I+VA++  +  T  KS  +   P     + +  +G   +  V  G  + KG  + ++ 
Sbjct: 1076 RKIRVADRSQKVETVTKSKADMHDPLH---IGAPMAGVIVEVKVHKGSLIKKGQPVAVLS 1132

Query: 1794 AMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            AMK EM++ +   G+V ++   +G+ VD+  ++ +++
Sbjct: 1133 AMKMEMIISSPSDGQVKEVFVSDGENVDSSDLLVLLE 1169

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  265 bits (676), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 171/462 (37%), Positives = 258/462 (55%), Gaps = 16/462 (3%)

Query: 627  ETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAET 683
            + +L+ANRGEI +RI +T  +L++R+VA+YS  D+ S H + AD    +      T    
Sbjct: 24   DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGA 83

Query: 684  YLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSA 743
            YL ID+II  AK      I PGYGFLSEN+EFADK  + GI ++GP  E I  +G K SA
Sbjct: 84   YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSA 143

Query: 744  REIAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIER 802
            R +A KA VP VPG+ G + + +EA+    +  YPV++K+  GGGG G++ V    +I  
Sbjct: 144  RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGGGRGMRVVREGEDIGD 203

Query: 803  VFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKII 862
             F+    + K  FG+   F+ERF++  +H+E+Q++ D +G  I + ERDCS+QRR+QK++
Sbjct: 204  AFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVV 263

Query: 863  EETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHP 922
            E  PA  L    R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 264  EVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHT 322

Query: 923  ITEMVTGLDLVEWMLRIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLL 979
            ITE +TG+D+V   ++IAA  +          I   G +I+ R+  E+PAK+F+P  G +
Sbjct: 323  ITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 382

Query: 980  TDVHFP---EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVY 1035
             +V+        R+D   +  G  +S  YD  L K    G        K+ +AL E  + 
Sbjct: 383  -EVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIR 441

Query: 1036 GCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077
            G  TNI +L ++ +  +F + +  T  +D     P  F + S
Sbjct: 442  GVKTNIPFLLTLLTHPVFISGQYWTTFIDD---TPQLFHMVS 480

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 1777 VSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            V  G  V KG  + I+ AMK EMVV ++  G+V  +  K+ + V+A  ++ +++
Sbjct: 1120 VHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAENVEASDLLVLLE 1173

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  253 bits (647), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 247/438 (56%), Gaps = 14/438 (3%)

Query: 650  IRSVAVYSDPDKYSQHVIDADLG--VALNGR-TAAETYLDIDKIIKAAKDTNAQAIIPGY 706
            +++VA+YS+ D+ S H + AD    +   G+ T    YL ID+II  AK+     I PGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 707  GFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGS-GLVTSAK 765
            GFLSENAEFA K ++ GI ++GP  E I  +G K SAR++A KA VP VPG+ G + S +
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 766  EAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERF 825
            EA+    +  YPV++K+  GGGG G++ V   ++I   F+    + K  FG+   F+ERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 826  VENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESL 885
            ++  +H+E+Q++ D YG  I + ERDCS+QRR+QK++E  PA  L +  R  +   A  L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 886  GSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAP 945
                KY+ AGT EF+ D  ++  YF+E+N R+QVEH ITE +TG+D+V   ++IAA  + 
Sbjct: 241  AKEAKYRNAGTAEFLVDA-QNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASL 299

Query: 946  D---FESANIVVTGASIEARLYAENPAKDFRPSPGLLTDVHFP--EWARVDTWVS-KGTT 999
                     I   G +I+ R+  E+P+K+F+P  G +           R+D   +  G  
Sbjct: 300  QQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAV 359

Query: 1000 VSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVA 1059
            +S  YD  L K    G        KM +AL E  + G  TNI +L ++ +  +FK+ +  
Sbjct: 360  ISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYW 419

Query: 1060 TKILDSYDYKPCAFEVTS 1077
            T  +D     P  FE+ S
Sbjct: 420  TTFIDD---TPQLFEMVS 434

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 49/91 (53%), Gaps = 5/91 (5%)

Query: 1740 NQELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEM 1799
            +Q++E+ +  K+   + Y   A M     +G   +  V  G  V KG  + ++ AMK EM
Sbjct: 1041 SQKVETISKPKADAHDPYQVGAPM-----AGVVVEVKVHKGSLVKKGQPVAVLSAMKMEM 1095

Query: 1800 VVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            V+ +  +G V  ++ K+G+ VD+  ++ V++
Sbjct: 1096 VISSPAAGLVKDVLIKDGENVDSSDLLVVLE 1126

>Scas_563.12
          Length = 1216

 Score =  253 bits (647), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 160/446 (35%), Positives = 246/446 (55%), Gaps = 14/446 (3%)

Query: 642  IKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVAL---NGRTAAETYLDIDKIIKAAKDTN 698
             ++  +L++++VA+YS  D+ S H + AD    +   +  T    YL ID+II  AK   
Sbjct: 76   FRSAHELSMQTVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHG 135

Query: 699  AQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGS 758
               I PGYGFLSEN+EFADK  + GI ++GP    I  +G K SAR +A KA VP VPG+
Sbjct: 136  VDYIHPGYGFLSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGT 195

Query: 759  -GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
             G + + ++A++  N+  YPV++K+  GGGG G++ V+  +++   F+    +    FGD
Sbjct: 196  PGPIRTVQDAQDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGD 255

Query: 818  SGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTK 877
               F+ERF+   +H+E+Q++ D +G  I + ERDCS+QRR+QK++E  PA  L    R  
Sbjct: 256  GTCFVERFLNKPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDA 315

Query: 878  MRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWML 937
            +   A  L     Y+ AGT EF+ D+ ++  YF+E+N R+QVEH ITE +TG+D+V   +
Sbjct: 316  ILTDAVKLAKECGYQNAGTAEFLVDD-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQI 374

Query: 938  RIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLLT--DVHFPEWARVDT 992
            +IAA  + +        I   G +I+ R+  E+PAK+F+P  G L   D       R+D 
Sbjct: 375  QIAAGASLEQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDG 434

Query: 993  WVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCITNIDYLRSIASSE 1051
              +  G  +S  YD  L K    G        KM +AL E  + G  TNI +L ++ +  
Sbjct: 435  GNAYAGAIISPHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHP 494

Query: 1052 MFKTAKVATKILDSYDYKPCAFEVTS 1077
            +F      T  +D     P  F++ S
Sbjct: 495  VFIAGDYWTTFIDD---TPQLFKMVS 517

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 1740 NQELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEM 1799
            +Q++E+    K+   + +   A M     +G   +  V  G  V KG+ + ++ AMK EM
Sbjct: 1125 SQKVETVAKPKADTHDPFQIGAPM-----AGVIVEVKVHKGSLVKKGEAVAVLSAMKMEM 1179

Query: 1800 VVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830
            V+ +   G V +++    + VDA  ++ +++
Sbjct: 1180 VISSPADGLVKEVLVNESENVDASDLLVLLE 1210

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  231 bits (588), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 253/506 (50%), Gaps = 74/506 (14%)

Query: 629  VLIANRGEIAVRIIKTLKK-----------LNIRSVAVYSDPDKYSQHVIDADLGVALNG 677
            VLIAN G  AV+ I++++K           +   ++A   D +  ++++  AD  + + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEVPG 122

Query: 678  RTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV--EEGIVFVGPSGEAIR 735
             T    Y ++D I++ A+  +  A+  G+G  SEN    ++       I+F+GP G A+R
Sbjct: 123  GTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNAMR 182

Query: 736  KLGLKHSAREIAEKAGVPLVPGSG-------------------------LVTSAKEAKEI 770
             LG K S+  +A+ A VP +P SG                           +S ++  + 
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGLKK 242

Query: 771  ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
            A ++ +P+MVK++ GGGG G++KV++E+E    F ++  Q       S +F+ +    AR
Sbjct: 243  AKEIGFPIMVKASEGGGGKGIRKVENEDE----FLSLYQQAANEIPGSPIFIMKLAGKAR 298

Query: 831  HVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLK 890
            H+E+Q++ D YG  I++  RDCS+QRR+QKIIEE P       T T+M +AA  LG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVG 358

Query: 891  YKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 940
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 359  YVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRD 418

Query: 941  ----------ADDAPDF-----ESANI----VVTGASIEARLYAENPAKDFRPSPGLLTD 981
                      +    DF     ESA         G     R+ +E+P + F+PS G L +
Sbjct: 419  IRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHE 478

Query: 982  VHFPEWARVDTWVSKGTT--VSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI- 1038
            ++F   + V  + S G    + +  D     I   G++R  +   M  AL E  + G   
Sbjct: 479  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 538

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064
            T ++YL  +  +E F+   + T  LD
Sbjct: 539  TTVEYLIKLLETEDFEDNTITTGWLD 564

>Scas_720.74
          Length = 2231

 Score =  230 bits (586), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 251/506 (49%), Gaps = 74/506 (14%)

Query: 629  VLIANRGEIAVRIIKTLKK-----------LNIRSVAVYSDPDKYSQHVIDADLGVALNG 677
            +LIAN G  AV+ I++++K           +   ++A   D +  ++++  AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 678  RTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV--EEGIVFVGPSGEAIR 735
             T  + Y ++D I+  A+  +  A+  G+G  SEN    +K    +  +VF+GP G A+R
Sbjct: 122  GTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGSAMR 181

Query: 736  KLGLKHSAREIAEKAGVPLVPGSG-------------LVTSAKEAK------------EI 770
             LG K S+  +A+ A VP +P SG             LV+ A E              E 
Sbjct: 182  SLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDGLEK 241

Query: 771  ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
            A K+ +PVM+K++ GGGG G+++V+ E +    F  + HQ       S +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLAGKAR 297

Query: 831  HVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLK 890
            H+E+Q++ D YG  I++  RDCS+QRR+QKIIEE P       T   M ++A  LG L+ 
Sbjct: 298  HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGKLVG 357

Query: 891  YKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRI----------- 939
            Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMVTG++L    L+I           
Sbjct: 358  YVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHRISD 417

Query: 940  -----------AADDAPDFESANIVVT-------GASIEARLYAENPAKDFRPSPGLLTD 981
                       A++   DF +   + T       G     R+ +E+P + F+PS G L +
Sbjct: 418  IRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGSLHE 477

Query: 982  VHFPEWARVDTWVSKGTT--VSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI- 1038
            ++F   + V  + S G    + +  D     I   G++R  +   M  AL E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064
            T ++YL  +  +E F+   + T  LD
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLD 563

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  229 bits (585), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 160/506 (31%), Positives = 252/506 (49%), Gaps = 74/506 (14%)

Query: 629  VLIANRGEIAVRIIKTLKK-----------LNIRSVAVYSDPDKYSQHVIDADLGVALNG 677
            VLIAN G  AV+ I++++K           +   ++A   D +  ++++  AD  V + G
Sbjct: 62   VLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 678  RTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV--EEGIVFVGPSGEAIR 735
             T    Y ++D I+  A+  +  A+  G+G  SEN    +K    +  I+F+GP G A+R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAMR 181

Query: 736  KLGLKHSAREIAEKAGVPLVPGSG-------------------------LVTSAKEAKEI 770
             LG K S+  +A+ A VP +P SG                           +S ++  E 
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLEK 241

Query: 771  ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
            A K+ +PVM+K++ GGGG G+++V  E +    F  + HQ       S +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVTREED----FINLYHQAANEIPGSPIFIMKLAGKAR 297

Query: 831  HVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLK 890
            H+E+Q++ D YG  I++  RDCS+QRR+QKIIEE P    G  T  +M +AA  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVG 357

Query: 891  YKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 940
            Y  AGTVE++Y    ++FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISD 417

Query: 941  ------------ADDAPDFESANIVVT-------GASIEARLYAENPAKDFRPSPGLLTD 981
                        ++   +F+S + + T       G     R+ +E+P   F+PS G L +
Sbjct: 418  IRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNE 477

Query: 982  VHFPEWARVDTWVSKGTT--VSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI- 1038
            ++F   + V  + S G    + +  D     I   G++R  +   M  AL E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064
            T ++YL  +  +E F+   + T  LD
Sbjct: 538  TTVEYLIKLLETEDFEENTITTGWLD 563

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  226 bits (576), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 161/506 (31%), Positives = 251/506 (49%), Gaps = 74/506 (14%)

Query: 629  VLIANRGEIAVRIIKTLKK-----------LNIRSVAVYSDPDKYSQHVIDADLGVALNG 677
            +LIAN G  AV+ I++++K           +    +A   D +  ++++  AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVPG 121

Query: 678  RTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV--EEGIVFVGPSGEAIR 735
             T    Y ++D I+  A+  +  A+  G+G  SEN    +K    +  +VF+GP G A+R
Sbjct: 122  GTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGSAMR 181

Query: 736  KLGLKHSAREIAEKAGVPLVPGSG-------------LVT------------SAKEAKEI 770
             LG K S+  +A+ A VP +P SG             LV+            S ++    
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDGLNK 241

Query: 771  ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
            A ++ +PVMVK++ GGGG G++KV  E +    F ++  Q       S +F+ +    AR
Sbjct: 242  AKQIGFPVMVKASEGGGGKGIRKVVREED----FISLYQQAANEIPGSPIFIMKLAGKAR 297

Query: 831  HVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLK 890
            H+E+Q++ D YG  I++  RDCS+QRR+QKIIEE P       T  +M +AA  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGKLVG 357

Query: 891  YKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 940
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRD 417

Query: 941  ------------ADDAPDFESANIVVT-------GASIEARLYAENPAKDFRPSPGLLTD 981
                         +   +F SA+ + T       G     R+ +E+P + F+PS G L +
Sbjct: 418  IRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGSLHE 477

Query: 982  VHFPEWARVDTWVSKGTT--VSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI- 1038
            ++F   + V  + S G    + +  D     I   G++R  +   M  AL E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064
            T ++YL  +  +E F+   + T  LD
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLD 563

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 1770 GRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVI 1829
            G+    +V +GD +  G     +E MK +M + A++SG VL+++ + G  + AG I+A++
Sbjct: 709  GKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESG-VLQLLRQPGSTLAAGDILAIL 767

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  225 bits (573), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 154/476 (32%), Positives = 239/476 (50%), Gaps = 58/476 (12%)

Query: 643  KTLKKLNIRSVAVYSDPDKY---SQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNA 699
            +T     I    V + PD     S+++  AD  V + G T    Y +ID I+  A+ T+ 
Sbjct: 10   ETFNDEKIIQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDV 69

Query: 700  QAIIPGYGFLSENAEFADKCV--EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
             A+  G+G  SEN    +     +  I+F+GP G A+R LG K S+  +A+ A +P +P 
Sbjct: 70   DAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPW 129

Query: 758  SG-------------------------LVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQ 792
            SG                           +S ++A E A  + +PVM+K++ GGGG G++
Sbjct: 130  SGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIR 189

Query: 793  KVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDC 852
            +VD+E++    F  +  Q       S +F+ + V +ARH+E+Q++ D YG  I +  RDC
Sbjct: 190  RVDNEDD----FIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDC 245

Query: 853  SLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLE 912
            S+QRR+QKIIEE P       T  +M +AA  LG L+ Y  AGTVE++Y  + D+FYFLE
Sbjct: 246  SIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLE 305

Query: 913  VNARLQVEHPITEMVTGLDLVEWMLRIA--------------------ADDAPDFESANI 952
            +N RLQVEHP TEM++G++L    L+IA                         DF++   
Sbjct: 306  LNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKR 365

Query: 953  -VVTGASIEARLYAENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTT--VSAEYDPTLA 1009
                G  I  R+ +E+P + F+PS G + +++F   + V  + S G    + +  D    
Sbjct: 366  PSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFG 425

Query: 1010 KIIVHGKDRNDAIMKMNKALNETVVYGCI-TNIDYLRSIASSEMFKTAKVATKILD 1064
             I   G DR DA   M  AL +  + G   T I+YL  +  +  F++  ++T  LD
Sbjct: 426  HIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLD 481

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  224 bits (570), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 155/506 (30%), Positives = 247/506 (48%), Gaps = 74/506 (14%)

Query: 629  VLIANRGEIAVRIIKTLKK-----------LNIRSVAVYSDPDKYSQHVIDADLGVALNG 677
            +LIAN G  AV+ I++++K           +   ++A   D +  ++++  AD  + + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPG 121

Query: 678  RTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVE--EGIVFVGPSGEAIR 735
             T    Y ++D I+  A+  +  A+  G+G  SEN    +K  +    ++F+GP G A+R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMR 181

Query: 736  KLGLKHSAREIAEKAGVPLVPGSG-------------------------LVTSAKEAKEI 770
             LG K S+  +A+ A VP +P SG                           TS ++  + 
Sbjct: 182  SLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQK 241

Query: 771  ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
            A ++ +PVM+K++ GGGG G+++V+ E +    F  + HQ       S +F+ +    AR
Sbjct: 242  AKRIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLAGRAR 297

Query: 831  HVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLK 890
            H+E+Q++ D YG  I++  RDCS+QRR+QKIIEE P       T  +M +AA  LG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVG 357

Query: 891  YKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 940
            Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMV+G++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISD 417

Query: 941  ----------ADDAPDFESANIVVT---------GASIEARLYAENPAKDFRPSPGLLTD 981
                      +    DFE      T         G     R+ +E+P   F+PS G L +
Sbjct: 418  IRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHE 477

Query: 982  VHFPEWARVDTWVSKGT--TVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI- 1038
            ++F   + V  + S G    + +  D     I   G++R  +   M  AL E  + G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064
            T ++YL  +  +E F+   + T  LD
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLD 563

>Kwal_23.6157
          Length = 2230

 Score =  223 bits (568), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 164/508 (32%), Positives = 252/508 (49%), Gaps = 78/508 (15%)

Query: 629  VLIANRGEIAVRIIKTLKKL------NIRSV-----AVYSDPDKYSQHVIDADLGVALNG 677
            VLIAN G  AV+ I++++K       N R+V     A   D +  ++++  AD  V + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEVPG 122

Query: 678  RTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVE--EGIVFVGPSGEAIR 735
             T    Y ++D I++ A+  +  A+  G+G  SEN    ++       ++F+GP G A+R
Sbjct: 123  GTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPGNAMR 182

Query: 736  KLGLKHSAREIAEKAGVPLVPGSG-------------LVT------------SAKEAKEI 770
             LG K S+  +A+ A VP +P SG             LV+            S ++    
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPEDGLAK 242

Query: 771  ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
            A K+ +PVMVK++ GGGG G++KV+ E +    F  +  Q       S +F+ +   NAR
Sbjct: 243  AKKIGFPVMVKASEGGGGKGIRKVEREQD----FIPLYKQAANEIPGSPIFIMKLAGNAR 298

Query: 831  HVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLK 890
            H+E+Q++ D YG  I++  RDCS+QRR+QKIIEE P       T T+M ++A  LG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLGKLVG 358

Query: 891  YKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRI----------- 939
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    L+I           
Sbjct: 359  YVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIKD 418

Query: 940  -----------AADDAPDFESANIVVT-------GASIEARLYAENPAKDFRPSPGLLTD 981
                       A +   DF S +           G     R+ +E+P + F+PS G L +
Sbjct: 419  IRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGGSLHE 478

Query: 982  VHFPEWARVDTW----VSKGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGC 1037
            ++F   + V  W    VS    + +  D     I   G++R  +   M  AL E  + G 
Sbjct: 479  LNFRSSSNV--WGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGD 536

Query: 1038 I-TNIDYLRSIASSEMFKTAKVATKILD 1064
              T ++YL  +  +E F+   + T  LD
Sbjct: 537  FRTTVEYLIKLLETEDFEGNSITTGWLD 564

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 1770 GRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVI 1829
            G+  K +  +GD V  G     VE MK +M + +++SG +++++ + G  V AG I+A++
Sbjct: 710  GKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESG-IIQLLKQPGSTVSAGDILAIL 768

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 116/419 (27%), Positives = 184/419 (43%), Gaps = 52/419 (12%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFE-YNPSADSTVVALLKDAGAIVIGKTNLDQFAT 129
           PL     A+KDNI +K  P+T A    + Y    D+TVV+LL +AG ++ GK N+D+F  
Sbjct: 46  PLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDEFGM 105

Query: 130 GLVGTRSPYGKT--PCV-FSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALN 186
           G  G  S +G T  P     D+ +           V  G+V  ALGTDT GS R+PA+  
Sbjct: 106 GSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRLPASYT 165

Query: 187 NLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLEN-----DEYS 241
           +  G KP+ G  S  GV+   +SLD V VFA +LS  +R F ++ K D ++     +E  
Sbjct: 166 STFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHDKKDPTSLSEELR 225

Query: 242 RPLPSNPLQKYPKNVTIAIPKE-----VPWYGET-----------ENPKLYAKAIENLKV 285
               S  L    K + I IP+E     VP                +  ++Y  +I ++K 
Sbjct: 226 HKFTS--LTTKRKTLRIGIPEEFSQESVPAEFRAAMTAIIKRLMKKGHEVYPVSIPSVKN 283

Query: 286 AGASIVTID-FEPLLALARCLYEGAWVAERYEA-TKDFFATNPPESSLDPTVTSIIKTAT 343
           A +   T+   E +  L+R  Y+G     R E+  +D     P  S+  P V + I    
Sbjct: 284 ALSIYYTLSPAEAVSNLSR--YDGVRYGYRAESDVEDGTLFTPTRSAFGPEVQNRIILGN 341

Query: 344 KYDAADSFRYEY-----QRQGILQKVDQTLK-------------DIDVLCVPTCPLNP-T 384
               ++SF+  Y      R  ++   D+  +              +D++   T    P T
Sbjct: 342 YNLCSESFKNNYIKAQKLRVQLINDFDRAFRFPNVLSGNSVNKDGVDIMLSLTSTSFPTT 401

Query: 385 FEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDGLPQGVTLIGKKFTDFALLE 443
           ++EV +E     +   T+ N +    M+   +P    P G   G+ +  +   D+ LL+
Sbjct: 402 YDEVVSEE--NKNPLNTYINDIFTMPMSLCGLPTMTVPAGHAFGIQVFSQHGNDYELLD 458

>Kwal_23.4249
          Length = 465

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 109/217 (50%), Gaps = 7/217 (3%)

Query: 33  LKSQKSAPEDPAWISLINEANLAHQWKVLQSKANKQQLPLYGVPIAVKDNIDSKGSPTTA 92
           LK   S P      +     N     ++ Q  +   + PL  +   +KDNI +K  PT+ 
Sbjct: 7   LKRLSSLPTVQKQFNAFTYINPKCHERLSQGSSADDEKPLKNILCGIKDNIATKELPTSC 66

Query: 93  ACPAF-EYNPSADSTVVALLKDAGAIVIGKTNLDQFATGLVGTRSPYGKT--PCVFSDKH 149
                 ++    ++TVV LL+ AGA+ +GKTN+D+F  G  GT S +G T  P   SD  
Sbjct: 67  GSKILKDFQSPFNATVVDLLEGAGAVTVGKTNMDEFGMGSGGTHSHFGPTRNPQFPSDNV 126

Query: 150 VXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKGLFSCSGVVPACKS 209
           +           V   +V  A+GTDT GS R+PAA  +++G KP+ G  S  GVV   +S
Sbjct: 127 IAGGSSSGSAAAVAADVVDFAIGTDTGGSVRLPAAYTSVMGFKPSYGRISRHGVVAYAQS 186

Query: 210 LDCVSVFAMNLSDAERCFKVMAKPDLEN----DEYSR 242
           LD V + A ++   ++ FKV+ K D ++    DE SR
Sbjct: 187 LDTVGILAKDIDIVQQVFKVLDKYDWKDPTSLDETSR 223

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 113/444 (25%), Positives = 179/444 (40%), Gaps = 71/444 (15%)

Query: 58  WKVLQSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFE-YNPSADSTVVALLKDAGA 116
           + +   K  K+ L   G   ++KDNI +K  PTT A    E +    D+TVV LLK AG 
Sbjct: 32  YSITNKKGTKETLT--GCVASIKDNIVTKDFPTTCASHILENFKSPFDATVVKLLKQAGV 89

Query: 117 IVIGKTNLDQFATGLVGTRSPYGKTPCV-----FSDKHVXXXXXXXXXXXVGRGIVPIAL 171
            ++GKTNLD+F  G  G  S  G  P +       DK +           V   +V  AL
Sbjct: 90  HILGKTNLDEFGMGSGGVHSIRG--PVINPLYPHEDKKIMGGSSSGAAASVACDLVDFAL 147

Query: 172 GTDTAGSGRVPAALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMA 231
           GTDT GS R+PA   +++G KP+ G  S  GV+   +SLD V + +  ++   + F  + 
Sbjct: 148 GTDTGGSVRLPACYGSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHTLD 207

Query: 232 KPDLEND-----EYSRPLPSNPLQKYPKNVTIAIPKEVPWYGETENP----KLYAKAIEN 282
           K D+++      E    +  N   + P  V I     V  +     P    +LY   +E 
Sbjct: 208 KYDMKDPTSLSVELRELIEGNKKVRRPLKVGI-----VKEFSHESMPIGFHRLYLSLLEK 262

Query: 283 LKVAGASIVTIDFEPLLALARCL--------YEGAWVAERYEA-----------TKDFFA 323
           L   G  I  +      ++  CL         E A    RY+             KD   
Sbjct: 263 LINLGLEIYPVSIP---SVKNCLPIYYTLSPAEAASNLSRYDGIRYGYRDSELDIKDGIL 319

Query: 324 TNPPESSLDPTVTSIIKTATKYDAADSFRYEY-----QRQGILQKVDQTLK--------- 369
             P  S     V + I        +D+F+  +      R  ++ + D   +         
Sbjct: 320 FAPTRSKFGTEVKNRIILGNYNLCSDAFKNNFIKAEKLRVNLIDEFDGIFRFPNVLTNSK 379

Query: 370 ----DIDVLCVPTCPLNP----TFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFR 421
                +D+L VPT    P     FEE  A+    +     +T  ++LA + +L++P    
Sbjct: 380 GNPDGLDLLIVPTSSKLPGSIRDFEEEEAKSPANSYINDVFTVPMSLAGLPSLSMPL--- 436

Query: 422 PDGLPQGVTLIGKKFTDFALLELA 445
            +  P G+ ++G+   D  +L+  
Sbjct: 437 KEKTPIGLQVVGQYGDDSTVLDFV 460

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 86/169 (50%), Gaps = 8/169 (4%)

Query: 72  LYGVPIAVKDNIDSKGSPTTAACPAFE-YNPSADSTVVALLKDAGAIVIGKTNLDQFATG 130
           L G+   +KDNI +K  PTT        Y    D+TVV LLK  G+IV+GKTNLD+F  G
Sbjct: 39  LSGLLCGIKDNIVTKDMPTTCGSEILRGYQSPYDATVVKLLKQEGSIVLGKTNLDEFGMG 98

Query: 131 LVGTRSPYGKT-----PCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAAL 185
             G  S +G T     P   +DK +           V    V  +LGTDT GS R+PA  
Sbjct: 99  SRGIHSCFGPTFNPLYPA--ADKVIMGGSSSGSAAAVVSEAVDFSLGTDTGGSVRLPATY 156

Query: 186 NNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPD 234
            ++ G KP+ G  S  GV+   +SLD V +   N+S   + + V+ K D
Sbjct: 157 GSIYGFKPSYGRISRYGVIAYAQSLDTVGILTKNISTLRKVYHVLDKYD 205

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 118/239 (49%), Gaps = 13/239 (5%)

Query: 33  LKSQKSAPEDPAWISLINEANLAHQWKVLQSKANKQQLPLYGVPIAVKDNIDSKGSPTTA 92
           L+  +  P      ++ N  NL+   +V+ S+      PL  + + +KDNI +K  PTT 
Sbjct: 5   LERLRQLPRANERFNIFNSVNLSAAQQVMPSEK-----PLGNLVVGIKDNIVTKKLPTTC 59

Query: 93  ACPAFE-YNPSADSTVVALLKDAGAIVIGKTNLDQFATGLVGTRSPYGKT--PCVFSDKH 149
           +      Y    D+TVV LL +AGA+  GKTN+D+F  G  G  S +G T  P       
Sbjct: 60  SSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEFGMGSGGIHSFFGPTLNPAFPERPT 119

Query: 150 VXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKGLFSCSGVVPACKS 209
           V           V  G+V  ALGTDT GS R+PAA  + +G KP+ G  S  GV+   +S
Sbjct: 120 VAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAYTSTVGFKPSYGRVSRHGVIAYAQS 179

Query: 210 LDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRP----LPSNPLQKYPKNVTIAIPKEV 264
           LD V + A ++    R F+V+ + D   D  S P      +  L++  K++ I IP E+
Sbjct: 180 LDTVGIGARDVGLVRRVFEVLDRHD-PKDPTSLPDELRQQAAALRREKKHLKIGIPAEL 237

>Scas_684.25
          Length = 482

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 85/167 (50%), Gaps = 3/167 (1%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAF-EYNPSADSTVVALLKDAGAIVIGKTNLDQFAT 129
           PL     AVKDNI +   PTT +      Y    D+TVV LL+++G  ++GKTN+D+FA 
Sbjct: 48  PLSNTLCAVKDNIATNDMPTTCSSSMLSNYQSPFDATVVKLLRESGTTIVGKTNMDEFAM 107

Query: 130 GLVGTRSPYGK--TPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNN 187
           G +G  S YG    P       V           V  G+V  ALGTDT GS R+PA   +
Sbjct: 108 GSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVRLPACYCS 167

Query: 188 LIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPD 234
           ++G K + G  S  GVV   +SLD V + A NL   +  F  + K D
Sbjct: 168 VLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFD 214

>Kwal_56.22295
          Length = 583

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 87/179 (48%), Gaps = 10/179 (5%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSA---DSTVVALLKDAGAIVIGKTNLDQF 127
           PL+G+P  VKDN  +K    T  C ++    S    D+ VVA L+DAGA++ G   L ++
Sbjct: 131 PLHGIPFVVKDNYATKDKMDTT-CGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLSEW 189

Query: 128 A-----TGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVP 182
           A     +   G  +  G+  C F+               V   ++P +LGT+T GS   P
Sbjct: 190 ADMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMIPFSLGTETDGSIIDP 249

Query: 183 AALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYS 241
           A  N ++G KPT GL S +GVVP  +  D     A ++ DA   F+ M   D E D Y+
Sbjct: 250 AMRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYMWGVD-ERDVYT 307

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 84/179 (46%), Gaps = 10/179 (5%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSA---DSTVVALLKDAGAIVIGKTNLDQF 127
           PL+G+P  VKDN  +K    T A  ++    S    D+ VV  L+DAGA++ G   + ++
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAG-SWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEW 198

Query: 128 A-----TGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVP 182
           A     +   G  +  G+  C F+               V   ++  +LGT+T GS   P
Sbjct: 199 ADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDP 258

Query: 183 AALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYS 241
           A  N ++G KPT GL S +GV+P  +  D     A  + DA   F+ M   D E D Y+
Sbjct: 259 AMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 84/179 (46%), Gaps = 10/179 (5%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSA---DSTVVALLKDAGAIVIGKTNLDQF 127
           PL+G+P  VKDN  +K    T A  ++    S    D+ VV  L+DAGA++ G   + ++
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAG-SWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEW 198

Query: 128 A-----TGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVP 182
           A     +   G  +  G+  C F+               V   ++  +LGT+T GS   P
Sbjct: 199 ADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDP 258

Query: 183 AALNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYS 241
           A  N ++G KPT GL S +GV+P  +  D     A  + DA   F+ M   D E D Y+
Sbjct: 259 AMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD-ERDAYT 316

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 134/300 (44%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL+  NI+++ V  +P+  S    +AD       R   ET +++++++   +  
Sbjct: 1002 AVTAVRTLRANNIKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEIE 1053

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
            N+  ++   G  + N   A     E +  +G S + I     ++    + ++ GV   P 
Sbjct: 1054 NSSGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS  EA+  A K+ YPV+V+ +    G  +  V S+N++E       +Q      D
Sbjct: 1112 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1167

Query: 818  SGVFLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +   G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1225

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++  A   +G  LK      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1226 VDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 77/194 (39%), Gaps = 21/194 (10%)

Query: 745 EIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804
           EI EK        S    S  EA     ++ +PV+V++    GG+G    ++E E+    
Sbjct: 567 EINEKCA-----KSQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKEL---- 617

Query: 805 ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RN 858
             V     A+     V +E+ ++  + VE +++ D +   I +    C+++         
Sbjct: 618 --VDLCNVAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHT 671

Query: 859 QKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQ 918
              I   P+  L +     +R  A ++   L       +++  +    ++  +EVNARL 
Sbjct: 672 GDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLS 731

Query: 919 VEHPITEMVTGLDL 932
               +    TG  L
Sbjct: 732 RSSALASKATGYPL 745

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 134/300 (44%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL+  NI+++ +  +P+  S    +AD       R   ET +++++++   +  
Sbjct: 1000 AVTAVRTLRANNIKTIMINYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEAE 1051

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
             +  ++   G  + N   A     E +  +G S + I     ++    + ++ GV   P 
Sbjct: 1052 ASNGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1109

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS  EA++ A K+ YPV+V+ +    G  +  V S+N++E       +Q      D
Sbjct: 1110 WKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1165

Query: 818  SGVFLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +   G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1166 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1223

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++  A   +G  LK      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1224 VDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIE 1281

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 94/239 (39%), Gaps = 27/239 (11%)

Query: 705 GYGFLSENAEFADKCVEEGIVFVGPSGEAI-----RKLGLKHSAREIAEKAGVPLVPGSG 759
           G   LS   E  D+    G+  +G   + I     R+L   ++  EI EK        S 
Sbjct: 521 GQTALSVGIEMKDEFESLGVKVLGTPIDTIITTEDREL-FANAIDEIDEKCA-----KSQ 574

Query: 760 LVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSG 819
              S +EA      + +PV+V++    GG+G    ++E E+      +     A+     
Sbjct: 575 AANSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQEL------IDLCNVAFASSPQ 628

Query: 820 VFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGET 873
           V +ER ++  + VE +++ D +   I +    C+++            I   P+  L + 
Sbjct: 629 VLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDE 684

Query: 874 TRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
               +R  A ++   L       +++  +    E+  +EVNARL     +    TG  L
Sbjct: 685 DYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL 743

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 134/300 (44%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL+K N +++ V  +P+  S    +AD       R   ET +++++I+   +  
Sbjct: 1000 AVTAVRTLRKNNFKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERIMDIYELE 1051

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
            ++  ++   G  + N   A     E +  +G S E I     ++    + ++  V   P 
Sbjct: 1052 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDVDQ-PA 1109

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS  EA++ A K+ YPV+V+ +    G  +  V S++++E          + Y   
Sbjct: 1110 WKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY--- 1166

Query: 818  SGVFLERFVENARHVEIQMMG-DGYGKAIAIGER--DCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +  DG      + E   +  +   +  +I   P  +L   T
Sbjct: 1167 -PVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1223

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++ +A   +G  L+      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1224 VRRIVEATAKIGRALQITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVVGVNLIE 1281

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 67/163 (41%), Gaps = 16/163 (9%)

Query: 776 YPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQ 835
           +PV+V++    GG+G     +E E+      V     A+     V +ER ++  + +E +
Sbjct: 591 FPVIVRAAYALGGLGSGFASNEKEL------VDLCNVAFASSPQVLVERSMKGWKEIEYE 644

Query: 836 MMGDGYGKAIAIGERDCSLQRRNQKIIEE------TPAPNLGETTRTKMRQAAESLGSLL 889
           ++ D +   I +    C+++  +   I         P+  L +     +R  A ++   L
Sbjct: 645 VVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNVIRHL 700

Query: 890 KYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
                  +++  +    E+  +EVNARL     +    TG  L
Sbjct: 701 GVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPL 743

>Scas_582.4*
          Length = 2193

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 133/300 (44%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL+   I+++ +  +P+  S    +AD       R   ET +++++I+   +  
Sbjct: 977  AVTAVRTLRANKIKTIMINYNPETVSTDYDEAD-------RLYFET-INLERILDIYEIE 1028

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
            N+  ++   G  + N   A     E +  +G S E I     ++    + ++ GV   P 
Sbjct: 1029 NSSGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1086

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS  EA+  A K+ YPV+V+ +    G  +  V S+N++        +Q      D
Sbjct: 1087 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRD 1142

Query: 818  SGVFLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +   G+     ++    +  +   +  +I   P  +L + T
Sbjct: 1143 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAKET 1200

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++  A   +G  LK      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1201 VDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNLIE 1258

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 94/239 (39%), Gaps = 27/239 (11%)

Query: 705 GYGFLSENAEFADKCVEEGIVFVGPSGEAI-----RKLGLKHSAREIAEKAGVPLVPGSG 759
           G   LS   E  D+    G+  +G   + I     R+L   ++  EI EK        S 
Sbjct: 518 GQTALSVGIEMKDEFESLGVKVLGTQIDTIITTEDREL-FANAIDEINEKCA-----KSH 571

Query: 760 LVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSG 819
              S +EA      + +PV+V++    GG+G    ++E E+      +     A+     
Sbjct: 572 AANSVEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQEL------IDLCNVAFASSPQ 625

Query: 820 VFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGET 873
           V +ER ++  + +E +++ D +   + +    C+++            I   P+  L + 
Sbjct: 626 VLVERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLSDE 681

Query: 874 TRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
               +R  A ++   L       +++  +    E+  +EVNARL     +    TG  L
Sbjct: 682 EYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL 740

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 135/300 (45%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL++ N++++ V  +P+  S    + D       R   ET +++++I+   +  
Sbjct: 1018 AVTAVRTLRQNNVKTIMVNYNPETVSTDYDEVD-------RLYFET-INMERILDIYEVE 1069

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
            ++  ++   G  + N   A     E +  +G S E I     ++    + ++  V   P 
Sbjct: 1070 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEVDQ-PA 1127

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS +EA++ ANK+ YPV+V+ +    G  +  V S++++E          + Y   
Sbjct: 1128 WKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY--- 1184

Query: 818  SGVFLERFVENARHVEIQMMG-DGYGKAIAIGER--DCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +  DG      + E   +  +   +  +I   P  +L   T
Sbjct: 1185 -PVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1241

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++  A   +G  LK      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1242 VRRIVDATAKIGRALKITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVIGVNLIE 1299

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 95/239 (39%), Gaps = 27/239 (11%)

Query: 705 GYGFLSENAEFADKCVEEGIVFVGPSGEAI-----RKLGLKHSAREIAEKAGVPLVPGSG 759
           G   LS   E  D+    G+  +G S + I     R+L   ++  EI EK        S 
Sbjct: 539 GQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDREL-FANAMDEINEKCA-----KSK 592

Query: 760 LVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSG 819
             ++  EA E    + +PV+V++    GG+G     +E E+      V     A+     
Sbjct: 593 AASTVDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQEL------VDLCNVAFASSPQ 646

Query: 820 VFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGET 873
           V +ER ++  + VE +++ D +   I +    C+++            I   P+  L + 
Sbjct: 647 VLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDE 702

Query: 874 TRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
               +R  A ++   L       +++  +    E+  +EVNARL     +    TG  L
Sbjct: 703 DYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL 761

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 3/141 (2%)

Query: 59  KVLQSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNP---SADSTVVALLKDAG 115
           K+L  +   + LPLYG+PI++KD  +  G  TT       + P   + +S +V  LKD G
Sbjct: 107 KLLDERKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFLKDLG 166

Query: 116 AIVIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDT 175
           A++  KT +           + +G T    +               +G     + +GTD 
Sbjct: 167 AVLYVKTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSILGIGTDI 226

Query: 176 AGSGRVPAALNNLIGLKPTKG 196
            GS R+P++   L GL+PT G
Sbjct: 227 GGSIRIPSSFQGLFGLRPTHG 247

>Scas_721.66
          Length = 573

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 69/147 (46%), Gaps = 4/147 (2%)

Query: 54  LAHQWKVLQSKANKQQLP-LYGVPIAVKDNIDSKGSPTTAACPAFEYNPSA---DSTVVA 109
           L H   + Q+K     LP LYG+PI++KD  + +G  TT    +  + P     +S +V+
Sbjct: 123 LEHSKILDQNKYEYSTLPPLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDESLIVS 182

Query: 110 LLKDAGAIVIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPI 169
            L+D GAI+  KT +         T + +G T   F+               +G     +
Sbjct: 183 FLRDLGAIIYVKTTVPPSMMATETTSNTFGYTYNSFNQHFSAGGSSGGEGSLIGCYGSVL 242

Query: 170 ALGTDTAGSGRVPAALNNLIGLKPTKG 196
            LGTD  GS R+PA+ + + G KP+ G
Sbjct: 243 GLGTDIGGSIRIPASYHGIFGFKPSTG 269

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 136/316 (43%), Gaps = 24/316 (7%)

Query: 638 AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
           AV   K L+K   +++ +  +P+  S    + D       R   E  L  ++++   +  
Sbjct: 601 AVNTTKALRKEGKKTIMINYNPETVSTDFDEVD-------RLYFEE-LSFERVMDIYELE 652

Query: 698 NAQ-AIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVP 756
           N++  +I   G L +N   A K +  G   +G S E I K   +H    I +  GV   P
Sbjct: 653 NSEGCVISVGGQLPQN--IALKLLHNGAHILGTSPEDIDKAENRHKFSTILDSIGVNQ-P 709

Query: 757 GSGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFG 816
               ++S +EAK  AN++ YPV+++ +    G  +  V  E+E+E    T          
Sbjct: 710 EWSELSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVSP---- 765

Query: 817 DSGVFLERFVENARHVEIQMMG-DGYGKAIAIGER--DCSLQRRNQKIIEETPAPNLGET 873
           D  V + +F+E A+ +++  +  +G     AI E   +  +   +  ++   P  NL + 
Sbjct: 766 DHPVVMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLV--LPPQNLSQN 823

Query: 874 TRTKMRQAAESLGSLLKYKCAGTVEFIYDERRD--EFYFLEVNARLQVEHPITEMVTGLD 931
            + ++++ A+ +           ++ I D+R +      +E N R     P    V G++
Sbjct: 824 IKDRLKEIADKVAKAWNITGPFNMQIIKDDRDEGVSLKVIECNIRASRSFPFVSKVLGVN 883

Query: 932 LVEWMLR-IAADDAPD 946
            +E  ++   + D P+
Sbjct: 884 FIEAAVQAFLSKDVPE 899

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 75/180 (41%), Gaps = 16/180 (8%)

Query: 767 AKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFV 826
           A E A+ + +PV+V+S    GG+G    ++  E++      Q   ++      + +E+ +
Sbjct: 177 ALEAADIVGFPVIVRSAYALGGLGSGFANNAQEMK------QLASQSLSLAPQILVEKSL 230

Query: 827 ENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE------TPAPNLGETTRTKMRQ 880
           +  + VE +++ D  G  I +    C+++  +   I         P+  L +     +R 
Sbjct: 231 KGWKEVEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRS 286

Query: 881 AAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA 940
           AA  +   L       V++       ++  +EVNARL     +    TG  L     +IA
Sbjct: 287 AAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIA 346

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 131/300 (43%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL+  N++++ V  +P+  S    +AD       R   ET +++++I+   +  
Sbjct: 1002 AVTAVRTLRANNVKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERILDIYEAE 1053

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
             +  ++   G  + N   A     E +  +G S E I     ++    + ++ GV   P 
Sbjct: 1054 ASAGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS  EA+  A  + YPV+V+ +    G  +  V S++++        +Q      D
Sbjct: 1112 WKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 818  SGVFLERFVENARHVEIQMMG-DGYGKAIAIGER--DCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +  DG      + E   +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++  A   +G  LK      ++FI   + ++   +E N R     P    V G++L+E
Sbjct: 1226 VNRIVVATAKIGKALKITGPYNIQFI--AKNNDIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 96/239 (40%), Gaps = 27/239 (11%)

Query: 705 GYGFLSENAEFADKCVEEGIVFVGPSGEAI-----RKLGLKHSAREIAEKAGVPLVPGSG 759
           G   LS   E  D+    G+  +G   + +     R+L   ++  EI EK        S 
Sbjct: 523 GQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDREL-FSNAMDEINEKCA-----KSK 576

Query: 760 LVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSG 819
             ++ KEA E   ++ +PV+V++    GG+G     +E E+      V     A+     
Sbjct: 577 AASTVKEALEAVKEIGFPVIVRAAYALGGLGSGFASNETEL------VDLCNVAFASSPQ 630

Query: 820 VFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGET 873
           V +ER ++  + VE +++ D +   I +    C+++            I   P+  L + 
Sbjct: 631 VLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDE 686

Query: 874 TRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
               +R  A ++   L       +++  +    E+  +EVNARL     +    TG  L
Sbjct: 687 DYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL 745

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTV-VALLKDAGAIVIGKTNLDQFAT 129
           PL+GVP+++K+ ++ KG PT A+  ++  N   +S V + +L   GAI   +T+  Q   
Sbjct: 188 PLHGVPVSLKEQMNFKGKPTHASYVSYITNIPKNSAVSIDILDKLGAIFHTRTSQPQAIM 247

Query: 130 GLVGTRSPYGKT--PCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNN 187
            L    +  G+T  PC  S +             VG     I  G+D  GS RVPAA  +
Sbjct: 248 HLDTWNNITGRTRNPC--STRLSPGGSSGGESAMVGMHGSVIGHGSDIGGSIRVPAAFVD 305

Query: 188 LIGLKPT 194
           L G++PT
Sbjct: 306 LFGIRPT 312

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 113/260 (43%), Gaps = 15/260 (5%)

Query: 685 LDIDKIIKAAKDTNAQ-AIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSA 743
           L  ++++   +  N++  +I   G L +N   A K   EG   +G S E I K   +H  
Sbjct: 643 LSFERVMDIYELENSEGCVISVGGQLPQN--IALKLFHEGAKILGTSPEDIDKAENRHKF 700

Query: 744 REIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERV 803
             I +  GV   P    +TS  EAK  A+K+ YPV+++ +    G  +  V+SE+E+E  
Sbjct: 701 SSILDSIGVDQ-PEWKELTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELEVK 759

Query: 804 FETVQHQGKAYFGDSGVFLERFVENARHVEIQMMG-DGYGKAIAIGER--DCSLQRRNQK 860
                        D  V + +F+E A+ +++  +  DG     AI E   +  +   +  
Sbjct: 760 LTNASDVSP----DHPVVISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDAS 815

Query: 861 IIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRD--EFYFLEVNARLQ 918
           +I   P  +L E T+ +++  A+ +           ++ I D+R        +E N R  
Sbjct: 816 LI--LPPQHLSEETKQRLKDIADKVAKAWNICGPFNMQIIKDDRDHGTSLKVIECNIRAS 873

Query: 919 VEHPITEMVTGLDLVEWMLR 938
              P    V G++ ++  ++
Sbjct: 874 RSFPFVSKVLGINFIDVAVK 893

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 77/181 (42%), Gaps = 16/181 (8%)

Query: 766 EAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERF 825
           +A E A K++YPV+V+S    GG+G    + E E++ +        ++      + +E+ 
Sbjct: 178 QALEAAAKVKYPVIVRSAYALGGLGSGFANDEQEMKEL------ASQSLSLAPQILVEKS 231

Query: 826 VENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE------TPAPNLGETTRTKMR 879
           ++  + +E +++ D  G  I +    C+++  +   I         P+  L +     +R
Sbjct: 232 LKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLR 287

Query: 880 QAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRI 939
            AA  +   L       V++       ++  +EVNARL     +    TG  L     +I
Sbjct: 288 SAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKI 347

Query: 940 A 940
           A
Sbjct: 348 A 348

>Kwal_33.14061
          Length = 2221

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 133/300 (44%), Gaps = 21/300 (7%)

Query: 638  AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
            AV  ++TL+K  I+S+ V  +P+  S    +AD       R   ET + +++I+   +  
Sbjct: 1002 AVTAVRTLRKEKIKSIMVNYNPETVSTDYDEAD-------RLYFET-ICLERILDIYEIE 1053

Query: 698  NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
            ++  ++   G  + N   A     E +  +G + E I     ++    + ++ GV   P 
Sbjct: 1054 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 758  SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
               +TS +EA++ A+ + +PV+V+ +    G  +  V S++++        +Q      D
Sbjct: 1112 WKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 818  SGVFLERFVENARHVEIQMMG-DGYGKAIAIGER--DCSLQRRNQKIIEETPAPNLGETT 874
              V + +++ENA+ +E+  +  DG      + E   +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 875  RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
              ++  A   +G  LK      ++FI   + ++   +E N R     P    V  ++L+E
Sbjct: 1226 VERIVVATAKIGKALKITGPFNIQFI--AKNNDIKVIECNVRASRSFPFISKVVNVNLIE 1283

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 95/239 (39%), Gaps = 27/239 (11%)

Query: 705 GYGFLSENAEFADKCVEEGIVFVGPSGEAI-----RKLGLKHSAREIAEKAGVPLVPGSG 759
           G   LS   E  D+    G+  +G   + +     R+L   ++  EI EK        S 
Sbjct: 523 GQTALSVGIEMKDEFEALGVKVLGTPIDTVITTEDREL-FSNAMDEINEKCA-----KSK 576

Query: 760 LVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSG 819
              + +EA E   ++ +PV+ ++    GG+G    ++E E+      V     A+     
Sbjct: 577 AAATVEEALEAVKEIGFPVICRAAYALGGLGSGFANNEKEL------VDLCNIAFASSPQ 630

Query: 820 VFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGET 873
           V +ER ++  + VE +++ D +   I +    C+++            I   P+  L + 
Sbjct: 631 VLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDE 686

Query: 874 TRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
               +R  A ++   L       +++  +    E+  +EVNARL     +    TG  L
Sbjct: 687 DYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPL 745

>Kwal_55.19783
          Length = 1121

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 110/252 (43%), Gaps = 15/252 (5%)

Query: 701 AIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGL 760
           A+I   G L +N   A K +E G   +G S E I +   +H    I +  GV   P    
Sbjct: 660 AVISVGGQLPQN--IALKMLENGANILGTSPEDIDRAENRHKFSSILDTIGVDQ-PEWSE 716

Query: 761 VTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGV 820
           ++S  EAK+ +  + YPV+++ +    G  +  V+SE+E+    ET          D  V
Sbjct: 717 LSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDEL----ETKLTNASDVSPDHPV 772

Query: 821 FLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTK 877
            + +F+E A+ +++  +   G+    AI+    +  +   +  +I   P  +L E+ + +
Sbjct: 773 VISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLI--LPPQSLSESIKER 830

Query: 878 MRQAAESLGSLLKYKCAGTVEFIYDERRD--EFYFLEVNARLQVEHPITEMVTGLDLVEW 935
           +   A+ +    K      ++ I D+R +      +E N R     P    V G + ++ 
Sbjct: 831 LYDIAKKVAHAWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGCNFIDV 890

Query: 936 MLR-IAADDAPD 946
            ++    +D P+
Sbjct: 891 AVKAFIGEDVPE 902

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 76/184 (41%), Gaps = 16/184 (8%)

Query: 763 SAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFL 822
           +  EA   A+++ YPV+V+S    GG+G    ++E E++ +        +A      + +
Sbjct: 175 TVDEALSAASRVGYPVIVRSAYALGGLGSGFAENEAEMKEL------AAQALSLSPQILV 228

Query: 823 ERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGETTRT 876
           E+ ++  + VE +++ D     I +    C+++            I   P+  L +    
Sbjct: 229 EKSLKGWKEVEYEVVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFH 284

Query: 877 KMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWM 936
            +R AA  +   L       V++       ++  +EVNARL     +    TG  L    
Sbjct: 285 MLRTAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTA 344

Query: 937 LRIA 940
            +IA
Sbjct: 345 AKIA 348

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSA---DSTVVALLKDAGAIVIGKTNLDQF 127
           PLYG+PI++KD  + +G  T+       + P     +S +V+ L+D GAI+  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 128 ATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNN 187
                   + +G T    +               +G     + LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 188 LIGLKPTKG 196
           L GLKPT G
Sbjct: 243 LFGLKPTFG 251

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAF-EYNPSADSTVVALLKDAGAIVIGKTNLDQFAT 129
           PL+GVP+++K+ +  KG  T A+  ++ ++ P   +  V +L   GA+   +T+  Q   
Sbjct: 141 PLHGVPVSIKEQMCYKGKVTNASYVSYVDFVPEQSAVSVDILIKLGAVCHVRTSQPQTIM 200

Query: 130 GLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNNLI 189
            L    +  G+T    S K             VG     I  G+D  GS R PAA  NL 
Sbjct: 201 HLDTWNNYIGRTRNPRSTKLSPGGSSGGESACVGMHGSVIGHGSDIGGSIRAPAAFANLF 260

Query: 190 GLKPT 194
           GL+PT
Sbjct: 261 GLRPT 265

>Kwal_34.15724
          Length = 556

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 1/126 (0%)

Query: 72  LYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVA-LLKDAGAIVIGKTNLDQFATG 130
           L+GVPI++KD ++  G  TT    +   + S   +++A +L+D GAI   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 131 LVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNNLIG 190
                S +G+T    +               +G    P+ +GTD  GS R+PAA   L G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 191 LKPTKG 196
           L+P+ G
Sbjct: 244 LRPSHG 249

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 126/304 (41%), Gaps = 20/304 (6%)

Query: 638 AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
           AV   K L++ N +++ +  +P+  S    + D         + E  LDI ++     + 
Sbjct: 601 AVNTAKALREQNYKTIMINYNPETVSTDFDEVDR--LYFEELSYERVLDIYEL-----EQ 653

Query: 698 NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
           +   I+   G L +N   A    E G   +G S + I     +H    I +   V   P 
Sbjct: 654 SEGCIVSMGGQLPQN--IALSLYEYGCKILGTSPKDIDNAENRHKFSSILDSINVGQ-PE 710

Query: 758 SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
              +TS +EAK  ANK+ YPV+++ +    G  +  V++E+E+E               D
Sbjct: 711 WKELTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----D 766

Query: 818 SGVFLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETT 874
             V + +F++ A+ +++  +   G+    AI+    D  +   +  +I   P  +L E  
Sbjct: 767 HPVVMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLI--LPPQHLSENV 824

Query: 875 RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
           +++++  A+ +           ++ I     D    +E N R     P    V G++ +E
Sbjct: 825 KSQLKTIAKKVAKAWNITGPFNMQVIKAGEND-LKVIECNIRASRSFPFVSKVLGVNFIE 883

Query: 935 WMLR 938
             ++
Sbjct: 884 VAVK 887

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 70/176 (39%), Gaps = 16/176 (9%)

Query: 771 ANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENAR 830
           A+ + YPV+++S    GG+G    ++  E++ +        ++      V +E+ +   +
Sbjct: 179 ASTIGYPVIIRSAYALGGLGSGFANNPEELKEL------ASQSLSLAPQVLVEKSLRGWK 232

Query: 831 HVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAPNLGETTRTKMRQAAES 884
            VE +++ D     I +    C+++            I   P+  L +     +R AA  
Sbjct: 233 EVEYEVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIK 288

Query: 885 LGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA 940
           +   L       V++       ++  +EVNARL     +    TG  L     +IA
Sbjct: 289 IIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIA 344

>Kwal_27.10438
          Length = 569

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 2/136 (1%)

Query: 61  LQSKANKQQL-PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPS-ADSTVVALLKDAGAIV 118
           L  K NK+ + PL+GV +++K+ ++ KG  TTA+  A+  N +  +   +++L+  GA+ 
Sbjct: 132 LYLKDNKKLIGPLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVF 191

Query: 119 IGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGS 178
             +T   Q    L    +  G+T    S +             V      I  G+D  GS
Sbjct: 192 HVRTAQPQGIMHLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSVIGHGSDIGGS 251

Query: 179 GRVPAALNNLIGLKPT 194
            R PAA  +L G++PT
Sbjct: 252 IRAPAAFADLFGIRPT 267

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/374 (20%), Positives = 138/374 (36%), Gaps = 20/374 (5%)

Query: 63  SKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSA-DSTVVALLKDAGAIVIGK 121
           S+  K   P++G+P+++K++   KG  T A   +   N +  D+    + + AGA+   +
Sbjct: 20  SETGKTVGPMHGLPLSLKEHYAYKGKTTNAGFSSMIDNLTEEDALTTEIFRKAGAVFYIR 79

Query: 122 TNLDQFATGLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRV 181
           T   Q    L    +  G+     +               +     P+  G+D  GS R 
Sbjct: 80  TTQPQSLMHLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRA 139

Query: 182 PAALNNLIGLKPTKGLFSCSGVVPACKSL--DCVSVFAMNLSDAERCFKVMAKPDLEN-- 237
           PAA  N+ G KPT    S  G   + + +  D V      +++     ++  K  L++  
Sbjct: 140 PAAFCNIWGFKPTNKRVSLQGAWASYRDMSNDMVLCSVGPMANTPEDLELYMKTFLDSEP 199

Query: 238 ---DEYSRPLPSNPLQKYPKNVTIAIPKE----VPWYGETENPKLYAKAIENLKVAGASI 290
              D Y   LP   +      + IAI  +     P        +L  K++E   VA   +
Sbjct: 200 WLRDNYVIRLPWREVDLSLDKLKIAIVMDDGIVKPSPPVLRALELAKKSLEKAGVA-KCV 258

Query: 291 VTIDFEPLLALARCLYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADS 350
             + F     L  C Y        +     +  +  P + L              D+ + 
Sbjct: 259 EWVPFNTSEGLDIC-YTAYNCDGNFNHRSRYEESGEPLAPLSEHHMRFGCGDRGLDSLEM 317

Query: 351 FRYEYQRQGILQKVDQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLAD 410
            +Y ++R    Q+    + +IDV  V    L P +   AA P  +  +   +T   N+ D
Sbjct: 318 LQYLHKRDSYRQRFADMMNEIDVDYV----LTPAYFAPAAIPDKI--KYWGYTALYNILD 371

Query: 411 MAALAVPAGFRPDG 424
           +  ++ P G   D 
Sbjct: 372 LPGVSFPTGVVTDA 385

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (42%), Gaps = 1/138 (0%)

Query: 71  PLYGVPIAVKDNIDSKGSPTTAACPAFEYNPS-ADSTVVALLKDAGAIVIGKTNLDQFAT 129
           P++G+PI++K+++  KG  T A+  +   + +   +  V +    GA+   +T   Q   
Sbjct: 143 PMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTVDIFDKQGALYHVRTAQPQTIM 202

Query: 130 GLVGTRSPYGKTPCVFSDKHVXXXXXXXXXXXVGRGIVPIALGTDTAGSGRVPAALNNLI 189
            L       G+T    S K             +G     I +GTD  GS R PAA   + 
Sbjct: 203 HLDTWNIITGRTRNPRSTKLSPGGSSGGESAAIGMHGSVIGIGTDIGGSIRCPAAFAGIC 262

Query: 190 GLKPTKGLFSCSGVVPAC 207
           G++PT    S   V P+ 
Sbjct: 263 GMRPTVKRVSLLDVTPSS 280

>Scas_691.19
          Length = 1117

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 93/231 (40%), Gaps = 13/231 (5%)

Query: 721 EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMV 780
           E G   +G S   I +   +H    I +   V   P    +TS  EAK  A+K+ YPV++
Sbjct: 675 ENGCKILGTSPVDIDRAEDRHKFSSILDSINVGQ-PAWSELTSVDEAKVFADKVGYPVLI 733

Query: 781 KSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMM--- 837
           + +    G  +  V++E+E++               D  V + +F+E A+ +++  +   
Sbjct: 734 RPSYVLSGAAMSVVNNEDELKLKLTLASDVSP----DHPVVMSKFIEGAQEIDVDAVAYN 789

Query: 838 GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTV 897
           G     AI+    +  +   +  +I   P  NL +  +  +++ A+ +           +
Sbjct: 790 GKVLIHAISEHVENAGVHSGDASLI--LPPQNLSDKVKANLKEIADKVADAWHITGPFNM 847

Query: 898 EFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLR--IAADDAPD 946
           + I  E       +E N R     P    V G + +E  +R  +  D  P+
Sbjct: 848 QII-KEGDKPLKVIECNIRASRSFPFVSKVLGKNFIEVAVRAFLGGDKVPE 897

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 78/192 (40%), Gaps = 16/192 (8%)

Query: 755 VPGSGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAY 814
           +  S    +  EA   AN ++YPV+++S    GG+G    +++ E++++           
Sbjct: 164 IANSIACATVDEALAAANSIKYPVIIRSAYALGGLGSGFANNDQELKQLSSQSLSLSPQ- 222

Query: 815 FGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQR------RNQKIIEETPAP 868
                + +ER ++  + VE +++ D  G  I +    C+++            I   P+ 
Sbjct: 223 -----ILVERSMKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQ 273

Query: 869 NLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVT 928
            L +     +R AA  +   L       V++       ++  +EVNARL     +    T
Sbjct: 274 TLSDEEYHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKAT 333

Query: 929 GLDLVEWMLRIA 940
           G  L     +IA
Sbjct: 334 GYPLAYTAAKIA 345

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 70/349 (20%), Positives = 136/349 (38%), Gaps = 32/349 (9%)

Query: 638 AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
           AV  ++ L+K   +++ +  +P+  S    + D       R   E  L  ++++   +  
Sbjct: 596 AVNTVQALRKEGHKTIMINYNPETVSTDFDEVD-------RLYFEE-LSFERVMDIYEAE 647

Query: 698 NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
            A   +   G   +    A +  E+G   +G S E I K   +H    I +  G+   P 
Sbjct: 648 CASGCVISMGG-QQPQNIASQLYEQGANILGTSPEDIDKAEDRHKFSTILDTLGLDQ-PR 705

Query: 758 SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
              + S  E K   + + YPV+V+ +    G  +  V +  ++E VFE+      A   +
Sbjct: 706 WSELKSLSEVKHFLDDVGYPVLVRPSYVLSGAAMSTVYNSEDLEGVFES----AVAVSPE 761

Query: 818 SGVFLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETT 874
             V + +F+E A+ ++I  +   G     AI+    +  +   +  ++   P  +L E  
Sbjct: 762 HPVVISKFIEGAQELDIDAVAYKGSLLVHAISEHVENAGVHSGDATLV--LPPQSLKEEE 819

Query: 875 RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDE--FYFLEVNARLQVEHPITEMVTGLDL 932
           +T+++Q A  + +         ++ I            +E N R     P    V G++ 
Sbjct: 820 KTRLKQLAAQVAAAWNITGPFNMQIIKTAEGGHTCLKIIECNIRASRSFPFVSKVLGVNF 879

Query: 933 VEWMLRIAADDAPDFESANIVVTGASIEARLY----AENPAKDFRPSPG 977
           VE  ++        F   ++V     + AR Y     + P   F   PG
Sbjct: 880 VEIAVKA-------FLGGDLVPPSCDLMARSYNYVATKCPQFSFTRLPG 921

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 76/185 (41%), Gaps = 16/185 (8%)

Query: 762 TSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVF 821
           ++ ++A   AN + YPV+V+S    GG+G    D + ++       Q   ++      V 
Sbjct: 171 STVEDAVAAANDIGYPVIVRSAYALGGLGSGFADDDLQLR------QLCAQSLALSPQVL 224

Query: 822 LERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE------TPAPNLGETTR 875
           +E+ ++  + +E +++ D  G  I +    C+++  +   I         P+  L +   
Sbjct: 225 VEKSLKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEF 280

Query: 876 TKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEW 935
             +R AA  +   L       V++        F  +EVNARL     +    TG  L   
Sbjct: 281 HMLRTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYT 340

Query: 936 MLRIA 940
             +IA
Sbjct: 341 AAKIA 345

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 60/304 (19%), Positives = 124/304 (40%), Gaps = 20/304 (6%)

Query: 638 AVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGRTAAETYLDIDKIIKAAKDT 697
           AV   KTL+    +++ +  +P+  S    + D         + E  +DI ++     + 
Sbjct: 601 AVNTAKTLRDQGKKTIMINYNPETVSTDFDEVDR--LYFEELSYERVMDIYEL-----EQ 653

Query: 698 NAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPG 757
           +   II   G L +N   A K  + G   +G +   I +   +H    I +   V   P 
Sbjct: 654 SEGCIISVGGQLPQN--IALKLYDNGCNIMGTNPNDIDRAENRHKFSSILDSIDVDQ-PE 710

Query: 758 SGLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGD 817
              +TS +EAK  A+K+ YPV+++ +    G  +  V++E E++               D
Sbjct: 711 WSELTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP----D 766

Query: 818 SGVFLERFVENARHVEIQMM---GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETT 874
             V + +F+E A+ +++  +   G+    AI+    +  +   +  ++   P  +L +  
Sbjct: 767 HPVVMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLV--LPPQHLSDDV 824

Query: 875 RTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVE 934
           +  ++  A+ +    K      ++ I D        +E N R     P    V G++ +E
Sbjct: 825 KIALKDIADKVAKAWKITGPFNMQIIKDGEH-TLKVIECNIRASRSFPFVSKVLGVNFIE 883

Query: 935 WMLR 938
             ++
Sbjct: 884 IAVK 887

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 76/176 (43%), Gaps = 16/176 (9%)

Query: 763 SAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFL 822
           +  EA E A +++YPV+V+S    GG+G    ++ +E++ +        ++      + +
Sbjct: 172 TVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKEL------AAQSLSLAPQILV 225

Query: 823 ERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE------TPAPNLGETTRT 876
           E+ ++  + VE +++ D  G  I +    C+++  +   +         P+  L +    
Sbjct: 226 EKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFH 281

Query: 877 KMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDL 932
            +R AA  +   L       V++       ++  +EVNARL     +    TG  L
Sbjct: 282 MLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL 337

>Scas_712.17
          Length = 793

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 61/121 (50%), Gaps = 6/121 (4%)

Query: 723 GIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKS 782
           GI   GPS +  +  G K  ++   +K G+P    +   T  ++AK+   +++Y V++K+
Sbjct: 95  GIPVFGPSAKVAQLEGSKVFSKRFMDKHGIPTAKYASF-TDFEKAKKYLAEVDYNVVLKA 153

Query: 783 TAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSG--VFLERFVENARHVEIQMMGDG 840
                G G+   DS+ +  +  +T+  + +  FG +G  V +E F+E    + I  + DG
Sbjct: 154 DGIAAGKGVLIPDSKEQALKDLDTIMVERQ--FGSAGDSVVIEEFLE-GEEISILTISDG 210

Query: 841 Y 841
           Y
Sbjct: 211 Y 211

>Kwal_14.783
          Length = 1280

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 1193 VPEYLGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELASSSLP 1235
            VP +LGS ST        + G+ LK GDVLF N PE+  + LP
Sbjct: 796  VPVHLGSMSTCIAAQAKLWKGK-LKPGDVLFTNHPEIGGTHLP 837

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
            cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
            protein X, start by similarity
          Length = 405

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 1773 WKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNG 1817
            WK    AGDT + GD L+ VE  K  + V A+  GK+ KI+ +NG
Sbjct: 44   WK--FKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86

>Sklu_2372.4 YKL215C, Contig c2372 8103-11945
          Length = 1280

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1193 VPEYLGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELASSSLP 1235
            VP +LGS ST        + G+ LK GDVL  N PE+  + LP
Sbjct: 798  VPVHLGSMSTCISAQANLWKGK-LKSGDVLITNHPEIGGTHLP 839

>YHR014W (SPO13) [2300] chr8 (132039..132914) Meiosis-specific
           protein required for sister centromere cohesion during
           meiosis I chromosome division [876 bp, 291 aa]
          Length = 291

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 48  LINEANLAHQWKVLQSKANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAF 97
           L  +  L HQ K L  + N Q LP+Y  P+++ +N D  G  T  A P  
Sbjct: 211 LFKKTRLPHQTKSLDKEKNYQYLPIY--PVSISNNGDFVGQETPRAAPKL 258

>Kwal_27.12602
          Length = 257

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 289 SIVTIDFEPLLALARCLYEGAWVAE-RYEATKDFFATNPPESSLDPTVTSIIKTATK 344
           S+ TID E L +L+R ++ G +VAE +++A +  ++    E  LD    SI  +A +
Sbjct: 142 SVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMIKERDLDGIYRSITNSAVE 198

>KLLA0C18975g complement(1684573..1688433) similar to sp|P28273
            Saccharomyces cerevisiae YKL215c singleton, start by
            similarity
          Length = 1286

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1193 VPEYLGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELASSSLP 1235
            VP +LGS ST        + G+ LK GDV+  N PE+  + LP
Sbjct: 804  VPVHLGSMSTCIAAQAKLWKGK-LKPGDVIITNHPEIGGTHLP 845

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 928 TGLDLV--EWMLRIAADDAPDFESANIVVTGASIEARLYAENPAKDFRPSPGLLTDVHFP 985
           TG++ +  +W+LR A D A  ++  N +VTG ++  RL+  +      P   +  +VHF 
Sbjct: 40  TGIEYIAEKWLLRSAPDSATLYKVMNYLVTGLALVLRLWRIS-----EPREVVFDEVHFG 94

Query: 986 EWA 988
           ++A
Sbjct: 95  KFA 97

>Sklu_1870.5 YFL029C, Contig c1870 6101-7144
          Length = 347

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 78/176 (44%), Gaps = 28/176 (15%)

Query: 1368 VKPGDSIQFVPISYQVARQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPV----LVQL 1423
            +KP D      +   V +QL++ +D+ +  L D  ++  T  L+ P YE  +    L Q 
Sbjct: 31   IKPHD----CRVELSVLKQLQKERDSHLIQLYDNYVKLDTMFLVFPYYEQNLYQYMLTQF 86

Query: 1424 PKKSN----LSPKVTYRQAGDRYILVEYGENQMDLNIAY----RINQLINLVGKHKTVGI 1475
             KK      LS +       + + L+    N+MD+N A     +++Q +  V  H+   I
Sbjct: 87   KKKRKNMYLLSDEDGRENGDEEFRLI----NKMDINHAIDFIKQLSQALRFVHSHR---I 139

Query: 1476 VEMSQGVRSVLIEYDGYK-ISQGALLDTLVAYES----EIQFDKNWSIKSKIFKLP 1526
            +      ++V+++      I Q  L D  +AY++    E   DK   + + I+K P
Sbjct: 140  IHRDLKPQNVMVDTSHKTGIPQLVLTDFGIAYDTKHPQEPPDDKITDVSTSIYKAP 195

>YKL215C (YKL215C) [3060] chr11 complement(26828..30688) Protein with
            similarity to Pseudomonas hydantoinases hyuA-hyuB [3861
            bp, 1286 aa]
          Length = 1286

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1193 VPEYLGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELASSSLP 1235
            VP +LGS ST        + G+ LK GDVL  N P++  + LP
Sbjct: 802  VPVHLGSMSTCISAQAKLWEGK-LKPGDVLITNHPDIGGTHLP 843

>Scas_617.7
          Length = 420

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 1773 WKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGDM-VDAGGIVAVI 1829
            WK  V  G+  + GD L+ VE  K ++ V A+  GK+ KI+  +G   VD G  +A +
Sbjct: 52   WKFKV--GEPFSSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYL 107

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 60,699,286
Number of extensions: 2740582
Number of successful extensions: 7085
Number of sequences better than 10.0: 76
Number of HSP's gapped: 7121
Number of HSP's successfully gapped: 108
Length of query: 1830
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1714
Effective length of database: 12,580,421
Effective search space: 21562841594
Effective search space used: 21562841594
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)