Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2101.449149123760.0
AFL202C48151412481e-169
KLLA0D10043g48841810491e-138
Kwal_23.349446643310441e-138
Scas_613.114933218611e-110
YDL106C (PHO2)5594418561e-108
CAGL0L07436g5152537205e-89
KLLA0B01584g464571486e-10
YML027W (YOX1)385571173e-06
AER314W431621164e-06
YDR451C (YHP1)353461155e-06
Sklu_797.1386601131e-05
Kwal_47.18450370571093e-05
CAGL0G07249g345571074e-05
KLLA0C03135g228691021e-04
KLLA0B14553g228691021e-04
Kwal_33.129919150942e-04
Scas_641.12413571013e-04
AFR643C10262923e-04
ADL394C10262924e-04
AER456W5750820.003
YKL098W35769710.96
CAGL0E03476g156498701.9
Scas_720.112349643.2
Kwal_33.1299511046633.6
AGL205C61537665.3
Scas_715.1451640656.2
CAGL0H06633g544112639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2101.4
         (491 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement        919   0.0  
AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..575...   485   e-169
KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...   408   e-138
Kwal_23.3494                                                          406   e-138
Scas_613.11                                                           336   e-110
YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain...   334   e-108
CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces c...   281   5e-89
KLLA0B01584g complement(125027..126421) weakly similar to sp|P34...    62   6e-10
YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in...    50   3e-06
AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C (...    49   4e-06
YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein ...    49   5e-06
Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement            48   1e-05
Kwal_47.18450                                                          47   3e-05
CAGL0G07249g complement(688189..689226) similar to sp|P34161 Sac...    46   4e-05
KLLA0C03135g complement(279869..280555) gi|10643642|gb|AAG21094....    44   1e-04
KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyce...    44   1e-04
Kwal_33.12991                                                          41   2e-04
Scas_641.12                                                            44   3e-04
AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH] (1607899.....    40   3e-04
ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH] (18058..1...    40   4e-04
AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH] complemen...    36   0.003
YKL098W (YKL098W) [3164] chr11 (256415..257488) Protein of unkno...    32   0.96 
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    32   1.9  
Scas_720.1                                                             29   3.2  
Kwal_33.12995                                                          29   3.6  
AGL205C [4107] [Homologous to ScYDR052C (DBF4) - SH] (314646..31...    30   5.3  
Scas_715.14                                                            30   6.2  
CAGL0H06633g 659326..660960 highly similar to sp|P10963 Saccharo...    29   9.9  

>Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement
          Length = 491

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/491 (92%), Positives = 455/491 (92%)

Query: 1   MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTANXXXXXXXXXXXXXXXXNYNDQKS 60
           MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTAN                NYNDQKS
Sbjct: 1   MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTANSDDQTTGTTSATSFSSNYNDQKS 60

Query: 61  AHLQQGNDGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQ 120
           AHLQQGNDGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQ
Sbjct: 61  AHLQQGNDGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQ 120

Query: 121 NRRAKFRKSGRQNPRPSALDMNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKRL 180
           NRRAKFRKSGRQNPRPSALDMNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKRL
Sbjct: 121 NRRAKFRKSGRQNPRPSALDMNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKRL 180

Query: 181 KSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILF 240
           KSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILF
Sbjct: 181 KSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILF 240

Query: 241 RIFFPINSVVNCSLSFEADSIRKXXXXXXXXXXXPSEKTCELKLTVSKSPKFAVYFSDAV 300
           RIFFPINSVVNCSLSFEADSIRK           PSEKTCELKLTVSKSPKFAVYFSDAV
Sbjct: 241 RIFFPINSVVNCSLSFEADSIRKENEDQDEQDQDPSEKTCELKLTVSKSPKFAVYFSDAV 300

Query: 301 EHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPP 360
           EHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPP
Sbjct: 301 EHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPP 360

Query: 361 PTVTQPHAVSQQSMILQPEPRPAEQGXXXXXXXXXAQNAILGLPHQEHDQLTTQQFVSPN 420
           PTVTQPHAVSQQSMILQPEPRPAEQG         AQNAILGLPHQEHDQLTTQQFVSPN
Sbjct: 361 PTVTQPHAVSQQSMILQPEPRPAEQGQQQFFDDFDAQNAILGLPHQEHDQLTTQQFVSPN 420

Query: 421 SAQSHHFTDDNNTVSQANLLPNLNQEAQIPNTPEFLSTTDLTSEDHNGISDLLTFESQNP 480
           SAQSHHFTDDNNTVSQANLLPNLNQEAQIPNTPEFLSTTDLTSEDHNGISDLLTFESQNP
Sbjct: 421 SAQSHHFTDDNNTVSQANLLPNLNQEAQIPNTPEFLSTTDLTSEDHNGISDLLTFESQNP 480

Query: 481 VGSSNANQNFF 491
           VGSSNANQNFF
Sbjct: 481 VGSSNANQNFF 491

>AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..57595)
           [1446 bp, 481 aa]
          Length = 481

 Score =  485 bits (1248), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 276/514 (53%), Positives = 334/514 (64%), Gaps = 57/514 (11%)

Query: 1   MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTANXXXXXXXXXXXXXXXXNYNDQKS 60
           M+NFEY   +F   FN +F  P+E + +      + N                  N +  
Sbjct: 1   MDNFEYPGGEF-GRFNQEFGSPEEMLNNGHGELRSDNGEATG-------------NSKSP 46

Query: 61  AH---LQQGNDGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRI 117
            H    +  + GKPK+KRTRATGEAL +LK+EFD+NPNPNAQNRKRIS+ T LPEKNVRI
Sbjct: 47  GHGELAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRI 106

Query: 118 WFQNRRAKFRKSGRQ-NPRPSALDMNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGS 176
           WFQNRRAK+RKS R  N R +A DMN  GS+S+TV++D+IPLNIN+NYYF+D +SLTVGS
Sbjct: 107 WFQNRRAKYRKSDRTFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGS 166

Query: 177 WKRLKSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNT 236
           WKRLKSGNL +ESL NIK LSNLSP SIN IMSN+TDLMVLISKKNFE+NYFFSAIANNT
Sbjct: 167 WKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIANNT 226

Query: 237 KILFRIFFPINSVVNCSLSFEADSIRKXXXXX----XXXXXXPSEKTCELKLTVSKSPKF 292
           KILFRIFFPINSV+NCSL   A+  +K                +E+ CELKL VSK P F
Sbjct: 227 KILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPPNF 286

Query: 293 AVYFSDAVEHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYN 352
           AVYFSD  +  TSNQWSICEDFSEGRQVSDA+VGGSN PHVL GLE SLKFM+SLILDYN
Sbjct: 287 AVYFSDMNDELTSNQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYN 346

Query: 353 STNQIIPPPTVTQPHAVSQ----------QSMILQPEPRPAEQGXXXXXXXXXAQNAILG 402
           ST  ++P     QP               Q+++LQPEP    Q          + + IL 
Sbjct: 347 STTHVVPH---AQPQPHPHSHPHHSSDPAQAIVLQPEPHSLAQSAFFRNYGPHSTDDILD 403

Query: 403 LPHQEHDQLTTQQ-----FVSPNSAQSHHFTDDNNTVSQANLLPNLNQEAQIPNTPEFLS 457
           +  Q+ DQ  T Q     F S ++A   HF           L  +L  + QIP TPEFL+
Sbjct: 404 I--QDPDQYETAQTANTEFPSTSTAAGSHF-----------LTAHL-ADTQIPKTPEFLN 449

Query: 458 T-TDLTSEDHNGISDLLTFESQNPVGSSNANQNF 490
             TDL ++D +G+++LL F  Q    +SNA QN+
Sbjct: 450 QHTDLHNDDQHGLNNLLNFNDQ--PHTSNAEQNY 481

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score =  408 bits (1049), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 286/418 (68%), Gaps = 37/418 (8%)

Query: 75  RTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSGRQNP 134
           RTRATGEAL ILKREF +NP+PNAQNRKRIS+MT LPEKNVRIWFQNRR+K+RKS ++  
Sbjct: 101 RTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMN 160

Query: 135 RPSALDMNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNLDKESLPNIK 194
            P A D   + S   + +FD+IPL IN++YYF+D+SSLTVGSWKRLKSGNL  +SLP I+
Sbjct: 161 GPGATDNTTLVS---SFEFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQ 217

Query: 195 DLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINSVVNCSL 254
            LSNLSPISIN IM+N+TDLMVLISKKNFEINYFFSAIANNTKILFRIFFPIN+VVNCSL
Sbjct: 218 KLSNLSPISINTIMANATDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSL 277

Query: 255 SFE-ADSIRKXXXXXXXXXXXP------SEKTCELKLTVSKSPKFAVYFSDAVEHFTSNQ 307
           S +  +S++                   S K  EL+L++SKSPKFAVYFS+ ++  +SNQ
Sbjct: 278 SLDNTESLKGDAKNSNSPSSLDGNNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQ 337

Query: 308 WSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPPPTVTQPH 367
           WSICEDFSEGRQV+DAF+GGSN+PHVL GL++SLKFMNSLILD NST     PPT    H
Sbjct: 338 WSICEDFSEGRQVNDAFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEHF--PPTTQLQH 395

Query: 368 AVSQQSMILQPEPRPAEQGXXXXXXXXXAQNAILGLPHQEHDQLTTQQFVSPNSAQSHHF 427
            +   SM       P               N I       HD   T    S NS  S   
Sbjct: 396 GI-MHSM-------PPTDTQSTALRFNDDPNLI------AHD---TSANPSHNSQSSFLT 438

Query: 428 TDDNNTVSQANLLPNLNQEAQIPNTPEFLSTTDLTSEDHNGISDLLTFESQNPVGSSN 485
           T+DN T    +     N  + IP TP+FL++T+L  ++   +S LL F+ Q+P GSS+
Sbjct: 439 TNDNFTSMTFD-----NFSSNIPKTPDFLNSTNL--QEGQSMSTLL-FQDQHPNGSSH 488

>Kwal_23.3494
          Length = 466

 Score =  406 bits (1044), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/433 (51%), Positives = 286/433 (66%), Gaps = 25/433 (5%)

Query: 68  DGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFR 127
           D +P+TKRTRATGEAL +LKREFD NPNPNAQNRKRIS++T LPEKNVRIWFQNRRAK R
Sbjct: 50  DDRPRTKRTRATGEALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHR 109

Query: 128 KSGRQNPRPSAL-DMNGIGSLSL-TVDFDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNL 185
           KS R   R SA  D+ G  + ++  +DFDRIPL+ N+NY F+DV SLTVGSWKRLKSGNL
Sbjct: 110 KSDRGGTRGSATTDVAGEPTGAIPALDFDRIPLDSNSNYCFIDVKSLTVGSWKRLKSGNL 169

Query: 186 DKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILFRIFFP 245
            ++ LP ++ LSNLSP+SIN+IM+N+TDLMVLISKKN EINYFFSAIANNTKILFRIFFP
Sbjct: 170 KQDDLPTVQRLSNLSPVSINEIMANATDLMVLISKKNHEINYFFSAIANNTKILFRIFFP 229

Query: 246 INSVVNCSLSFEADSIRKXXXXXXXXXXXPSEKTCELKLTVSKSPKFAVYFSDAVEHFTS 305
           I + V+C+LS   D                  K CEL+L +SK+P FAVYFSD  + F+S
Sbjct: 230 ITTTVDCALSATTDGAESVRSDAHN-------KLCELRLNLSKAPTFAVYFSDGADQFSS 282

Query: 306 NQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPPP---- 361
           NQWSICEDFSE RQVS+AF+GG N+PH+L GLE SL FM S I D+NS   ++       
Sbjct: 283 NQWSICEDFSEERQVSEAFIGGLNIPHILTGLESSLSFMCSSIQDHNSGAHVLSHKSHLR 342

Query: 362 -TVTQPHAVSQQSMILQPEPRPAEQGXXXXXXXXXAQNAILGLPHQEHDQLTTQQFVSPN 420
            +V  P A    ++++ PEP                   I  +   EH+   T QF + N
Sbjct: 343 DSVGAPEA---HNIVINPEPHALGTRQQPFFDDFNDHQDIYAI--GEHN---TPQFAASN 394

Query: 421 -SAQSHHFTDDNNTVSQANLLPNLNQEAQIPNTPEFL-STTDLTSEDHNGISDLLTFESQ 478
            + QSH F+  +   S          E+ +P TP+FL S  ++  E+ +G+++LL F+  
Sbjct: 395 TTTQSHSFSQHSPEPSGNEHTSPQYSESGVPKTPDFLRSHAEMGVEEQSGLNNLLIFDDH 454

Query: 479 NPVGSSNANQNFF 491
               + +A QN+F
Sbjct: 455 TSNNTKSA-QNYF 466

>Scas_613.11
          Length = 493

 Score =  336 bits (861), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 226/321 (70%), Gaps = 14/321 (4%)

Query: 71  PKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSG 130
           PK++R RA GE L ILK  F++NPNP+ + RK+IS++  +PEK+VRIWFQNRRAK +K  
Sbjct: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAKVKKHN 152

Query: 131 RQNPRPSAL------DMNGIGSLSLTVD----FDRIPLNINNNYYFLDVSSLTVGSWKRL 180
               R +A       D N   S +   +    FDRIP+ IN NY F+DV S+TVGSW R 
Sbjct: 153 NLKNRNNANMDSNDEDFNDETSPNTDSNNAKFFDRIPVRINKNYNFIDVCSITVGSWNRK 212

Query: 181 KSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILF 240
           K G+L  E LP ++ LSNLSP+S+N+IMSNSTDL+VL SKKN EINYFFSA+AN+TKILF
Sbjct: 213 KYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMANDTKILF 272

Query: 241 RIFFPINSVVNCSLSFEADSIRKXXXXXXXXXXXPSEKTCELKLTVSKSPKFAVYFSDAV 300
           RIFFPI+SV NCSLS E D                SE+  ELKL ++K P FAVYF  + 
Sbjct: 273 RIFFPISSVKNCSLSLETDD-DIITNNNVTNSSDTSERLGELKLILTKPPTFAVYFIKSD 331

Query: 301 EHFTS---NQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQI 357
           E+ T    NQWSICEDFSEG+QV+DAF+GGSNLPHVL+GL+DSLKF+NS IL+Y STN+I
Sbjct: 332 ENETVPSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKFLNSHILEYKSTNEI 391

Query: 358 IPPPTVTQPHAVSQQSMILQP 378
           +PP T+T P    Q   ++ P
Sbjct: 392 LPPSTITVPSHQLQSHDLMTP 412

>YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain
           protein required for expression of phosphate pathway and
           other genes [1680 bp, 559 aa]
          Length = 559

 Score =  334 bits (856), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/441 (45%), Positives = 249/441 (56%), Gaps = 69/441 (15%)

Query: 1   MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTANXXXXXXXXXXXXXXXXNYNDQKS 60
           ME F YD +DF +HF  D     +++                              + + 
Sbjct: 2   MEEFSYD-HDFNTHFATDL----DYLQHDQQQQQQQQHDQQHNQQQQPQPQPIQTQNLEH 56

Query: 61  AHLQQGND----------GKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNL 110
            H Q  ND          G  + KRTRA GEAL +LKR+F++NP P+   RK+ISD+  +
Sbjct: 57  DHDQHTNDMSASSNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGM 116

Query: 111 PEKNVRIWFQNRRAKFRK---SGRQNPRPSA-------------LDMNGIGSLS------ 148
           PEKNVRIWFQNRRAK RK      ++  PS+              D N + + S      
Sbjct: 117 PEKNVRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFH 176

Query: 149 ---LTVDFDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNLDKESLPNIKDLSNLSPISIN 205
              LT  FDRIPLN NNNYYF D+ S+TVGSW R+KSG L + +  +IK+L NLSPI IN
Sbjct: 177 DEDLTF-FDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKIN 235

Query: 206 DIMSNSTDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINSVVNCSLSFEAD------ 259
           +IMSN+TDLMVLISKKN EINYFFSA+ANNTKILFRIFFP++SV NCSL+ E D      
Sbjct: 236 NIMSNATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETDDDIINS 295

Query: 260 -------------------SIRKXXXXXXXXXXXPSEKTCELKLTVSKSPKFAVYFSDAV 300
                              +  +             +   ELKLTV++SP FAVYF +  
Sbjct: 296 NNTSDKNNSNTNNDDDNDDNSNEDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNA 355

Query: 301 ---EHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQI 357
              +   +NQWSIC+DFSEGRQV+DAFVGGSN+PH L GL+ SL+FMNSLILDY S+N+I
Sbjct: 356 PDEDPNLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEI 415

Query: 358 IPPPTVTQPHAVSQQSMILQP 378
           +P      P A   Q  I  P
Sbjct: 416 LPTINTAIPTAAVPQQNIAPP 436

>CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces
           cerevisiae YDL106c GRF10 homeodomain protein,
           hypothetical start
          Length = 515

 Score =  281 bits (720), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 177/253 (69%), Gaps = 19/253 (7%)

Query: 153 FDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNLDKESLPNIKDLSNLSPISINDIMSNST 212
           FD++PLNINNNYYF+DV S+TVGSW R+KSG+L   SLP +KDL NLSP+S+N +MS++T
Sbjct: 128 FDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDAT 187

Query: 213 DLMVLISKKNFEINYFFSAIANNTKILFRIFFPINSVVNCSLSFEADSIRKXXXXXXXXX 272
           DLMV+ISKKNFEINYFFSA+ANNTKILFRIFF IN+V +CSLSF+               
Sbjct: 188 DLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDK------TDEEINNR 241

Query: 273 XXPSEKTCELKLTVSKSPKFAVYFSDAVEHFTSNQWSICEDFSEGRQVSDAFVGGSNLPH 332
             P+ K  ELKL V+K PKFAVYF +  E+  +NQW +CEDFSEG+QV+DAFVGGSN+PH
Sbjct: 242 TDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGSNVPH 301

Query: 333 VLNGLEDSLKFMNSLILDYNSTNQII------PPPTVTQPHAVSQQSMILQPEPRPAEQG 386
           VL GLE SLK +NSLILDY STN  I      PPPT       +  S IL P+  PA  G
Sbjct: 302 VLKGLESSLKILNSLILDYISTNDTITSAPLPPPPT-------NVGSDILHPQMHPAPHG 354

Query: 387 XXXXXXXXXAQNA 399
                     Q A
Sbjct: 355 LMAYNAGMSGQMA 367

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (79%)

Query: 68  DGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFR 127
           DG  K+KRTRA GE+L ILK  F +NPNP+ Q R RIS++T +PEKNVRIWFQNRRAK R
Sbjct: 2   DGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61

Query: 128 KSGR 131
           K G+
Sbjct: 62  KKGK 65

>KLLA0B01584g complement(125027..126421) weakly similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 464

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           + KR R +     ILK+EF+VNP P+ + R  +S + N+ EK V++WFQNRR  FRK
Sbjct: 210 RRKRRRTSKNESDILKKEFEVNPAPSKERRSELSIICNMSEKAVQVWFQNRRQNFRK 266

>YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in
           transcriptional derepression during the M/G1 phase of
           the cell cycle along with Yhp1p, contains homeodomain
           [1158 bp, 385 aa]
          Length = 385

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 37/57 (64%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           + KR R + + L+IL+ EF+  P P+ + R  +++  ++ EK V+IWFQN+R   ++
Sbjct: 177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKR 233

>AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C
           (YHP1) - SH] complement(1218410..1219705) [1296 bp, 431
           aa]
          Length = 431

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSGR 131
           + KR R +   L IL++EFD    P+ + R  ++   N+ EK V+IWFQN+R   +K  +
Sbjct: 198 RRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKRQSMKKKRK 257

Query: 132 QN 133
           + 
Sbjct: 258 ER 259

>YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein
           involved in transcriptional derepression during the M/G1
           phase of the cell cycle along with Yox1p, contains a
           homeodomain [1062 bp, 353 aa]
          Length = 353

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 83  LAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           L IL+  FD  P PN   R  +S+  N+ EK+V+IWFQN+R   +K
Sbjct: 185 LGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK 230

>Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement
          Length = 386

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSGR 131
           + KR R +   L IL+ EF+    P+ Q R  ++   ++ EK V+IWFQN+R   +K  R
Sbjct: 170 RRKRRRTSKNELNILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKRQSVKKHKR 229

>Kwal_47.18450
          Length = 370

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           + KR R +   L IL+ EF++ P P+   R  +S+   + EK ++IWFQN+R   ++
Sbjct: 160 RRKRRRTSKHELNILQSEFELCPTPDKFKRIELSERCCMSEKAIQIWFQNKRQSVKR 216

>CAGL0G07249g complement(688189..689226) similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 345

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           + KR R + + L IL+ EF     P+ Q R  ++   N+ EK V++WFQN+R   ++
Sbjct: 155 RRKRRRTSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKRQAMKR 211

>KLLA0C03135g complement(279869..280555)
           gi|10643642|gb|AAG21094.1|AF195067_2 Kluyveromyces
           lactis a1p, start by similarity
          Length = 228

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 71  PKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK-- 128
           P  KR+    E+  IL++ F V   PN   R  I+   +L    VRIWF N+R + +K  
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKKHT 214

Query: 129 SGRQNPRPS 137
           +G+   R S
Sbjct: 215 TGKGTKRKS 223

>KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyces
           lactis A1p, start by similarity
          Length = 228

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 71  PKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK-- 128
           P  KR+    E+  IL++ F V   PN   R  I+   +L    VRIWF N+R + +K  
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKKHT 214

Query: 129 SGRQNPRPS 137
           +G+   R S
Sbjct: 215 TGKGTKRKS 223

>Kwal_33.12991
          Length = 91

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 74  KRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRR 123
           +RT  + +    L+  F+   +PN++ RK I+D   L    VR+WF NRR
Sbjct: 40  RRTLFSKDTRLFLESVFEKKKSPNSRERKAIADKCGLTPVQVRVWFTNRR 89

>Scas_641.12
          Length = 413

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%)

Query: 72  KTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           + KR R +   L+IL+ EF+    P+ Q R  ++   ++ +K V+IWFQN+R   ++
Sbjct: 184 RRKRRRTSSHELSILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKRQSMKR 240

>AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH]
           (1607899..1608207) [309 bp, 102 aa]
          Length = 102

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 31/62 (50%)

Query: 69  GKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           G  + +RT    E    L+  F+    PNA+ R+ I++   L    +RIWF N+R + + 
Sbjct: 38  GDKQRRRTVLPKETKEFLESVFERKRWPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKT 97

Query: 129 SG 130
            G
Sbjct: 98  RG 99

>ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH]
           (18058..18366) [309 bp, 102 aa]
          Length = 102

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 31/62 (50%)

Query: 69  GKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRK 128
           G  + +RT    E    L+  F+    PNA+ R+ I++   L    +RIWF N+R + + 
Sbjct: 38  GDNQRRRTVLPKEPKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKT 97

Query: 129 SG 130
            G
Sbjct: 98  RG 99

>AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH]
           complement(1512285..1512285,1512359..1512531) [174 bp,
           57 aa]
          Length = 57

 Score = 36.2 bits (82), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 81  EALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSG 130
           E    L+  F+    PNA+ R+ I++   L    +RIWF N+R + +  G
Sbjct: 5   ETKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRG 54

>YKL098W (YKL098W) [3164] chr11 (256415..257488) Protein of unknown
           function [1074 bp, 357 aa]
          Length = 357

 Score = 32.0 bits (71), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 275 PSEKTCELKLTVSKSPKFAVYFSDAV--EHFTSNQWSICEDFSEGRQVSDAFVGGSNLPH 332
           P  +TC LK +V+    F   + D+V  E   S+  S C D    R ++DA+ GG     
Sbjct: 7   PDFQTC-LKFSVTAKKSFLCMYRDSVSKEKLASSMPSTC-DIQLKRAINDAYPGGGIKVT 64

Query: 333 VLNGLEDSL 341
           VLN    SL
Sbjct: 65  VLNSTTASL 73

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 40/98 (40%), Gaps = 8/98 (8%)

Query: 286  VSKSPKFAVYFSDAVEHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMN 345
            V+  P F VY SD    F  N      D+ +G+     F   S + +++ G+    KF  
Sbjct: 1427 VACVPFFGVYLSDLTFTFAGNS-----DYLDGKTDIINFGKRSKIANIIEGILTFKKFHY 1481

Query: 346  SLI-LDYNSTNQIIPPPTVTQPHAVSQQSMILQPEPRP 382
             L  LD   T   I       PH   Q  + LQ EPRP
Sbjct: 1482 KLKRLDDVQTG--IEEGLEGVPHIEKQYQLSLQIEPRP 1517

>Scas_720.1
          Length = 123

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 77  RATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAK 125
           R T E L     E   NP PN Q +K + ++T L +  +  WF N R +
Sbjct: 55  RGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRR 103

>Kwal_33.12995
          Length = 110

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 86  LKREFDVNPNPNAQNRKRIS---DMTNLPEKNVRIWFQNRRAKFRK 128
           L+  F +N +     RK+IS   + TNL  K +R W  NRR K +K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92

>AGL205C [4107] [Homologous to ScYDR052C (DBF4) - SH]
           (314646..316493) [1848 bp, 615 aa]
          Length = 615

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 325 VGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPPP 361
           +G    P   + +  SLK +N L++D   T Q IPPP
Sbjct: 478 IGNGLAPAKASNVNKSLKSLNRLVVDRKFTQQTIPPP 514

>Scas_715.14
          Length = 516

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 5/40 (12%)

Query: 177 WKRLKSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMV 216
           W+RLKSGNL K +   + D+S L P+ IN+I    TD+++
Sbjct: 161 WRRLKSGNL-KSNTTALMDVSEL-PVDINEI---KTDIVL 195

>CAGL0H06633g 659326..660960 highly similar to sp|P10963
           Saccharomyces cerevisiae YKR097w PCK1, start by
           similarity
          Length = 544

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 50/112 (44%), Gaps = 11/112 (9%)

Query: 141 MNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNLDKESLPNIKDLSNLS 200
           ++G G  +L+ D  R+ +  ++ + + D     +      K  NL +E  P I D     
Sbjct: 247 LSGTGKTTLSADPHRLLIG-DDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFD----- 300

Query: 201 PISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINSVVNC 252
            I    ++ N     V+   ++ E++Y  S+I  NT+  + I F  ++ + C
Sbjct: 301 AIRFGSVLEN-----VIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPC 347

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,668,994
Number of extensions: 732527
Number of successful extensions: 2060
Number of sequences better than 10.0: 52
Number of HSP's gapped: 2078
Number of HSP's successfully gapped: 55
Length of query: 491
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 385
Effective length of database: 12,926,601
Effective search space: 4976741385
Effective search space used: 4976741385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)