Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2101.356856828580.0
Kwal_23.348850245116560.0
KLLA0D10065g46642114200.0
CAGL0F07799g58042114040.0
ADL279W49351413830.0
YMR171C55042412611e-168
Scas_669.1058548312201e-162
Sklu_2430.75393653628e-37
KLLA0B12760g5422303302e-32
CAGL0M06545g5873583312e-32
ABL026W4802153087e-30
YKL124W (SSH4)5792482965e-28
Kwal_26.76655512302956e-28
Scas_721.1265732392884e-27
CAGL0I04114g910127840.048
AFR242C82373780.21
Scas_686.2241669740.60
AAR167C35969720.96
CAGL0K06831g35869711.2
Kwal_47.1917383628721.3
YBR221C (PDB1)36669701.7
YGL227W (VID30)95883674.4
Scas_599.1055127665.8
YCR073C (SSK22)133161666.5
Scas_712.2397324667.3
Scas_480.193969657.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2101.3
         (568 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2101.3 YMR171C, Contig c2101 5004-6710                          1105   0.0  
Kwal_23.3488                                                          642   0.0  
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   551   0.0  
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   545   0.0  
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   537   0.0  
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   490   e-168
Scas_669.10                                                           474   e-162
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         144   8e-37
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   131   2e-32
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   132   2e-32
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   123   7e-30
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   118   5e-28
Kwal_26.7665                                                          118   6e-28
Scas_721.126                                                          115   4e-27
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...    37   0.048
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    35   0.21 
Scas_686.22                                                            33   0.60 
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...    32   0.96 
CAGL0K06831g complement(665672..666748) highly similar to sp|P32...    32   1.2  
Kwal_47.19173                                                          32   1.3  
YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...    32   1.7  
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...    30   4.4  
Scas_599.10                                                            30   5.8  
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    30   6.5  
Scas_712.23                                                            30   7.3  
Scas_480.1                                                             30   7.7  

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/568 (96%), Positives = 550/568 (96%)

Query: 1   MHVTHNLNFIILYAKCRDIYLADFQIGAYRYTINFVHHSTLSIKGSSHFMVLIMDILRQF 60
           MHVTHNLNFIILYAKCRDIYLADFQIGAYRYTINFVHHSTLSIKGSSHFMVLIMDILRQF
Sbjct: 1   MHVTHNLNFIILYAKCRDIYLADFQIGAYRYTINFVHHSTLSIKGSSHFMVLIMDILRQF 60

Query: 61  SYPIVLAFIPKLTIGAPISEGTYSEHPSAPGFQDDYEXXXXXXXXXXXXXXXXXXYILLT 120
           SYPIVLAFIPKLTIGAPISEGTYSEHPSAPGFQDDYE                  YILLT
Sbjct: 61  SYPIVLAFIPKLTIGAPISEGTYSEHPSAPGFQDDYEDDMDMAMLFFSMAFMLLSYILLT 120

Query: 121 LIYFSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFY 180
           LIYFSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFY
Sbjct: 121 LIYFSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFY 180

Query: 181 YKQGEEYIKQNPPLLIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTI 240
           YKQGEEYIKQNPPLLIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTI
Sbjct: 181 YKQGEEYIKQNPPLLIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTI 240

Query: 241 LIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFG 300
           LIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFG
Sbjct: 241 LIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFG 300

Query: 301 LSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNS 360
           LSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNS
Sbjct: 301 LSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNS 360

Query: 361 GTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKW 420
           GTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKW
Sbjct: 361 GTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKW 420

Query: 421 GYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPPPPGFE 480
           GYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPPPPGFE
Sbjct: 421 GYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPPPPGFE 480

Query: 481 FSTTPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQLQQIVEERGED 540
           FSTTPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQLQQIVEERGED
Sbjct: 481 FSTTPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQLQQIVEERGED 540

Query: 541 EMNFDMQSSPVDGNNLNDNTVANQFIHE 568
           EMNFDMQSSPVDGNNLNDNTVANQFIHE
Sbjct: 541 EMNFDMQSSPVDGNNLNDNTVANQFIHE 568

>Kwal_23.3488
          Length = 502

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/451 (68%), Positives = 367/451 (81%), Gaps = 16/451 (3%)

Query: 116 YILLTLIYFSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSP 175
           Y  LTL+Y  V+F++++YF T ISL+   S  I    +  WPS+LDD +AV+DKL ++S 
Sbjct: 68  YFALTLVYLVVKFLLRRYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRDKLARMSA 127

Query: 176 EEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPNL 235
           EEQFYYKQGEE+IKQNPPLL+P RS      +DPIIN+QT++FI+EEG HAWEFQPDP L
Sbjct: 128 EEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWEFQPDPKL 187

Query: 236 PNDTILIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNE 295
           PND++L+ENK+EITFLNYNYD SVMTNLP+PR+NRVYY E KIFELNT+ S+NN  S NE
Sbjct: 188 PNDSVLVENKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNNNS-SQNE 246

Query: 296 MISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIG 355
           M+SFGLS+SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELS ELASIFPR +KGD+IGIG
Sbjct: 247 MLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIG 306

Query: 356 YRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEA 415
           YRTNSGTVFFTRNGKKLNEK IGGHIKGWK KY+YPIVG+N+PCKVHVNFG+YGFVFIEA
Sbjct: 307 YRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYGFVFIEA 366

Query: 416 NVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPP 475
           NVKKWGYAKS+G+KLPPPSY++Y QDVLLESSYEDD TDNES ST++GDI+DS+G LLPP
Sbjct: 367 NVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSYEDDATDNESTSTIDGDIIDSEGHLLPP 426

Query: 476 PPGFEFSTTPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQLQQIVE 535
           PPGFE+S +PQ   +   Q TL+SLP +PP Y+SD        E+ +E ET QQL+Q+  
Sbjct: 427 PPGFEYSVSPQP--SAAGQFTLNSLPPEPPRYASDT------PEDAEEAETGQQLEQLAH 478

Query: 536 ERGEDEMNFDMQSSPVDGNNLNDNTVANQFI 566
           +  E    +        GN L  NT+ANQF+
Sbjct: 479 DVEEGNEIY-------AGNELGKNTMANQFL 502

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 336/421 (79%), Gaps = 15/421 (3%)

Query: 116 YILLTLIYFSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSP 175
           Y+L  L+YF  R+++K+ F+ RISL+   + N    +  S    LDDE  VK+ L  LSP
Sbjct: 51  YLLSILVYFVTRWLVKRLFTARISLHEEGTMN-GGQSDLSEDRYLDDESEVKEFLQNLSP 109

Query: 176 EEQFYYKQGEEYIKQNPPLLIPHRSEDSQG----MLDPIINDQTIRFIEEEGVHAWEFQP 231
           +EQFYYKQGEEY+KQNPPLL+P+   D +     + DPI+N+QT++FIEEEG  AWEFQ 
Sbjct: 110 KEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQA 169

Query: 232 DPNLPNDTILIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYL 291
           DPNLPNDT++I+ +TE+TFLN++YDASVMT LP+PR+N+VYY+ECKIFELN  +   N+L
Sbjct: 170 DPNLPNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQGK---NHL 226

Query: 292 SDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDI 351
           SDNEMIS GLS+SPYPYFRLPGRHHHSI+YDS G RR N SF +SAEL ++FPR++KGD+
Sbjct: 227 SDNEMISIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDV 286

Query: 352 IGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFV 411
           IGIGYRT SGT+FFT NGKKLNEK +GGHIKGWKLKYLYPIVG+N+PCK+HVNFG+YGFV
Sbjct: 287 IGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFV 346

Query: 412 FIEANVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVS--TVEGDIVDSD 469
           +IEANVKKWGY+K+ G+KLPPPSY++Y QDVLLES++EDD++D+ES++  ++   I D  
Sbjct: 347 YIEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQS 406

Query: 470 GELLPPPPGFEFSTTPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQ 529
           G +LPPPPGFEFST+  S   + + IT+ SLPA+PP+YS+D+D     E NV++   A Q
Sbjct: 407 GNILPPPPGFEFSTSVASDIPV-ESITMHSLPAEPPNYSADED----EEHNVEDNTIANQ 461

Query: 530 L 530
            
Sbjct: 462 F 462

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/421 (64%), Positives = 320/421 (76%), Gaps = 27/421 (6%)

Query: 116 YILLTLIYFSVRFVIKKYFS--TRISLNNN---------NSPNIRTTTSNSWPSSLDDEE 164
           Y+ + +IYF+ + V+ +  +   RISL N           S  +  +  + WPS+LDDE 
Sbjct: 82  YLCICIIYFTTKIVVTRLLTRHARISLLNEEGMATGLSARSRRLAESAESRWPSALDDEN 141

Query: 165 AVKDKLVKLSPEEQFYYKQGEEYIKQNPPLLIP--HRSEDSQGMLDPIINDQTIRFIEEE 222
            VK KL KLSPEEQFYYKQGEEYIKQNPPL+I    RS D   + DPIINDQT +FIEEE
Sbjct: 142 EVKSKLQKLSPEEQFYYKQGEEYIKQNPPLIISTGSRSGDQNTVNDPIINDQTRQFIEEE 201

Query: 223 GVHAWEFQPDPNLPNDTILIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELN 282
           G  AWEFQP+PNLPNDTI++ENKTEI+FLNYNYDASV TNLP+P +NRVYY E KIFEL+
Sbjct: 202 GALAWEFQPNPNLPNDTIIVENKTEISFLNYNYDASVTTNLPIPCINRVYYCEFKIFELS 261

Query: 283 TSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASI 342
            +  D   L DNE+ISFGLS+SPYPYFRLPGRHHHSIAYDS G RRFNDSF+L  ELA +
Sbjct: 262 IT-DDQTTLKDNEIISFGLSTSPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLEPELADL 320

Query: 343 FPRYQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVH 402
           FP+ QKGDIIGIGYRT SGTVFFTRNGKK++EK +GGHIKGWK KYLYP+VGANVPCK+H
Sbjct: 321 FPKCQKGDIIGIGYRTRSGTVFFTRNGKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIH 380

Query: 403 VNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVS--- 459
           VNFGSYGFVFIEANVKKWGYAK +G+KLPPPSYD+Y QD LLES YED+   +       
Sbjct: 381 VNFGSYGFVFIEANVKKWGYAKPNGIKLPPPSYDDYVQDTLLESGYEDNDNSDNDSDDES 440

Query: 460 ---------TVEGDIVDSDGELLPPPPGFEFSTTPQSRGNIGDQITLDSLPAQPPSYSSD 510
                    +++  I+D DG LLPPPPGFEFST+P S G   ++I LDSLP  PPSYS +
Sbjct: 441 DTDNRRQHRSIKNTIIDIDGNLLPPPPGFEFSTSPHSHGT-NEEINLDSLPMNPPSYSDE 499

Query: 511 D 511
           +
Sbjct: 500 E 500

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/514 (53%), Positives = 356/514 (69%), Gaps = 38/514 (7%)

Query: 64  IVLAFIPKLTIGAPISEGTYSEHPSAPGFQDDYEXXXXXXXXXXXXXXXXXXYILLTLIY 123
           I + F+ +   G P++    +   SA  F DD E                  Y ++ LIY
Sbjct: 4   IAIWFLVRGARGMPVTLQRVARR-SATVFPDDNELDMDFVLFTFSLVFMLLCYGMMVLIY 62

Query: 124 FSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFYYKQ 183
             +R+V+++ F+ RI+L++++S       S   P+ LDDE  V+ KL +LSPEEQFYYKQ
Sbjct: 63  LGLRYVVRRCFTRRIALSSSDS---SRANSGDVPTVLDDELEVRHKLAQLSPEEQFYYKQ 119

Query: 184 GEEYIKQNPPLLIPHRSEDSQG-------MLDPIINDQTIRFIEEEGVHAWEFQPDPNLP 236
           GEE+IKQNPP L+P+++    G       + DP+INDQT+R+IEEEG  AWEFQP P+LP
Sbjct: 120 GEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLP 179

Query: 237 NDTILIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDN-NYLSDNE 295
            D + +EN+TE+TF+N N D SV TNLP+P  N+VYYFECKIFEL        ++LS+N+
Sbjct: 180 PDFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQ 239

Query: 296 MISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIG 355
           ++SFGL++SPYPYFRLPGRHHHS+AYDS G RR N+SF+L  EL+S+FPR +KGD+IGIG
Sbjct: 240 IVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIG 299

Query: 356 YRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEA 415
           YRT SGTVFFTRNGKKLNEK IGGHIKGWK+KYLYPIVGANVPCK+HVNFG+YGFV+IEA
Sbjct: 300 YRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEA 359

Query: 416 NVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPP 475
           NVKKWGYAK +G+KLPPP+Y++Y +DVLLESSYED++++ E+ S VE      DG LLPP
Sbjct: 360 NVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYEDEVSEGETNSFVEH---LHDGHLLPP 416

Query: 476 PPGFEFSTTPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHE-ENVDEEETAQQLQQIV 534
           PPGFEFSTTP S     DQ TL++LP +PP Y SD +   +H    V   E         
Sbjct: 417 PPGFEFSTTPTSN---CDQFTLNTLPTEPPGYMSDVNAGSKHNGRGVGRSE--------- 464

Query: 535 EERGEDEMNFDMQSSPVDGNNLNDNTVANQFIHE 568
                     ++QS   +   LN NT ANQFI++
Sbjct: 465 ----------NVQSDAPNAELLNANTFANQFIND 488

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  490 bits (1261), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 243/424 (57%), Positives = 317/424 (74%), Gaps = 30/424 (7%)

Query: 156 WPSSLDDEEAVKDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPH----RSEDSQ---GMLD 208
           WP++LDD + V+DKL +LSPEEQFYYKQGEEYIKQNPP L+      +SEDS       D
Sbjct: 115 WPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTRED 174

Query: 209 PIINDQTIRFIEEEGVHAWEFQPDPNLPNDTILIENKTEITFLNYNYDASVMTNLPVPRV 268
           PI+N+QT ++I+EEG +AWEF P+P++PN T+++ENKTE++FLNYNYDAS+ TNLP+P +
Sbjct: 175 PIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTEVSFLNYNYDASISTNLPIPCI 234

Query: 269 NRVYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRR 328
           N+VYY E KIFE +   + +  +S   +ISFGLS+ PYPYFRLPGRHHHSIAYDS G RR
Sbjct: 235 NKVYYCEFKIFETDGPLNSDENVSKG-VISFGLSTQPYPYFRLPGRHHHSIAYDSNGARR 293

Query: 329 FNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKY 388
           FNDSF+L+ +L ++FP+ +KGDI+GIGYR+ SGTVFFTRNGKKLNEK +GGHI+GWK +Y
Sbjct: 294 FNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQY 353

Query: 389 LYPIVGANVPCKVHVNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSY 448
           LYPI+G+NVPC++HVNFG+YGFV+IEANVKKWGYAKS+G+KLPPPSY++YG+D LLES  
Sbjct: 354 LYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAKSNGIKLPPPSYEDYGKDTLLESGG 413

Query: 449 ED-----DITDNESVSTVEG-------DIVDSDGELLPPPPGFEFSTTPQS-RGNIGDQI 495
           ED     D +D +S +   G       DI+  +GE+LPPPPGFEF+ +P + +  I ++I
Sbjct: 414 EDNDFDEDFSDGDSDNIAAGSTTNLNDDIIIRNGEILPPPPGFEFTMSPPTGKKIINEEI 473

Query: 496 TLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQLQQIVEERGEDEMNFDMQSSPVDGNN 555
            LDSLP  PPSYS D     EH    D+   + ++         DE +FD     VD +N
Sbjct: 474 NLDSLPMLPPSYSDD-----EHHSKNDKSAISGRIIGTSRNLITDEASFD----SVDNDN 524

Query: 556 LNDN 559
            ++N
Sbjct: 525 EDEN 528

>Scas_669.10
          Length = 585

 Score =  474 bits (1220), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/483 (56%), Positives = 320/483 (66%), Gaps = 74/483 (15%)

Query: 127 RFVIKKYFST---RISLNNNNSPNIRTTTSNS----------------WPSSLDDEEAVK 167
           +FV+ +  ++   RISL N       T T+N                   S LDD E VK
Sbjct: 77  KFVVTRMLTSNISRISLLNRTEVEESTRTNNEGTGRSRRSTRRDQRFDLESFLDDPETVK 136

Query: 168 DKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHR---------SEDSQGMLDPIINDQTIRF 218
            KL  L+PEEQFYYKQGEE+IKQNPP++IP           + DS    DPI+N QT +F
Sbjct: 137 SKLSLLNPEEQFYYKQGEEFIKQNPPIIIPPNNNNNSNDISTTDSNAEDDPIMNHQTKQF 196

Query: 219 IEEEGVHAWEFQPDPNLPNDTILIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKI 278
           IEEEG  AWEFQ DPNLPNDTILIENKTEITFLNYNYDASVMTNLP+P +NRVYY E KI
Sbjct: 197 IEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTNLPIPCINRVYYCEFKI 256

Query: 279 FELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAE 338
           FELN S    N LS NE+IS GL++SPYPYFRLPGRHHHSIAYDS G RRFNDSF L  E
Sbjct: 257 FELNNSPEQTN-LSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPE 315

Query: 339 LASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVP 398
           LA++FP  ++GDIIG+GYRT SGT FFTRNGKK++EK IGGHIKG K+KYLYPIVG NVP
Sbjct: 316 LANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVP 375

Query: 399 CKVHVNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSYDEYGQDVLLES--SYEDDITDNE 456
           CKVHVNFG+YGFV+IEANVKKWGYAKSHG+K+PPPSY+EYG+D L+ S    ED I D E
Sbjct: 376 CKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDALVGSYQDLEDGINDEE 435

Query: 457 SV-------------------STVEGD-IVDSDGELLPPPPGFEFSTTPQSR--GNIGDQ 494
                                +T E D + D  G+LLPPPPGFEFST+P S    N  + 
Sbjct: 436 EDYEDEEEEDEEEDYDEEDDNTTTETDPLRDEYGQLLPPPPGFEFSTSPLSNFGQNEEED 495

Query: 495 ITLDSLPAQPPSYSSD----------DDIRG-----------EHEENVDEEETAQQLQQI 533
           I L+SLP  PP YS D          D+ R            EH++  D E T  QLQ +
Sbjct: 496 INLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDFIENDASWDEHDDEADYERTTNQLQGL 555

Query: 534 VEE 536
           +E+
Sbjct: 556 LED 558

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  144 bits (362), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 169/365 (46%), Gaps = 98/365 (26%)

Query: 157 PSSLDDEEAV--------KDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLD 208
           P   DDE+AV        KDK  K   E    Y++ +E+ K NPP++       S G   
Sbjct: 107 PGKFDDEQAVQEQEDECFKDKFSKFEIE---LYQRAKEFQKVNPPIV------KSFGTYT 157

Query: 209 PIINDQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENKTEITFLNYNYDASV 259
           P+ + Q I+   + G+ ++ F P  N         LP  + LI++K +I F  YN  +S 
Sbjct: 158 PLKDKQLIK---DRGIQSYYFLPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSA 212

Query: 260 MTNLPVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHS 318
           + N P+P   +   YFE K+F+  +          N + + GL + PYPYFR+PG + HS
Sbjct: 213 IMNFPLPYNRKDAVYFEVKVFKYPSK--------SNSIFTIGLITPPYPYFRMPGYNKHS 264

Query: 319 IAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKK------- 371
           IAY+STG  R ++ F  +    ++ P+ ++GD++G GYR  SGT+F T NGKK       
Sbjct: 265 IAYESTGKLRISNPFYAN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTEN 320

Query: 372 ---------------------------------LNEKPIGGHIK---------GWKLKYL 389
                                            L+E+ +   +            +L+ +
Sbjct: 321 IGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERV 380

Query: 390 YPIVGANVPC---KVHVNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSY--DEYGQDVLL 444
           +     ++P    ++ VN G  GFVFIEANVKK+ +   +G    PPSY  DE  QD +L
Sbjct: 381 HDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVL 440

Query: 445 ESSYE 449
           +   E
Sbjct: 441 QKGEE 445

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  131 bits (330), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 125/230 (54%), Gaps = 37/230 (16%)

Query: 157 PSSLDDEEAVK----DKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLDPIIN 212
           P   DD+E++K     +L K+S  E   Y++ +E+ K +PP++ P         L   +N
Sbjct: 105 PGKFDDDESLKVREAKELPKMSSFEVELYERTKEFQKMSPPMVKP---------LGSFLN 155

Query: 213 DQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNL 263
            Q  + I++ G+ ++ F P  N         LP  +  +E+K  ++F  +N  +S + N 
Sbjct: 156 SQDKQVIKDRGIQSYFFLPSINDNVDINGAFLP--SFFVEDKLNVSFTKFNISSSAIMNY 213

Query: 264 PVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYD 322
           P+P   +   YFE K+++  T          N + S GL + PYPYFR+PG   +SIAY+
Sbjct: 214 PLPMNKKDAVYFEVKVYKFKTCS--------NSIFSIGLMTCPYPYFRIPGTAAYSIAYE 265

Query: 323 STGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKL 372
           STG  R N++F       ++ P+ ++GD++G GYR +SGT+F T NGKK+
Sbjct: 266 STGKLRINNAFGAD----TLLPKLEEGDVVGFGYRYSSGTIFITHNGKKM 311

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  132 bits (331), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 165/358 (46%), Gaps = 88/358 (24%)

Query: 157 PSSLDDEEAV----KDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLDPIIN 212
           P   DD E      ++ L+K+SP E   Y + +E+   +PP +     ++    LD    
Sbjct: 109 PGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAV-----QEFGTYLD---- 159

Query: 213 DQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNL 263
            + ++ I++ G+ ++ F P  N         LP  + L+++K E+ F  +N  +S + N 
Sbjct: 160 SKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVLNY 217

Query: 264 PVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYD 322
           P+P   +   YFE K++        N+  + N + S GL + PYPYFR+PG    SIAY+
Sbjct: 218 PLPYNKKDAVYFEVKVY--------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYE 269

Query: 323 STGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKK----------- 371
           STG  R ND F  S    ++ P+  +GD++G GYR  +GT+F T NGKK           
Sbjct: 270 STGKLRINDPFFPS----TLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVE 325

Query: 372 --------------------LNEKPIGGHIK-----GWKLKYLYPIVGANVP-------- 398
                               L E P    ++     G +LK    I   + P        
Sbjct: 326 LFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDI 385

Query: 399 -----CKVHVNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSY--DEYGQDVLLESSYE 449
                 ++HVN G  GFVFIEANVKK+G+    G    PP+Y  ++  +D L++   E
Sbjct: 386 IDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEE 443

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  123 bits (308), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 113/215 (52%), Gaps = 39/215 (18%)

Query: 172 KLSPEEQFYYKQGEEYIKQNPPLLIPHRS----EDSQGMLDPIINDQTIRFIEEEGVHAW 227
           ++S  E   Y + +E+   NPPL+    +    ED Q              + + G+ A+
Sbjct: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQ-------------CVRDRGIQAY 107

Query: 228 EFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNLPVPRVNR-VYYFECK 277
              P  N         LP  + L+++K  +TF  YN  +S + N P+P   R   YFE K
Sbjct: 108 YLLPSINDNVDRRGNFLP--SFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVK 165

Query: 278 IFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSA 337
           +++        NYL+ N + S GL + PYPYF +PG   +SIAY+STG  R N+SF  S 
Sbjct: 166 VYKFR------NYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS- 218

Query: 338 ELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKL 372
              ++ P+ Q+GD++G+GYR  +GTVF T NGKK+
Sbjct: 219 ---TLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  118 bits (296), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 129/248 (52%), Gaps = 37/248 (14%)

Query: 139 SLNNNNSPNIRTTTSNSWPSSLDDEEAVKDK----LVKLSPEEQFYYKQGEEYIKQNPPL 194
           SL       I   +S + P   DDE  ++++    L K+S  E   Y + +E+   +PP+
Sbjct: 95  SLFGKKHSGILLDSSFASPGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPM 154

Query: 195 LIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENK 245
           +     +D    LD   +DQ  +FI++ G+ ++   P  N         LP  + ++++K
Sbjct: 155 V-----KDFGTYLDS--DDQ--QFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDK 203

Query: 246 TEITFLNYNYDASVMTNLPVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSS 304
            +I F  +N  +S + N P+P   +   YFE KIF         +    N + S GL++ 
Sbjct: 204 LDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFR--------HIQKSNSIFSIGLTTV 255

Query: 305 PYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVF 364
           PYPYFR+PG   +SIAY+STG  R N+ F  S    ++ P+ ++GD +G GYR  +GT+F
Sbjct: 256 PYPYFRVPGMAKYSIAYESTGKLRINNPFTAS----TLLPKLEEGDTVGFGYRYKTGTIF 311

Query: 365 FTRNGKKL 372
            T NGKKL
Sbjct: 312 ITHNGKKL 319

>Kwal_26.7665
          Length = 551

 Score =  118 bits (295), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 120/230 (52%), Gaps = 37/230 (16%)

Query: 157 PSSLDDEEAVKDK----LVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLDPIIN 212
           P   DDE A+ ++    L ++S  E   Y++  E+ K  PP +    +  S        +
Sbjct: 138 PGQFDDEHALLEQEAVELPRMSRFEVELYQRCREFQKMCPPNVTEFGTYTSA-------S 190

Query: 213 DQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNL 263
           D+  +FI++ GV ++ F P  N         LP  + ++++K ++ F  +N  AS + N 
Sbjct: 191 DK--QFIKDRGVQSYYFLPSINDNVDHYGNFLP--SFIVQDKLDVLFTKFNRSASTIMNY 246

Query: 264 PVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYD 322
           P+P+  +   YFE K+F+             N + S GL + PYPYFR+PG    SIAY+
Sbjct: 247 PLPQNKKEAVYFEVKVFKFPAK--------SNSIFSCGLVTCPYPYFRIPGMAQFSIAYE 298

Query: 323 STGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKL 372
           STG  R N+ F  +    ++ P+ Q+GD+IG GYR  +GT+  T NGKKL
Sbjct: 299 STGKLRMNNPFYAN----TLLPKLQEGDVIGFGYRYKTGTILITHNGKKL 344

>Scas_721.126
          Length = 573

 Score =  115 bits (288), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 120/239 (50%), Gaps = 37/239 (15%)

Query: 148 IRTTTSNSWPSSLDDE----EAVKDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDS 203
           I   +S + P   DDE    E    +L ++SP E   YK+  E+ +  PP    H  E  
Sbjct: 103 ILLDSSFTSPGQFDDECEHQEREHTELNRMSPFELELYKRSNEFQEVAPP----HIDE-- 156

Query: 204 QGMLDPIINDQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENKTEITFLNYN 254
                  +    ++ I++ G+ ++   P  N         LP  + LI++K ++ F  YN
Sbjct: 157 ---FGTYLKATDLQVIKDRGIQSYFLLPSINDNVNKQGNFLP--SFLIQDKLDMVFTKYN 211

Query: 255 YDASVMTNLPVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPG 313
             +S + N P+P   R   YFE K+F+        +    N + S GL + PYPYFR+PG
Sbjct: 212 KSSSTVMNYPLPYTKRDAVYFEVKVFK--------HQPVSNTIFSIGLVTVPYPYFRIPG 263

Query: 314 RHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKL 372
               SIAY+STG  R N+ F  S    ++ P+  +GD++G GYR +SGT+F T NGKKL
Sbjct: 264 MAKFSIAYESTGKLRINNPFMAS----TLLPKLVEGDVVGFGYRYSSGTIFITHNGKKL 318

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 52/127 (40%), Gaps = 11/127 (8%)

Query: 346 YQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNF 405
           Y + D+IG G    +G+VFFT+NG  L     G  +         P +       V  NF
Sbjct: 502 YGRDDVIGCGINYVNGSVFFTKNGVFL-----GEAVSSLMNVNAIPYIALKSGNSVRTNF 556

Query: 406 GSY-GFVF----IEANVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYE-DDITDNESVS 459
           G Y  FVF     + N K+  Y       +    + +    ++ ES  E DD  D   +S
Sbjct: 557 GLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLS 616

Query: 460 TVEGDIV 466
            ++  ++
Sbjct: 617 LLQKGLI 623

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 9/73 (12%)

Query: 340 ASIFPRYQK----GDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGA 395
            S+F  Y K     D+IG G     GT+FFT+NG  L     G   K      L P V  
Sbjct: 392 GSLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSL 446

Query: 396 NVPCKVHVNFGSY 408
                +  NFG Y
Sbjct: 447 KPANSIRTNFGLY 459

>Scas_686.22
          Length = 416

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245
           +L+P+ +ED++G+L   I D   + F+E E ++   F+       PD  LP    +    
Sbjct: 230 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREG 289

Query: 246 TEITFLNYN 254
           T+I+ + Y 
Sbjct: 290 TDISIITYT 298

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245
           +L P+ +ED++G+L   I D   + F+E E ++   F+       PD  LP  + +    
Sbjct: 173 VLCPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREG 232

Query: 246 TEITFLNYN 254
           T+I+ + Y+
Sbjct: 233 TDISIITYS 241

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245
           +L+P+ +ED++G+L   I D   + F+E E ++  +F+       PD  LP    + +  
Sbjct: 172 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEG 231

Query: 246 TEITFLNYN 254
            +I+ + Y 
Sbjct: 232 KDISIITYT 240

>Kwal_47.19173
          Length = 836

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 345 RYQKGDIIGIGYRTNSGTVFFTRNGKKL 372
           +Y + D+IG G     GT+FFT+NG  L
Sbjct: 438 QYGRNDVIGCGVNYVDGTIFFTKNGLHL 465

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245
           +L+P+ +ED++G+L   I D   + F+E E ++   F+       P+  LP    +    
Sbjct: 180 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREG 239

Query: 246 TEITFLNYN 254
           T+I+ + Y 
Sbjct: 240 TDISIVTYT 248

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 34/83 (40%), Gaps = 9/83 (10%)

Query: 331 DSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLY 390
           +S E S E A  F R    D+IG G     G++FFT+NG  L     G            
Sbjct: 521 NSTEQSKEYAKPFGR---DDVIGCGINFIDGSIFFTKNGIHL-----GNAFTDLNDLEFV 572

Query: 391 PIVGANVPCKVHVNFG-SYGFVF 412
           P V       +  NFG +  FVF
Sbjct: 573 PYVALRPGNSIKTNFGLNEDFVF 595

>Scas_599.10
          Length = 551

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 214 QTIRFIEEEGVHAWEFQPDPNLPNDTI 240
           +T++   +EG+  + + PDP LPN T+
Sbjct: 294 ETVKLRSKEGIMDYRYMPDPELPNVTL 320

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
           kinase kinase (MAPKKK) with strong similarity to Ssk2p,
           participates in the high-osmolarity signal transduction
           pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 429 KLPPPSYDEY-GQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPPPPGFEFSTTPQS 487
           KL   + D+Y  + + L + YE+D  D+E +    GD +D D   L     F FSTTP  
Sbjct: 78  KLKKTALDDYYTRGIKLTNRYEEDDGDDEIIRLSNGDRIDED---LHSGVKF-FSTTPYC 133

Query: 488 R 488
           R
Sbjct: 134 R 134

>Scas_712.23
          Length = 973

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 346 YQKGDIIGIGYRTNSGTVFFTRNG 369
           + + DIIG G     GT+FFT+NG
Sbjct: 580 FGRDDIIGCGINYIDGTIFFTKNG 603

>Scas_480.1
          Length = 939

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 10/69 (14%)

Query: 484 TPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQ----------QLQQI 533
           TPQ    + +   +  +P  P ++++DD+   EH++ ++EE+  +          Q QQ 
Sbjct: 128 TPQVPKTVEESKHVPKMPTLPSTFNADDNGDHEHDQQLEEEDLPKMSLKERIALLQEQQR 187

Query: 534 VEERGEDEM 542
           ++ + +DEM
Sbjct: 188 LQTKKDDEM 196

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,940,896
Number of extensions: 1021027
Number of successful extensions: 4874
Number of sequences better than 10.0: 97
Number of HSP's gapped: 4902
Number of HSP's successfully gapped: 107
Length of query: 568
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 461
Effective length of database: 12,891,983
Effective search space: 5943204163
Effective search space used: 5943204163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)