Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2075.334534515940.0
Kwal_33.1544630529013030.0
KLLA0E09680g30728912401e-172
CAGL0B03883g30630011471e-158
CAGL0K12210g3113083119e-33
Sklu_1926.23052903039e-32
Sklu_2398.43092863002e-31
YPR058W (YMC1)3073042942e-30
CAGL0D01606g3053042933e-30
YOR130C (ORT1)2922862913e-30
Kwal_33.129883032832862e-29
KLLA0B08503g3032932836e-29
Scas_667.223063062802e-28
Kwal_27.125993042972792e-28
Scas_718.53242882802e-28
CAGL0K10362g3012892713e-27
KLLA0E02772g2842892686e-27
YBR104W (YMC2)3292992672e-26
Kwal_55.213353172742662e-26
Sklu_1275.13112972619e-26
Sklu_2127.52782742591e-25
Kwal_56.230113032782582e-25
AFR146W2812732572e-25
Scas_632.92923022573e-25
ACR109W2992842555e-25
KLLA0F17864g3072832512e-24
Kwal_26.86692962702503e-24
YOR222W (ODC2)3072812452e-23
ADL264C3293302391e-22
CAGL0K02365g9192802416e-22
Scas_714.183052942292e-21
ADL049W9122792353e-21
Kwal_47.173218812752353e-21
KLLA0D07073g2972702274e-21
KLLA0E13453g9062882344e-21
YPR021C (AGC1)9022792256e-20
Scas_640.253062972171e-19
Sklu_2359.69022922185e-19
CAGL0J04114g3032792117e-19
YOR100C (CRC1)3272852127e-19
Kwal_23.29133202912127e-19
CAGL0J02002g3612902121e-18
Scas_697.473282892101e-18
KLLA0C13431g3282922092e-18
Sklu_2431.53703022022e-17
CAGL0B04543g3172932003e-17
YEL006W3352872003e-17
KLLA0E23705g3683031987e-17
Scas_721.273743061961e-16
Scas_602.88852881991e-16
Kwal_27.120813692991925e-16
Scas_709.93653001925e-16
AEL253W3653001915e-16
Scas_589.103162851897e-16
Kwal_55.208683802991908e-16
YIL006W3732871891e-15
YPL134C (ODC1)3102851834e-15
AGL311C3623091792e-14
ADL009W3792891793e-14
Sklu_2334.23192961746e-14
Scas_691.43343161614e-12
YBR192W (RIM2)3773051607e-12
KLLA0F04697g3072891588e-12
CAGL0K11616g3201931561e-11
KLLA0B12826g3193061561e-11
KLLA0C11363g5171801572e-11
CAGL0M05225g3813071562e-11
Kwal_23.39653071711524e-11
Kwal_26.79672972951516e-11
Kwal_26.76533251881508e-11
CAGL0J05522g5191891528e-11
Sklu_1149.22962941499e-11
CAGL0F04213g3062931482e-10
YNL083W5451771502e-10
AER419W4931771492e-10
CAGL0G08910g2892751462e-10
YJR095W (SFC1)3222971463e-10
AER366W2931801453e-10
AER184W3052881453e-10
Scas_718.243373001463e-10
Sklu_2363.23233131453e-10
CAGL0M09020g3483291463e-10
Kwal_23.47313142941454e-10
YBR291C (CTP1)2992741445e-10
Sklu_2037.23102901436e-10
CAGL0G03135g3073081437e-10
Kwal_47.182163333161437e-10
YBR085W (AAC3)3071761428e-10
YKL120W (OAC1)3241861421e-09
KLLA0D15015g3171741411e-09
Scas_489.42971861392e-09
KLLA0E18810g3772741402e-09
YMR056C (AAC1)3092821392e-09
Scas_716.293162981392e-09
YBL030C (PET9)3182811392e-09
CAGL0K08250g2973001382e-09
Scas_328.12271641345e-09
KLLA0D14036g4313221376e-09
Kwal_27.124813041571356e-09
Sklu_2430.103241911348e-09
CAGL0K02915g3423111359e-09
KLLA0F03212g3052981349e-09
Scas_578.3*5241801351e-08
KLLA0E12353g3051571321e-08
CAGL0L02079g2972741322e-08
Sklu_2432.52882731322e-08
Kwal_23.30425421761342e-08
YIL134W (FLX1)3112831322e-08
Scas_667.43082801303e-08
AFR147C3152521313e-08
YPR128C (ANT1)3282881303e-08
Scas_379.23013041293e-08
CAGL0J01661g3273081294e-08
AGL065C3351981294e-08
YJL133W (MRS3)3142811294e-08
Kwal_55.213383231681286e-08
Kwal_14.22103152931286e-08
CAGL0L05742g3052921276e-08
Sklu_2374.75131801297e-08
Sklu_2433.8420931287e-08
ACR260W3112981251e-07
Scas_582.73292921252e-07
CAGL0F07711g3681881252e-07
Scas_717.203563081242e-07
Scas_687.15*3281021242e-07
AGL047C3163051232e-07
Scas_721.1293231861224e-07
Kwal_23.35293952701224e-07
Kwal_47.19228281971196e-07
YMR166C3682881207e-07
KLLA0A00979g343881197e-07
Scas_715.453052001198e-07
YPR011C3263021198e-07
AFR253W344891199e-07
AGR383W2931881189e-07
CAGL0D04774g3222891189e-07
Scas_662.123082901162e-06
YKR052C (MRS4)3042811152e-06
AAR036W3171861152e-06
YGR096W (TPC1)3142121153e-06
Scas_645.93912771153e-06
Kwal_26.79723583131135e-06
ABL023W3092901126e-06
Sklu_2115.42991791126e-06
KLLA0E15532g3263061117e-06
Kwal_33.140503142941108e-06
YHR002W (LEU5)3573081101e-05
ADR036C3401631101e-05
Scas_669.63732891082e-05
Scas_613.241771681052e-05
YGR257C (MTM1)3662821082e-05
Sklu_2435.23442221055e-05
CAGL0G01166g2952661037e-05
Kwal_55.211063282091021e-04
YLR348C (DIC1)2982721002e-04
YFR045W285551002e-04
AFL196W3612001002e-04
Kwal_27.11419298278992e-04
AAL014C271265992e-04
KLLA0D04290g188193953e-04
YMR241W (YHM2)314262965e-04
AFR131C344268957e-04
CAGL0C02013g32970957e-04
YER053C300183957e-04
Scas_705.9323292940.001
Kwal_23.435434370920.002
KLLA0D09889g364338920.002
Sklu_2442.8275271900.002
CAGL0H10538g297173900.003
Sklu_2127.432367890.004
Sklu_2194.3312261890.004
KLLA0B11319g355241880.005
Scas_558.2289272880.006
Scas_696.9312125870.006
Scas_562.12300150850.011
AGL064W296128850.014
KLLA0A09383g366280840.016
KLLA0E08877g294171830.022
AGR191W29862810.035
KLLA0E18788g38168810.043
KLLA0F08547g308172800.051
KLLA0D04312g10381750.052
Kwal_33.15597305146800.056
Kwal_27.1162629962780.099
Sklu_1119.1307146780.10
Sklu_2260.5302197770.12
YDL198C (YHM1)30062760.13
Scas_673.17314245760.14
AFR542W310184760.15
KLLA0B14454g305146760.15
CAGL0F00231g307146760.17
CAGL0H03839g282271750.21
YNL003C (PET8)284267740.25
Sklu_2117.229865740.31
KLLA0E02750g30474730.36
CAGL0J09790g300150730.36
YDL119C307181730.37
CAGL0K07436g307255720.55
Scas_702.10302269710.62
KLLA0F13464g30062710.68
Scas_671.1*12335670.74
KLLA0D04950g274268700.81
CAGL0F08305g374158700.83
Sklu_1982.347635691.5
AER450C308148635.7
Kwal_23.5757307164628.1
Kwal_0.232274271619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2075.3
         (345 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               618   0.0  
Kwal_33.15446                                                         506   0.0  
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   482   e-172
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   446   e-158
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   124   9e-33
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         121   9e-32
Sklu_2398.4 , Contig c2398 9476-10405                                 120   2e-31
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   117   2e-30
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   117   3e-30
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   116   3e-30
Kwal_33.12988                                                         114   2e-29
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   113   6e-29
Scas_667.22                                                           112   2e-28
Kwal_27.12599                                                         112   2e-28
Scas_718.5                                                            112   2e-28
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   108   3e-27
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   107   6e-27
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   107   2e-26
Kwal_55.21335                                                         107   2e-26
Sklu_1275.1 , Contig c1275 314-1249                                   105   9e-26
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        104   1e-25
Kwal_56.23011                                                         103   2e-25
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...   103   2e-25
Scas_632.9                                                            103   3e-25
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   102   5e-25
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   101   2e-24
Kwal_26.8669                                                          100   3e-24
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    99   2e-23
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    97   1e-22
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    97   6e-22
Scas_714.18                                                            93   2e-21
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    95   3e-21
Kwal_47.17321                                                          95   3e-21
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    92   4e-21
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    95   4e-21
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    91   6e-20
Scas_640.25                                                            88   1e-19
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          89   5e-19
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    86   7e-19
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    86   7e-19
Kwal_23.2913                                                           86   7e-19
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    86   1e-18
Scas_697.47                                                            86   1e-18
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    85   2e-18
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            82   2e-17
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    82   3e-17
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    82   3e-17
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    81   7e-17
Scas_721.27                                                            80   1e-16
Scas_602.8                                                             81   1e-16
Kwal_27.12081                                                          79   5e-16
Scas_709.9                                                             79   5e-16
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    78   5e-16
Scas_589.10                                                            77   7e-16
Kwal_55.20868                                                          78   8e-16
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    77   1e-15
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    75   4e-15
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    74   2e-14
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    74   3e-14
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         72   6e-14
Scas_691.4                                                             67   4e-12
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    66   7e-12
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    65   8e-12
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    65   1e-11
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    65   1e-11
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    65   2e-11
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    65   2e-11
Kwal_23.3965                                                           63   4e-11
Kwal_26.7967                                                           63   6e-11
Kwal_26.7653                                                           62   8e-11
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    63   8e-11
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         62   9e-11
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    62   2e-10
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    62   2e-10
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    62   2e-10
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    61   2e-10
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    61   3e-10
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    60   3e-10
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    60   3e-10
Scas_718.24                                                            61   3e-10
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          60   3e-10
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    61   3e-10
Kwal_23.4731                                                           60   4e-10
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    60   5e-10
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         60   6e-10
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    60   7e-10
Kwal_47.18216                                                          60   7e-10
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    59   8e-10
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    59   1e-09
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    59   1e-09
Scas_489.4                                                             58   2e-09
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    59   2e-09
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    58   2e-09
Scas_716.29                                                            58   2e-09
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    58   2e-09
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    58   2e-09
Scas_328.1                                                             56   5e-09
KLLA0D14036g complement(1203522..1204817) some similarities with...    57   6e-09
Kwal_27.12481                                                          57   6e-09
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         56   8e-09
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    57   9e-09
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    56   9e-09
Scas_578.3*                                                            57   1e-08
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    55   1e-08
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    55   2e-08
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       55   2e-08
Kwal_23.3042                                                           56   2e-08
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    55   2e-08
Scas_667.4                                                             55   3e-08
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    55   3e-08
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    55   3e-08
Scas_379.2                                                             54   3e-08
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    54   4e-08
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    54   4e-08
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    54   4e-08
Kwal_55.21338                                                          54   6e-08
Kwal_14.2210                                                           54   6e-08
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    54   6e-08
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       54   7e-08
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       54   7e-08
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    53   1e-07
Scas_582.7                                                             53   2e-07
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    53   2e-07
Scas_717.20                                                            52   2e-07
Scas_687.15*                                                           52   2e-07
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    52   2e-07
Scas_721.129                                                           52   4e-07
Kwal_23.3529                                                           52   4e-07
Kwal_47.19228                                                          50   6e-07
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    51   7e-07
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    50   7e-07
Scas_715.45                                                            50   8e-07
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    50   8e-07
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    50   9e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    50   9e-07
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    50   9e-07
Scas_662.12                                                            49   2e-06
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    49   2e-06
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    49   2e-06
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    49   3e-06
Scas_645.9                                                             49   3e-06
Kwal_26.7972                                                           48   5e-06
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    48   6e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            48   6e-06
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    47   7e-06
Kwal_33.14050                                                          47   8e-06
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    47   1e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    47   1e-05
Scas_669.6                                                             46   2e-05
Scas_613.24                                                            45   2e-05
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    46   2e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         45   5e-05
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    44   7e-05
Kwal_55.21106                                                          44   1e-04
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    43   2e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    43   2e-04
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    43   2e-04
Kwal_27.11419                                                          43   2e-04
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    43   2e-04
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    41   3e-04
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    42   5e-04
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    41   7e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    41   7e-04
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    41   7e-04
Scas_705.9                                                             41   0.001
Kwal_23.4354                                                           40   0.002
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    40   0.002
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          39   0.002
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    39   0.003
Sklu_2127.4 , Contig c2127 6322-7293                                   39   0.004
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            39   0.004
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    39   0.005
Scas_558.2                                                             39   0.006
Scas_696.9                                                             38   0.006
Scas_562.12                                                            37   0.011
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    37   0.014
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    37   0.016
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    37   0.022
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    36   0.035
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    36   0.043
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    35   0.051
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    33   0.052
Kwal_33.15597                                                          35   0.056
Kwal_27.11626                                                          35   0.099
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             35   0.10 
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         34   0.12 
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    34   0.13 
Scas_673.17                                                            34   0.14 
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    34   0.15 
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    34   0.15 
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    34   0.17 
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    33   0.21 
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    33   0.25 
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            33   0.31 
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    33   0.36 
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    33   0.36 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    33   0.37 
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    32   0.55 
Scas_702.10                                                            32   0.62 
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    32   0.68 
Scas_671.1*                                                            30   0.74 
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    32   0.81 
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    32   0.83 
Sklu_1982.3 YDL238C, Contig c1982 3793-5223                            31   1.5  
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    29   5.7  
Kwal_23.5757                                                           28   8.1  
Kwal_0.232                                                             28   9.1  

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/345 (88%), Positives = 305/345 (88%)

Query: 1   MKNFDIKRFCRILACRKTTFIEQRDXXXXXXXXXXXXXXXXXXXXXXDIQQPPPSEAYSR 60
           MKNFDIKRFCRILACRKTTFIEQRD                      DIQQPPPSEAYSR
Sbjct: 1   MKNFDIKRFCRILACRKTTFIEQRDSRNTSHIPSSSSTSTSIMSGKSDIQQPPPSEAYSR 60

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF
Sbjct: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
           TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE
Sbjct: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELL 240
           LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELL
Sbjct: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELL 240

Query: 241 TRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAK 300
           TRWFKEHTNMSDTAINFW          WTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAK
Sbjct: 241 TRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAK 300

Query: 301 DIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAKVN 345
           DIWRTRGYRGFFKGFVPSFLRSFP        FEFVLRTSGAKVN
Sbjct: 301 DIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRTSGAKVN 345

>Kwal_33.15446
          Length = 305

 Score =  506 bits (1303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/290 (82%), Positives = 260/290 (89%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P+EAYSR+MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD+ RFKGPLDCVY+T  QQGI
Sbjct: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI 71

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173
           RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY +EEKLPLSGCI+SGV+AGWSVS
Sbjct: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131

Query: 174 FIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFW 233
           FIAAPVELAKAKLQVQYDA+TT+Y GP+DVIKKVY+++G+RG+YKGL STLIFRT+FV+W
Sbjct: 132 FIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYW 191

Query: 234 WGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR 293
           WGSYELLTRWFK +TN+SDTAINFW          WTTAYPSDVIKQV+LCNDKYDG+ R
Sbjct: 192 WGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLR 251

Query: 294 SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAK 343
           SW+ AA DIWRTRG RGFFKGFVPSFLRSFP        FEFVLR SGAK
Sbjct: 252 SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSGAK 301

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 226/289 (78%), Positives = 253/289 (87%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIR 114
           +E YSRIMGFV+G+FSG+AKNAVGHPFDTIKVRLQTSQ+ TRFKGPLDCVYKTF  QGIR
Sbjct: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSF 174
           GFYLGFTPPLVGWILMDSVMLGCLHNYRML+ KYVY N+EKLPLSGCIISGV+AGWSVSF
Sbjct: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSF 137

Query: 175 IAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWW 234
           IA P+ELAKAKLQVQYD  TT+Y GP+DVIKK+YS+ G+RGLYKGL STLIFRT+FV+WW
Sbjct: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWW 197

Query: 235 GSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRS 294
           GSYELLTRWF+E+T MS+ AINFW          WTTAYPSDV+KQVVLCNDKYDG+F+S
Sbjct: 198 GSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKS 257

Query: 295 WKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAK 343
           W+ A KDI++++G  GFFKGFVPSFLRSFP        FEFVLRTSGAK
Sbjct: 258 WRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLRTSGAK 306

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  446 bits (1147), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/300 (71%), Positives = 242/300 (80%), Gaps = 12/300 (4%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST----RFKGPLDCVYKTFTQQ 111
           E YSR+MGFV+GMFSG+AKN VGHPFDT+KVRLQTSQ  +    +FKGPLDCVYKT   Q
Sbjct: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64

Query: 112 GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWS 171
           GIRG YLGFTPPL GWI+MDS +LG LHNYRMLL KYVY   +KLPLSGCIISGVMAGW+
Sbjct: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWT 124

Query: 172 VSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS--------NGVRGLYKGLTST 223
           VSFIAAPVELAKAKLQVQYDAKTTKYTGP+DV++KV+           GVR LYKGL ST
Sbjct: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIST 184

Query: 224 LIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVL 283
           LIFR+NFVFWWGSYEL+T+WF+++TN+S  AINFW          WT+AYPSDV+KQVVL
Sbjct: 185 LIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244

Query: 284 CNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAK 343
           CNDKYDG+F+SW+ A  DI+R RG  GFFKGF+PSFLRSFP        FEFVLRTSGAK
Sbjct: 245 CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVLRTSGAK 304

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  124 bits (311), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 88/308 (28%), Positives = 148/308 (48%), Gaps = 23/308 (7%)

Query: 48  DIQQPPPSEAYSRIMGFV-SGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYK 106
           +++  PP   Y R++  + +G   G+A+  VG PFDT KVRLQTS+      G ++ V  
Sbjct: 13  ELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQN 69

Query: 107 TFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK--------LPL 158
               +G   FY G   PL+G  +  SV  G   + +   + +  YN ++        LPL
Sbjct: 70  LLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMK---RFFAAYNADRVDPQKHVPLPL 126

Query: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGLY 217
               + G+  G   SF+AAP+E  + +LQ Q       ++ GP D IKK+  +   + L 
Sbjct: 127 HQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALM 183

Query: 218 KGLTSTLIFRTNFV-FWWGSYE-LLTRWFKEHTNMSDT-AINFWXXXXXXXXXXWTTAYP 274
           +GL  T+I   + +  ++ +YE L+ + F++ T  +   A              W T YP
Sbjct: 184 RGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYP 243

Query: 275 SDVIKQVVLCNDKYDGTFRSWKL-AAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXF 333
            DV+K V+  +   +  +++  + A + +++  G   FFKGFVP+ +R+ P        F
Sbjct: 244 VDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303

Query: 334 EFVLRTSG 341
           E  +R  G
Sbjct: 304 EMTMRVLG 311

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  121 bits (303), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 136/290 (46%), Gaps = 23/290 (7%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
            ++G   G+++  +G PFDT KVRLQTS   T     LD V K    +G RGFY G   P
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---ALDVVKKLVKNEGFRGFYKGTLTP 83

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNE------EKLPLSGCIISGVMAGWSVSFIAA 177
           LVG     SV  G   N  M  K++ +         E L L    + G   G + SF+A+
Sbjct: 84  LVGVGACVSVQFGV--NEAM--KRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139

Query: 178 PVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV-FWWG 235
           P+E  + +LQ Q       ++ GP+D IKK+ ++N    L +GLT T++  ++    ++ 
Sbjct: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFL 196

Query: 236 SYELLTRWFKEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIKQVVLCNDKYD-GT 291
           +YE L    + H  +S + I  W             W   YP DVIK V+  +       
Sbjct: 197 TYEALIAN-ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255

Query: 292 FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSG 341
            ++    AK I+ TRG   FFKGF P+ LR+ P        FE  +R  G
Sbjct: 256 GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 81/178 (45%), Gaps = 13/178 (7%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDSTRFKGPLDCVYKTFTQ 110
           P+E    +  ++ G   G A + +  P + +++RLQT   +  + +F GPLDC+ K    
Sbjct: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN 173

Query: 111 QGIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRMLLKKYVY--YNEEKLPLSGCIISGVM 167
             +     G TP +    L +S   G     Y  L+   ++   +  ++P     + G  
Sbjct: 174 NSL---MRGLTPTM----LRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGAT 226

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
           +G ++  +  P+++ K+ +Q     +  +    + V K +YS+ G+   +KG   T++
Sbjct: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  120 bits (300), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 133/286 (46%), Gaps = 17/286 (5%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           I   +SG   GIA+  VG PFD  KVR+QTS  S      +D V      +GI GFY G 
Sbjct: 24  IKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSAT---AVDVVTSLIKNEGILGFYKGT 80

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
             PLVG     S   G     +   ++      + L L    + GV +G + +F+A P+E
Sbjct: 81  LAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIE 140

Query: 181 LAKAKLQVQYDA-KTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT--NFVFWWGSY 237
             + +LQ+Q  +    +Y G +D ++K+        L +G T+TL+ RT   F  ++ +Y
Sbjct: 141 HVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGA---LMRGFTATLM-RTCHGFGIYFSTY 196

Query: 238 E-LLTRWFKEHTNMSDTAI-NFWXXXXXXXXXXWTTAYPSDVIKQVVLCN---DKYDGTF 292
           E L+    K+     D A               W  AYP DV+K ++  +       GT 
Sbjct: 197 EALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHGT- 255

Query: 293 RSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
             W++A K I+ TRG R F KGF+P+ LRS P        FE  +R
Sbjct: 256 NVWQVA-KSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMR 300

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 9/176 (5%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS---TRFKGPLDCVYKTFTQ 110
           PS+  S    +V G+ SG A   +  P + +++RLQ    S     ++G LDC+ K   Q
Sbjct: 112 PSKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQ 171

Query: 111 QGI-RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAG 169
             + RGF         G+ +  S     + N      K     ++  P   CI  G  +G
Sbjct: 172 GALMRGFTATLMRTCHGFGIYFSTYEALIANQH----KKGIPRKDIAPWKVCIF-GAFSG 226

Query: 170 WSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
                +A P+++ K+ +Q          T    V K +Y++ G R   KG    ++
Sbjct: 227 ACYWAMAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAML 282

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 131/304 (43%), Gaps = 19/304 (6%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D+++ P  +    +   ++G   GIA+  VG PFDT KVRLQTS   T     ++ V K 
Sbjct: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVVRKL 69

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
              +G RGFY G   PL+G     S+  G     +             L L      GV 
Sbjct: 70  LANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVT 129

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
            G   SF+A+P+E  + +LQ Q  + T  ++ GP++ IKK+  +   + L +GLT T++ 
Sbjct: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILR 186

Query: 227 RTNFVFWWGSY-----ELLTRWFKEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVI 278
             +     G+Y      L+     +   +    I  W             W   YP DVI
Sbjct: 187 EGH---GCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVI 243

Query: 279 KQVVLCNDKYDGTF-RSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVL 337
           K V+  ++     F  S    AK ++   G   FFKGF P+ LR+ P        FE  +
Sbjct: 244 KSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAM 303

Query: 338 RTSG 341
           R  G
Sbjct: 304 RLLG 307

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  117 bits (293), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 136/304 (44%), Gaps = 21/304 (6%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D++  P  +    +   ++G   GIA+  +G PFDT KVRLQTS+  T      + V   
Sbjct: 13  DLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAA---EVVKNL 69

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
              +G +GFY G   PLVG     S+  G     +         +   L LS   + G+ 
Sbjct: 70  LKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLT 129

Query: 168 AGWSVSFIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
            G + SF+A+P+E  + +LQ Q       ++ GP+D IKK+ S    +GL +GL  T++ 
Sbjct: 130 GGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQ---KGLMRGLIPTMLR 186

Query: 227 RTNFVFWWGSYELLTRWF---KEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIKQ 280
             +     G+Y L+       + +  +  T I  W             W   YP DV+K 
Sbjct: 187 EGH---GCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKS 243

Query: 281 VVLC---NDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVL 337
           V+     N   +G  ++    A++++   G + FFKGF P+ LR+ P        FE  +
Sbjct: 244 VMQTDNLNKPQNG--KNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAM 301

Query: 338 RTSG 341
           R  G
Sbjct: 302 RLLG 305

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  116 bits (291), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/286 (29%), Positives = 134/286 (46%), Gaps = 24/286 (8%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLG 119
           I+  ++G  +G     +  PFDT+KVRLQT Q S  F     C+  T+  +GI RGF+ G
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQT-QASNVFPTTWSCIKFTYQNEGIARGFFQG 72

Query: 120 FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPV 179
              PLVG  L ++ +    +     L+K+        PL   +ISG +AG   S +  PV
Sbjct: 73  IASPLVGACLENATLFVSYNQCSKFLEKHTNV----FPLGQILISGGVAGSCASLVLTPV 128

Query: 180 ELAKAKLQV---QYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF--VFWW 234
           EL K KLQV   Q  +  TK+T  +  IK + +  G+ GL++G + T I R +F  V W+
Sbjct: 129 ELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFI-RESFGGVAWF 187

Query: 235 GSYELLTRWFKEHTNMSDTAIN---FWXXXXXXXXXXW---TTAYPSDVIKQVVLCNDKY 288
            +YE++ +  K+  ++ D   +    W               + +P+D +K V+      
Sbjct: 188 ATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEH-- 245

Query: 289 DGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
                S   A K I+   G +GF++G   +  R+ P        FE
Sbjct: 246 ----ISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

>Kwal_33.12988
          Length = 303

 Score =  114 bits (286), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 127/283 (44%), Gaps = 17/283 (6%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
             +G   GIA+  VG PFD  KVRLQTS   T     L  V      +G+RGFY G T P
Sbjct: 27  ITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTT---ALRVVQDLVKNEGLRGFYKGTTLP 83

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAK 183
           L+G  L  S   G     +    K   +    L L      G ++G + +F+A P+E  +
Sbjct: 84  LIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVR 143

Query: 184 AKLQVQYDAKT-TKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTN--FVFWWGSYELL 240
             LQVQ  ++   +Y G +D IKK+        L +G T T I RT+  F  ++ SYE +
Sbjct: 144 ILLQVQTKSRADAEYQGAMDCIKKLLKEG---KLMRGFTPT-ILRTSHGFGVYFTSYEAM 199

Query: 241 TRWFKEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKL 297
               ++   ++   I  W             W   YP DVIK  V+ +DK         +
Sbjct: 200 I-CSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKS-VMQSDKLRTPVYGTNV 257

Query: 298 --AAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
              AK+I+  RG + F KGF P+ LRS P        FE  +R
Sbjct: 258 FQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMR 300

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  113 bits (283), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 132/293 (45%), Gaps = 11/293 (3%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P +    I   ++G   GIA+  VG PFDT KVRLQTS+ ST     +  +      +G 
Sbjct: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN---AVKVIKDLIKNEGP 73

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173
            GFY G   PLVG     S+  G     +     +     + L L    I GV  G++ S
Sbjct: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS 133

Query: 174 FIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV- 231
           F+A+P+E  + +LQ Q     T ++ GP+D IKK+   NG   L +GLT T++  ++   
Sbjct: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNGQ--LMRGLTPTMLRESHGCG 190

Query: 232 FWWGSYE-LLTRWFKEHTNMSDT-AINFWXXXXXXXXXXWTTAYPSDVIKQVVLCND-KY 288
            ++ +YE L+    K      D  A              WT  YP DVIK V+  ++ K 
Sbjct: 191 VYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKT 250

Query: 289 DGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSG 341
                +     + I   +G  G FKGF P+ LR+ P        FE  +R  G
Sbjct: 251 PKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLLG 303

>Scas_667.22
          Length = 306

 Score =  112 bits (280), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 134/306 (43%), Gaps = 24/306 (7%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D++  P  +    I   ++G   GIA+  VG PFDT KVRLQTS   T     ++ + K 
Sbjct: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVIRKL 69

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNY-RMLLKKYVYYNEEKLPLSGCIISGV 166
              +G +GFY G   PL+G     S+  G      R    +      + L L    I G+
Sbjct: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129

Query: 167 MAGWSVSFIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
             G + SF+A+P+E  + +LQ Q       ++ GP+D I+K+ +     G  +GLT T++
Sbjct: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTML 186

Query: 226 FRTNFVFWWGSYELLTRWF---KEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIK 279
              +     G+Y L+       + +     T +  W             W   YP DVIK
Sbjct: 187 REGH---GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIK 243

Query: 280 QVV----LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
            V+    L + KY  +  S    AK ++   G   FFKGF P+ LR+ P        FE 
Sbjct: 244 SVMQTDNLKSPKYGNSISS---VAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFEL 300

Query: 336 VLRTSG 341
            +R  G
Sbjct: 301 AMRLLG 306

>Kwal_27.12599
          Length = 304

 Score =  112 bits (279), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 136/297 (45%), Gaps = 14/297 (4%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           DI Q P  ++   +   ++G   G+A+  VG PFDT KVRLQTS   T     ++ V K 
Sbjct: 13  DIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT---AVEVVKKL 68

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
              +G+RGFY G   PLVG     S   G     +   +       + L L    I G +
Sbjct: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFV 128

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
            G + SF+A+P+E  + +LQ Q  + T  ++ GP+D I K+  +NG   L +GL+ T++ 
Sbjct: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANGA--LMRGLSPTILR 185

Query: 227 RTN-FVFWWGSYE-LLTRWFKEHTNMSDT-AINFWXXXXXXXXXXWTTAYPSDVIKQVVL 283
                  ++ +YE L+     +    SD  A              W T YP DVIK  ++
Sbjct: 186 EAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKS-LM 244

Query: 284 CNDKYDGTFRSWKL--AAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
             D      R   +   A+ +    G++ FFKGF P+ LR+ P        FE  +R
Sbjct: 245 QTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMR 301

>Scas_718.5
          Length = 324

 Score =  112 bits (280), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 134/288 (46%), Gaps = 16/288 (5%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
            ++G   GI++  VG PFDT KVR+QTS  S    G LD + K    +G+  FY G   P
Sbjct: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---GALDIIRKLVKNEGVWAFYKGSLIP 99

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKY-----VYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178
           +VG     SV  G     +   +++       + +  L L    I G+  G   SF+A+P
Sbjct: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159

Query: 179 VELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV-FWWGS 236
           +E  + +LQ Q  +    ++ GP+D I+K+      + L +GL   ++   + +  ++ +
Sbjct: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216

Query: 237 YE-LLTRWFKEHTNMSDTAI-NFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR- 293
           YE L+    K+  + S+ A               W   YP DV+K ++  +   +  F+ 
Sbjct: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276

Query: 294 SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSG 341
           S K     ++R +G   FFKGF P+ LR+ P        FE V+R  G
Sbjct: 277 SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  108 bits (271), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 130/289 (44%), Gaps = 33/289 (11%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTPPLV 125
           G  +G     + +PFDT+KVRLQT Q    F     C+  T+  +GI +GF+ G   PL 
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQT-QGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLA 78

Query: 126 GWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAK 185
           G  + ++ +    +     L+ Y   ++    L+  +ISG  AG   SF+  PVEL K K
Sbjct: 79  GAAIENAALFLSYNQCSKFLQHYTNVSD----LTNILISGAFAGSCASFVLTPVELIKCK 134

Query: 186 LQVQY-----------DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF--VF 232
           LQV             +  T ++T  +  I+ V  + G  GL++G + T I R +F  V 
Sbjct: 135 LQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFI-RESFGGVA 193

Query: 233 WWGSYELLTRWFKEHTNMSDTAI-------NFWXXXXXXXXXXWTTAYPSDVIKQVVLCN 285
           W+ +YEL+ ++ K   N+ D ++                      + +P+D +K ++   
Sbjct: 194 WFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTE 253

Query: 286 DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
                     K A K I+  +G RGF++G   + +R+ P        +E
Sbjct: 254 H------LGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYE 296

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
             SG  +G+A NA   P DT+K  +QT        G    + K F ++G+RGFY G    
Sbjct: 226 LASGASAGLAFNASIFPADTVKSMMQTEH-----LGLKTAIKKIFVEKGLRGFYRGLGIT 280

Query: 124 LV 125
           L+
Sbjct: 281 LI 282

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  107 bits (268), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 130/289 (44%), Gaps = 21/289 (7%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI- 113
           S+  S +     G  +G     + +PFDT+KVRLQT Q +  +     C+  T+T +GI 
Sbjct: 2   SDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQT-QPAHLYPTTWSCIRSTYTDEGIW 60

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173
           +GFY G   PL G  L ++V+    +     L ++        PL+  I SG  AG   S
Sbjct: 61  KGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLK----PLTKTIYSGAFAGACAS 116

Query: 174 FIAAPVELAKAKLQV----QYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT- 228
           FI  PVEL K KLQV       ++TT++T     IK V    G+ GL++G  ST +    
Sbjct: 117 FILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECL 176

Query: 229 NFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXW---TTAYPSDVIKQVVLCN 285
               W+ +YE++   F    + ++   + W               + +P+D +K V  C 
Sbjct: 177 GGAVWFTTYEIMKMKFAS-LHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSV--CQ 233

Query: 286 DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
            ++         A K + RT G  GF++G   + +R+ P        +E
Sbjct: 234 TEHVSIVN----ALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  107 bits (267), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 130/299 (43%), Gaps = 30/299 (10%)

Query: 66  SGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLV 125
           +G   GIA+  VG PFDT KVRLQT+   T     L+ +      +G+  FY G   PL+
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT---LEVLRNLVKNEGVFAFYKGALTPLL 96

Query: 126 GWILMDSVMLGCLHNYRMLLKKYV-------------YYNEEKLPLSGCIISGVMAGWSV 172
           G  +  SV  G     +   + Y                    LPLS   + G+  G   
Sbjct: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156

Query: 173 SFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV 231
           SF+A+P+E  + +LQ Q  +    ++ GP D IKK+ +  G   L +GL  T+I   +  
Sbjct: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGH-- 211

Query: 232 FWWGSYELLTRWFKEH---TNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIKQVVLCN 285
              G+Y L+          T ++   I  W             W T YP DV+K ++  +
Sbjct: 212 -GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQND 270

Query: 286 DKYDGTFR-SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAK 343
           D     ++ S    AK I+   G R FFKGF P+ +RS P        FE V+R  G +
Sbjct: 271 DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE 329

>Kwal_55.21335
          Length = 317

 Score =  107 bits (266), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 125/274 (45%), Gaps = 19/274 (6%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG-IRGFYLGFTPPLV 125
           G  +G A   + +P DTIKVRLQT Q +  F     C+  T+ ++G ++GFY G   PLV
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQT-QPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLV 110

Query: 126 GWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAK 185
           G  L ++V+    +  +  L++Y    E   PLS  ++SG  AG   S++  PVEL K  
Sbjct: 111 GAALENAVLFVTFNRAQNFLQQY----ESVSPLSQTVLSGAFAGACTSYVLTPVELIKCT 166

Query: 186 LQV-QYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRW 243
           LQV   +  TT+++     +K +    G+ GL++G +ST I        W+ +YE L  +
Sbjct: 167 LQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSY 226

Query: 244 FKEHTNMSDTAINFWXXXXXXXXXXW---TTAYPSDVIKQVVLCNDKYDGTFRSWKLAAK 300
                N  DT  + W               + +P+D IK       ++ G       A K
Sbjct: 227 LARRRN--DTENHTWELLASGASAGVAFNASIFPADTIKST--AQTQHLGIVD----ATK 278

Query: 301 DIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
            I    G  G ++G   + +R+ P        +E
Sbjct: 279 RILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 69/164 (42%), Gaps = 12/164 (7%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQ---DSTRFKGPLDCVYKTFTQQGIRGFYLGFT 121
           +SG F+G   + V  P + IK  LQ S     +TR       V      +GI G + G +
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQS 203

Query: 122 PPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVEL 181
              +      +V      + +  L +    N+ +      + SG  AG + +    P + 
Sbjct: 204 STFIRECAGGAVWFTTYESLKSYLAR--RRNDTENHTWELLASGASAGVAFNASIFPADT 261

Query: 182 AKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            K+  Q       T++ G VD  K++ + +G  GLY+GL  TLI
Sbjct: 262 IKSTAQ-------TQHLGIVDATKRILARSGPAGLYRGLGITLI 298

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 71/167 (42%), Gaps = 14/167 (8%)

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPV--DVIKKVYSSNG-VRGLYK 218
           I+ G +AG +   I  P++  K +LQ Q       +  P     IK  Y   G V+G Y+
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQ-----PAHVFPTSWSCIKYTYQKEGFVKGFYQ 103

Query: 219 GLTSTLIFRT--NFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSD 276
           G+ S L+     N V +  ++     + +++ ++S  +              +    P +
Sbjct: 104 GVASPLVGAALENAVLFV-TFNRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVLT-PVE 161

Query: 277 VIKQVVLCNDKYDGTFRSWKL--AAKDIWRTRGYRGFFKGFVPSFLR 321
           +IK  +  ++    T R  K+    K I + +G  G ++G   +F+R
Sbjct: 162 LIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIR 208

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  105 bits (261), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 131/297 (44%), Gaps = 15/297 (5%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D+   P  E    I   +SG   GIA+  VG PFD  KVR+QTS  S      ++ +   
Sbjct: 13  DLSDAP--EFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPT---AIEVIKNL 67

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
              +G+  FY G   PL+G     S   G     +    +   Y ++ L L      G +
Sbjct: 68  VKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFV 127

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDA-KTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
           +G + +F+A P+E  + +LQ+Q  A    +Y G +D +KK+      + L +G T+TL+ 
Sbjct: 128 SGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ---KALMRGFTATLMR 184

Query: 227 RTN-FVFWWGSYELLTRWFKEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIKQVV 282
            ++ F  ++ +YE L    +    +    I  W             W   YP DV+K ++
Sbjct: 185 TSHGFGVYFLTYEALI-MNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIM 243

Query: 283 LCNDKYDGTF-RSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
             +        ++    AK I  TRG+  F KGFVP+ LRS P        FE  +R
Sbjct: 244 QADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMR 300

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  104 bits (259), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 124/274 (45%), Gaps = 19/274 (6%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTPPLV 125
           G  +G     + +PFDT+KVRLQT Q +  F     C+  T+  +G+ RGFY G   PL 
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQT-QPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLA 71

Query: 126 GWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--PLSGCIISGVMAGWSVSFIAAPVELAK 183
           G  L ++V+    +  + LL      + E L  PLS  + +G  AG   SF+  PVEL K
Sbjct: 72  GAALENAVLFVSFNQAKRLL------DVESLLSPLSKTVWAGAFAGACASFVLTPVELIK 125

Query: 184 AKLQVQYDAKT-TKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT-NFVFWWGSYELLT 241
            KLQV   + T T +T  +  IK V S  G  GL++G + T I  +     W+ +YE++ 
Sbjct: 126 CKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVK 185

Query: 242 RWFKEHTNMS-DTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAK 300
            +         +T                 + +P+D IK   +  D  D        A +
Sbjct: 186 NYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKS-TMQTDHID-----LSSATR 239

Query: 301 DIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
            I+  +G  GF++G   + +R+ P        +E
Sbjct: 240 KIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 66/170 (38%), Gaps = 26/170 (15%)

Query: 66  SGMFSGIAKNAVGHPFDTIKVRLQTSQDS---TRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
           +G F+G   + V  P + IK +LQ S  S   T     L  +    +++G  G + G + 
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSG 165

Query: 123 PLV-------GWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175
             +        W     V+   L + R   +   +           + SG  AG + +  
Sbjct: 166 TFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWE---------LLASGASAGLAFNAS 216

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
             P +  K+ +Q       T +       +K+Y+  G+ G Y+GL  TLI
Sbjct: 217 IFPADTIKSTMQ-------TDHIDLSSATRKIYARQGIAGFYRGLGITLI 259

>Kwal_56.23011
          Length = 303

 Score =  103 bits (258), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 123/278 (44%), Gaps = 13/278 (4%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVG 126
           G   G+A+  VG PFD  KVRLQTS   T     +  + K    +G+  FY G   PL G
Sbjct: 30  GTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQVIKSLVK---NEGLLAFYKGTLAPLAG 86

Query: 127 WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKL 186
                S   G     +   +K     ++ L L      G ++G + +F+A P+E  + +L
Sbjct: 87  VGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRL 146

Query: 187 QVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTN-FVFWWGSYELLTRWF 244
           Q+Q   +   +Y G +D  +K+        L +G T+T +  ++ F  ++ +YE L    
Sbjct: 147 QLQTASSSAAEYHGSLDCARKLLKQGA---LMRGFTATTLRTSHGFGIYFLTYETLIANQ 203

Query: 245 KEHTNMSDTAINFWXXXXXXXXXX---WTTAYPSDVIKQVVLCNDKYDGTFRSWKLA-AK 300
             H  + +  I  W             W   YP DV+K V+  +   +  +    LA AK
Sbjct: 204 AHHGVLREN-IPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAK 262

Query: 301 DIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
            I+R RG R F KGF P+ LRS P        FE  +R
Sbjct: 263 AIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMR 300

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTS--QDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
           V G FSG    A+ +PFD +K  +Q    ++    + PL      + ++G R F  GFTP
Sbjct: 220 VYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTP 279

Query: 123 PLV 125
            ++
Sbjct: 280 TML 282

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 121/273 (44%), Gaps = 16/273 (5%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTPPLV 125
           G  +G     V +PFDT+KVRLQT Q +  F     CV  T+ Q+G+ RGFY G   P+ 
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQT-QSAALFPTTWSCVSHTYKQEGLWRGFYQGMASPVF 73

Query: 126 GWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAK 185
           G  L  +V+    +  + +L+          PL   + +G +AG   S++  PVEL K K
Sbjct: 74  GAFLEHAVLFVSFNRAQAVLENCYSCG----PLEKVVFAGAIAGACTSYVLTPVELVKCK 129

Query: 186 LQVQ--YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT-NFVFWWGSYELLTR 242
           LQV         +YT  +  ++ +   NG+ GL++G + T I  +     W+ +YE+L  
Sbjct: 130 LQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKG 189

Query: 243 WF-KEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKD 301
           W  +   +  +T                 + +P+D +K  +       G       A + 
Sbjct: 190 WLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLGP------AVRT 243

Query: 302 IWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           + +  G  GF++G   + LR+ P        +E
Sbjct: 244 VLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>Scas_632.9
          Length = 292

 Score =  103 bits (257), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 136/302 (45%), Gaps = 39/302 (12%)

Query: 49  IQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTF 108
           I++     A S I   V+G  +G     + +PFDT+KVRLQT Q S  F     C+  T+
Sbjct: 9   IEKSSVQNALSDI---VNGSIAGAFGKIIEYPFDTVKVRLQT-QGSHIFPTTWSCIKYTY 64

Query: 109 TQQGI-RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
             +G+ RGF+ G   PL G  L ++ +    +    +L+K+   +    PLS  ++SG  
Sbjct: 65  HNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVS----PLSNILLSGAF 120

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTT-----KYTGPVDVIKKVYSSNGVRGLYKGLTS 222
           AG   SF+  PVEL K KLQV  + +T      K+T  +  +  V    G+ GL++G +S
Sbjct: 121 AGSCASFVLTPVELIKCKLQVS-NLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSS 179

Query: 223 TLIFRT-NFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXW---TTAYPSDVI 278
           T I  +   V W+ +YE++ +  K+     DT    W               + +P+D +
Sbjct: 180 TFIRESLGGVAWFATYEVMKQGLKDRRK--DTENKTWELLVSGASAGLAFNASIFPADTV 237

Query: 279 K------QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXX 332
           K       + L N            A K +  T G  GF++G   + +R+ P        
Sbjct: 238 KSMMQTEHITLIN------------AVKKVLTTYGITGFYRGLGITLIRAVPANATVFYM 285

Query: 333 FE 334
           +E
Sbjct: 286 YE 287

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  102 bits (255), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 122/284 (42%), Gaps = 19/284 (6%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS---TRFKGPLDCVYKTFTQQGIRGFYLGF 120
           F +G  +G+++  V +P D +K R+Q          + G +DC+ K    +G+   Y G 
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
           + P++      +    C   ++ L K+     +   PLS  +++G  AG   +F+  P E
Sbjct: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFE 132

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELL 240
           L K +LQ   DA ++ Y GPVDV++K+ +  GV  +Y GL STL        W G Y  +
Sbjct: 133 LVKIRLQ---DASSS-YKGPVDVVRKIVAREGVLAMYNGLESTL---WRHALWNGGYFGI 185

Query: 241 T----RWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR--S 294
                       N +    N               + P DV+K  +       G  R  +
Sbjct: 186 IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYN 245

Query: 295 WKLAA-KDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVL 337
           W L +   I+R  G+R  +KGFVP  LR  P        F  VL
Sbjct: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (46%), Gaps = 15/176 (8%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115
           E  S+ +  ++G  +G  +  V  PF+ +K+RLQ +  S+ +KGP+D V K   ++G+  
Sbjct: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDA--SSSYKGPVDVVRKIVAREGVLA 163

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMA---GWSV 172
            Y G    L    L +    G +   R LL     +N+ +     CI + +++   G S+
Sbjct: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLP--AAHNKTQ-----CITNDLISDSIGCSI 216

Query: 173 S-FIAAPVELAKAKLQ--VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
              ++ P ++ K+++Q          KY   +  +  +Y   G R LYKG    ++
Sbjct: 217 GCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSS 210
           + + LP      +G +AG S   +  P+++ K ++Q+Q        YTG VD +KK+ + 
Sbjct: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64

Query: 211 NGVRGLYKGLTSTLIFRT 228
            GV  LYKG++S ++   
Sbjct: 65  EGVGRLYKGISSPILMEA 82

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  101 bits (251), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 129/283 (45%), Gaps = 18/283 (6%)

Query: 66  SGMFSGIAKNAVGHPFDTIKVRLQT-SQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPL 124
           SG   G+A+  VG PFD IKVRLQT   ++T ++   D V      +G  GFY G   PL
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLV----KYEGFMGFYKGTMAPL 85

Query: 125 VGWILMDSVMLG---CLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVEL 181
           VG     S   G    +  Y   L +     +  L L      G ++G + + +A P+E 
Sbjct: 86  VGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPIEH 145

Query: 182 AKAKLQVQYDA-KTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTN-FVFWWGSYEL 239
            + +LQ+Q +A    +Y   +D  +K+        L +G T+TL+  ++ F  ++ +YE 
Sbjct: 146 VRIRLQLQKEALANAEYKSTLDCTEKLLKQGS---LMRGFTATLMRTSHGFGIYFLTYET 202

Query: 240 LTRWFKEHTNMSDTAINFWXX---XXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWK 296
           L      H       I+ W             W   YP DV+K V+  +   +  + +  
Sbjct: 203 LIASQLAH-GFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNV 261

Query: 297 L-AAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
           +  AK+I+R RG R F KGF+P+ LRS P        FE  ++
Sbjct: 262 VQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQ 304

>Kwal_26.8669
          Length = 296

 Score =  100 bits (250), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 122/270 (45%), Gaps = 17/270 (6%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS---TRFKGPLDCVYKTFTQQGIRGFYLGF 120
           F +G  +GI++  V +P D +K R+Q         ++KG +DC+ +   ++G    Y G 
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
           + P++      +    C   ++ + K+   +  EKL  S  I+SG  AG   +F+  P E
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKRE--FGVEKLTQSLSILSGASAGCCEAFVVVPFE 130

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF--VFWWGSYE 238
           L K +LQ      ++ Y GP+DV++K+ +  GV  +Y GL STL +R       ++G   
Sbjct: 131 LVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL-WRHGVWNAGYFGIIF 185

Query: 239 LLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR----S 294
            +     E  + S    N               + P DV+K  +       G  R    S
Sbjct: 186 QVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS 245

Query: 295 WKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           W  +   I++  G+R  +KGFVP  LR  P
Sbjct: 246 WP-SIFTIYKEEGFRALYKGFVPKVLRLGP 274

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 11/174 (6%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115
           E  ++ +  +SG  +G  +  V  PF+ +K+RLQ    S+ +KGP+D V K   Q+G+  
Sbjct: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDV--SSSYKGPIDVVRKIIAQEGVLA 161

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175
            Y G    L    + ++   G +   R LL +    +++       +I+G + G   S +
Sbjct: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLM 218

Query: 176 AAPVELAKAKLQ----VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
           + P ++ K+++Q    V   A+   ++ P   I  +Y   G R LYKG    ++
Sbjct: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWP--SIFTIYKEEGFRALYKGFVPKVL 270

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 99.0 bits (245), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 122/281 (43%), Gaps = 26/281 (9%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----------TSQDSTRFKGPLDCVYKTFTQ 110
           I  F+SG  +GI++  V +P D +K R Q            +   R+ G +DC+ K   +
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 111 QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGW 170
           +G    Y G + P++      +    C   Y+ + K     NE    +S  I +G  AG 
Sbjct: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IAAGASAGM 130

Query: 171 SVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF 230
           + + +  P EL K ++Q   D K++ Y GP+D +KK   + G+ GLYKG+ ST+ +R   
Sbjct: 131 TEAAVIVPFELIKIRMQ---DVKSS-YLGPMDCLKKTIKNEGIMGLYKGIESTM-WRN-- 183

Query: 231 VFWWGSYELLTRWFKEHTNMSDT----AINFWXXXXXXXXXXWTTAYPSDVIKQVVLCND 286
             W G Y  +    +    ++ T      N                 P DV+K  +   D
Sbjct: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243

Query: 287 KYDGTFR--SWKLAA-KDIWRTRGYRGFFKGFVPSFLRSFP 324
                 +  +W L +   I+R  G+R  +KGFVP   R  P
Sbjct: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTT--------KYTGPVDV 203
           N + LP     ISG +AG S   +  P+++ K + Q++    T         +Y G +D 
Sbjct: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65

Query: 204 IKKVYSSNGVRGLYKGLTSTLIFRT 228
           +KK+    G   LY+G++S ++   
Sbjct: 66  LKKIVKKEGFSRLYRGISSPMLMEA 90

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQT----SQDSTRFKGPLDCVYKTFTQQGIRGFYLG 119
            ++G   G     +  PFD +K R+Q+    S    ++   L  +   + ++G R  Y G
Sbjct: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274

Query: 120 FTPPLV----GWILMDSVMLGCLHNYRML 144
           F P +     G  LM  V  G ++ +R L
Sbjct: 275 FVPKVCRLAPGGSLMLVVFTGMMNFFRDL 303

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 96.7 bits (239), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 133/330 (40%), Gaps = 39/330 (11%)

Query: 10  CRILACRKTTFIEQRDXXXXXXXXXXXXXXXXXXXXXXDIQQPPPSEAYSRIMGFVSGMF 69
           C +LA R+      RD                       +  P  +  Y       +G  
Sbjct: 3   CGVLAERRDHVPRSRDRMAEQESVVAIEEPSV------HVGTPKSNALYENAKSLAAGAV 56

Query: 70  SGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTF----TQQGI------RGFYLG 119
            G+     GHPFD +KVR Q++Q S    G +D V K       Q G+      RGFY G
Sbjct: 57  GGVCAVLTGHPFDLLKVRCQSNQAS----GTVDAVRKILVEARAQSGLSAVNMMRGFYKG 112

Query: 120 FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE--KLPLSGCIISGVMAGWSVSFIAA 177
             PPL+G   + +V       Y  + KK V +N+   KL  +    +G ++    + + A
Sbjct: 113 VIPPLLGVTPIFAV---SFWGYD-VGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVMA 168

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR-TNFVFWWGS 236
           P E  K  LQ Q +             K + ++ GVR L++G  +TL         ++ S
Sbjct: 169 PTERVKVVLQTQSNHSLG------SAAKHILATGGVRSLFRGSLATLARDGPGSALYFAS 222

Query: 237 YELLTRWFKEHTNMSDTAI-NFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSW 295
           YE    +    +  ++ +I N            W   +P D IK  +  ++    T ++ 
Sbjct: 223 YEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSN----TRQTM 278

Query: 296 KLAAKDIWRTR-GYRGFFKGFVPSFLRSFP 324
             A + I+ TR G +GFF G  P+ LRSFP
Sbjct: 279 MEATRKIYNTRGGIKGFFPGIGPALLRSFP 308

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 97.4 bits (241), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 124/280 (44%), Gaps = 22/280 (7%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  +  F  G  +G     + +P D +K R+Q  +  +++K  +DC  K  +++GIRG Y
Sbjct: 541 FDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVY 600

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P L+G     ++ L      R  LK        KL L   IISG  AG        
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKLKD----KNGKLGLLSEIISGASAGACQVIFTN 656

Query: 178 PVELAKAKLQVQ-----YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-V 231
           P+E+ K +LQV+      +A+  K T  + +IK++    G+ GLYKG  + L+    F  
Sbjct: 657 PLEIVKIRLQVKGEYVAENAENAKLTA-LQIIKRL----GLPGLYKGAAACLLRDVPFSA 711

Query: 232 FWWGSYELLTR---WFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIKQVVLCN 285
            ++ +Y  L R    F  +     + +N W             AY   P DVIK  +  +
Sbjct: 712 IYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQID 771

Query: 286 DKYDGT-FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
            K   T ++    AA+ I R   ++ FFKG     LRS P
Sbjct: 772 PKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

>Scas_714.18
          Length = 305

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 125/294 (42%), Gaps = 35/294 (11%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTPP 123
           ++G  +G     + +PFDT+KVRLQT Q++  F     C+  T+  +GI  GFY G   P
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQT-QEAYMFPSTWSCIKYTYENEGILEGFYQGIESP 75

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAK 183
           L+G  L ++++    +     L  +  ++   + L    IS   AG   SF+  PVEL K
Sbjct: 76  LIGAALENAILFLAYNQCSSFLNAFTEFSAFLIIL----ISAGFAGSCASFVLTPVELIK 131

Query: 184 AKLQVQ------YDAKTT----------------KYTGPVDVIKKVYSSNGVRGLYKGLT 221
            KLQ+       +D                    ++T  +  IK +    G+ GL++G +
Sbjct: 132 CKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQS 191

Query: 222 STLIFRT-NFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQ 280
           ST I  +   V W+ +YEL+ +  ++  +  +T                 + +P+D +K 
Sbjct: 192 STFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPADTVKS 251

Query: 281 VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           ++           +     + I    G  GF++G   + LR+ P        +E
Sbjct: 252 IMQTEH------LALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYE 299

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 53  PPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG 112
           P SE  +     +SG  +G+A N    P DT+K  +QT   +      ++ V     + G
Sbjct: 218 PKSEVNTTWQLLISGATAGLAFNGSVFPADTVKSIMQTEHLAL-----METVRSILERDG 272

Query: 113 IRGFYLGFTPPLV 125
           + GFY G    L+
Sbjct: 273 VAGFYRGLGITLL 285

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV-RGLYKGL 220
           I++G +AG    FI  P +  K +LQ Q   +   +      IK  Y + G+  G Y+G+
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQTQ---EAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 221 TSTLI 225
            S LI
Sbjct: 73  ESPLI 77

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 123/279 (44%), Gaps = 21/279 (7%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  I  F  G  +G     V +P D +K R+Q  +D +++K  +DC+ K  +++G+RG Y
Sbjct: 522 FDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLY 581

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P L+G     ++ L    + R  L       + KL L   IISG  AG        
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATLAG----RDGKLSLPCEIISGATAGACQVVFTN 637

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGS 236
           P+E+ K +LQV+ D         V+ I  V  + G+ GLY+G  + L+    F   ++ +
Sbjct: 638 PLEIVKIRLQVKSDYVADAARNSVNAI-SVIKNLGLIGLYRGAGACLLRDIPFSAIYFPT 696

Query: 237 Y-ELLTRWFKEHTNMSD--TAINFWXXXXXXXXXXWTTAY---PSDVIKQVVLCNDK--- 287
           Y  + +  F      SD    +N W             A+   P DVIK  +  + K   
Sbjct: 697 YAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGE 756

Query: 288 --YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             Y+G    W  AA+ I +  G + FFKG     LRS P
Sbjct: 757 SVYNGI---WD-AARTILKEEGIKSFFKGGPARVLRSSP 791

>Kwal_47.17321
          Length = 881

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 126/275 (45%), Gaps = 13/275 (4%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  I  F+ G  +G       +P D +K R+Q  ++ +++K  +DC  K F+++GIRG Y
Sbjct: 498 FDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIY 557

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P LVG     ++ L  +++Y   ++K +     +L L   IISG  AG        
Sbjct: 558 SGLGPQLVGVAPEKAIKL-TVNDY---VRKLLMDENNRLTLPLEIISGAAAGACQVIFTN 613

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGS 236
           P+E+ K +LQV+ +   +     +  +  V  S G+RGLYKGL + L+    F   ++ +
Sbjct: 614 PLEIVKIRLQVRSEYADSLPKSQLTAL-GVVKSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 237 YELLTR---WFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIKQVVLCNDKYDG 290
           Y  L R    +          ++ W             AY   P DVIK  +  + +   
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE 732

Query: 291 TFRSWKL-AAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           T  +  L AA+ I +   ++ FFKG     LRS P
Sbjct: 733 TRYTGILHAARTILKEERFKSFFKGGGARVLRSSP 767

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 92.0 bits (227), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 122/270 (45%), Gaps = 17/270 (6%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIK--VRLQTSQDS-TRFKGPLDCVYKTFTQQGIRGFYLGF 120
           F++G  +G+++  V +P D +K  ++LQ S  S  ++KG  DC+ +   ++G    Y G 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
           + P++      +    C   ++ + K    +  EKL     I+SG  AG   SF+  P E
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDL--FGAEKLTQPLSILSGASAGICESFVVVPFE 130

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF--VFWWGSYE 238
           L K +LQ      ++K+T P+ V+K +    G+  +Y GL ST+ +R       ++G   
Sbjct: 131 LVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM-WRHGIWNAGYFGIIF 185

Query: 239 LLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR----S 294
            +     + +  S+   N               + P DV+K  V       G  R    S
Sbjct: 186 QVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS 245

Query: 295 WKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           W  A   I++  G++  +KGFVP  LR  P
Sbjct: 246 WP-ALATIYKEEGFKALYKGFVPKVLRLGP 274

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 7/173 (4%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIR 114
           +E  ++ +  +SG  +GI ++ V  PF+ +K+RLQ    S++F  P+  V     ++GI 
Sbjct: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVEKEGIL 160

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSF 174
             Y G    +    + ++   G +   R LL K    +E+       +++G + G   S 
Sbjct: 161 AMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQT---RNDLLAGTVGGTLSSL 217

Query: 175 IAAPVELAKAKLQ--VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
           ++ P ++ K+++Q          KY      +  +Y   G + LYKG    ++
Sbjct: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSS 210
           +++ LP     ++G +AG S   +  P+++ K  +Q+Q    +  +Y G  D +K++ + 
Sbjct: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62

Query: 211 NGVRGLYKGLTSTLIFRT 228
            G   LYKG++S ++   
Sbjct: 63  EGPSRLYKGISSPILMEA 80

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 122/288 (42%), Gaps = 19/288 (6%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  I  F  G  +G     V +P D +K R+Q  ++S ++K  +DCV K F  +GIRG Y
Sbjct: 502 FDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P L+G     ++ L         +++Y       +     I+SG  AG        
Sbjct: 562 SGLGPQLIGVAPEKAIKLTV----NDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTN 617

Query: 178 PVELAKAKLQVQYD---AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFW 233
           P+E+ K +LQ++ D          G V +I+++    G+RGLYKG  + L+    F   +
Sbjct: 618 PLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSAIY 673

Query: 234 WGSYELLTR---WFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIK-QVVLCND 286
           + +Y  L +    F  +       +  W             AY   P DVIK ++ +   
Sbjct: 674 FPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPR 733

Query: 287 KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           K + T+     AA+ I +    + FFKG     LRS P        FE
Sbjct: 734 KGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 91.3 bits (225), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 116/279 (41%), Gaps = 20/279 (7%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  +  F  G  +G     V +P D IK R+Q  +   ++K  +DC+ K  +++GI+G Y
Sbjct: 528 FDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLY 587

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P L+G     ++ L         ++  +     KL L   IISG  AG        
Sbjct: 588 SGLGPQLIGVAPEKAIKLTV----NDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTN 643

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGS 236
           P+E+ K +LQVQ D          +   ++    G+RGLY G+ + L+    F   ++ +
Sbjct: 644 PLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 237 YELLTR---WFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIKQVVLCN----- 285
           Y  L +    F  +       +  W             A+   P DVIK  +  +     
Sbjct: 704 YAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE 763

Query: 286 DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
            KY+G F     A + I +   +R FFKG     LRS P
Sbjct: 764 TKYNGIFH----AIRTILKEESFRSFFKGGGARVLRSSP 798

>Scas_640.25
          Length = 306

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 128/297 (43%), Gaps = 36/297 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-------TSQDSTRFKGPLDCVYKTFTQQGIRGF 116
           F++G  +GI++  V +P D +K R+Q           +T +KG +DC+ +   ++G    
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA 176
           Y G + P++      +V       +  L K    +  ++L     ++SG  AG + + + 
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSV--FGTKQLTQQISVLSGASAGITEALVI 134

Query: 177 APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGS 236
            P EL K +LQ       +K+ GPV+V+K +   +G++GLY G+ ST ++R     W   
Sbjct: 135 VPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST-VWRN--AVWNAG 187

Query: 237 Y--------ELL-TRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLC--N 285
           Y        ELL     K+    +D    F                P DV+K  +    N
Sbjct: 188 YFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-----PFDVVKSRIQSDGN 242

Query: 286 DKYDGTFR---SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 339
           +  +G  +   +W    K I+   G+R  +KGFVP  LR  P        F  V+  
Sbjct: 243 EIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 150 YYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYD-----AKTTKYTGPVDVI 204
           +  +  LP     ++G +AG S   +  P+++ K ++Q+Q       A  T Y G +D +
Sbjct: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL 64

Query: 205 KKVYSSNGVRGLYKGLTSTLIFRT 228
            ++    G   +YKG++S ++   
Sbjct: 65  SQIVKKEGPMHMYKGISSPMLMEA 88

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 88.6 bits (218), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 124/292 (42%), Gaps = 47/292 (16%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  I  F  G  +G     V +P D +K R+Q  +  +++K  +DC  K F+++GIRG Y
Sbjct: 516 FDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIY 575

Query: 118 LGFTPPLVGW-------ILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGW 170
            G  P L+G        + ++  M G L +    LK Y             I+SG  AG 
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFE-----------ILSGACAGA 624

Query: 171 SVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKK------VYSSNGVRGLYKGLTSTL 224
                  P+E+ K +LQV+     ++Y G  DV+K       V    G++GLYKG+ + L
Sbjct: 625 CQVVFTNPLEVVKIRLQVR-----SEYAG--DVLKSQVTALGVIKQLGIKGLYKGIAACL 677

Query: 225 IFRTNF-VFWWGSYELLTR---WFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDV 277
           +    F   ++ +Y  L +    +          +  W             AY   P DV
Sbjct: 678 MRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDV 737

Query: 278 IKQVVLCN-----DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           IK  +  +      +Y+G F     AA+ I +   ++ FFKG     LRS P
Sbjct: 738 IKTRLQIDPRKGETRYEGIFH----AARTILKEESFKSFFKGGSARVLRSSP 785

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 85.9 bits (211), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 119/279 (42%), Gaps = 28/279 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS-----TRFKGPLDCVYKTFTQQGIRGFYL 118
           FVSG  +G+++  V +P D +K R+Q    S       + G +DC+ +   ++G    Y 
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178
           G + P++      +    C  +Y+ + K    Y  +KL     I+SG +AG + + +  P
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDL--YGVDKLTQQISILSGSLAGVTEACVIVP 129

Query: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSY- 237
            EL K +LQ       +K+ GP++V+ K     G+  LY GL ST+ +R    FW G Y 
Sbjct: 130 FELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-WRN--AFWNGGYF 182

Query: 238 ----ELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIK---QVVLCNDKYDG 290
               ++     K  TN   T  +             T      V+K   Q        DG
Sbjct: 183 GVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADG 242

Query: 291 TFR-----SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           T       +W    K I+   G+   +KGF+P  LR  P
Sbjct: 243 TVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGP 280

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT---TKYTGPVDVIKKVY 208
           +E+ LP     +SG  AG S   +  P+++ K ++Q+Q  + T     Y G +D + ++ 
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61

Query: 209 SSNGVRGLYKGLTSTLIFR 227
              G   LYKG++S ++  
Sbjct: 62  KREGFSRLYKGISSPMLME 80

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 86.3 bits (212), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 115/285 (40%), Gaps = 33/285 (11%)

Query: 60  RIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQ-------QG 112
            I  FV+G   G+     GHPFD IKVR Q  Q ++      + + +  TQ         
Sbjct: 35  NIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNS 94

Query: 113 IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE----KLPLSGCIISGVMA 168
           ++GFY G  PPL+G   + +V       Y +  K   + N++    +L +     +G ++
Sbjct: 95  VKGFYKGVIPPLLGVTPIFAV---SFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFIS 151

Query: 169 GWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR- 227
               + + AP E  K  LQ      T+     +   K +    G+  L+KG  +TL    
Sbjct: 152 AIPTTLVTAPTERVKVVLQ------TSSKGSFIQAAKTIVKEGGIASLFKGSLATLARDG 205

Query: 228 TNFVFWWGSYELLTRWFKEHTNMSDTA-------INFWXXXXXXXXXXWTTAYPSDVIKQ 280
                ++ SYE+   +        D         +N            W   +P D IK 
Sbjct: 206 PGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKT 265

Query: 281 VVLCNDKYDGTFRSWKLAAKDIWRTR-GYRGFFKGFVPSFLRSFP 324
            +  +     T ++   A K+I+  R G +GFF G  P+ LRSFP
Sbjct: 266 KLQASS----TRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFP 306

>Kwal_23.2913
          Length = 320

 Score = 86.3 bits (212), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 121/291 (41%), Gaps = 31/291 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG------IRGFY 117
             +G   G+     GHPFD +KVR Q++Q S         +++  ++ G      I+GFY
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQIKGFY 91

Query: 118 LGFTPPLVGWILMDSVML-GCLHNYRML------LKKYVYYNEEKLPL--SGCIISGVMA 168
            G  PPL+G   + +V   G     R++      +      + +  PL  S   ++G  +
Sbjct: 92  RGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGFFS 151

Query: 169 GWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR- 227
               + I AP E  K  LQ      T++    +   + +    GVR L++G  +TL    
Sbjct: 152 AIPTTLITAPTERVKVVLQ------TSESGSFLGAARTLIREGGVRSLFQGTLATLARDG 205

Query: 228 TNFVFWWGSYELLTRWFKEHTNMSD-TAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCND 286
                ++ SYE+  R+   + +    + ++            W   +P D IK       
Sbjct: 206 PGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIK------T 259

Query: 287 KYDGTFRSWKL--AAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
           K   + RS  +  AA++I+   G RGFF G  P+ +RSFP         EF
Sbjct: 260 KLQSSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEF 310

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIR 114
           ++A S +   V+G  +G++      P DTIK +LQ+S   +R +  +    + +T+ G+R
Sbjct: 228 TDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSS---SRSQSMVQAAREIYTRAGLR 284

Query: 115 GFYLGFTPPLV 125
           GF+ G  P L+
Sbjct: 285 GFFPGLGPALM 295

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 111/290 (38%), Gaps = 26/290 (8%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTR------FKGPLDCVYKTFTQQGIRGFYL 118
           +SG  +G+    V  P D  K RLQ     TR      ++G +  +      +G+RG Y 
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 119 GFTPPLVG----WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSF 174
           G  P ++G    W++  SV   C  N R         N           S + AG   + 
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRT--------NSSNWSFVSHSFSAITAGAVSTV 184

Query: 175 IAAPVELAKAKLQVQYD--AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVF 232
           +  P+ + K +L +Q    + TT Y G  D  KK+ +  GV+ LY GL  +L+   +   
Sbjct: 185 VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLHVAI 244

Query: 233 WWGSYELLTRWFK-----EHTNMSDTAIN-FWXXXXXXXXXXWTTAYPSDVIKQVVLCND 286
            +  YE L   FK     E +N S   +                 +YP ++++  +    
Sbjct: 245 HFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKS 304

Query: 287 KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
                 R      K  +   G  GF+ GF  +  R+ P        FE+V
Sbjct: 305 DLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 70  SGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYK-TFTQQGIRGFYLGFTPPLVGWI 128
           S +  + + +P + ++ RLQ   D    +  L  + K T+ Q+GI GFY GF   L   +
Sbjct: 282 SKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTL 341

Query: 129 LMDSVMLGCLHNYRMLLKK 147
              ++ L      R  L K
Sbjct: 342 PASAITLVSFEYVRNFLNK 360

>Scas_697.47
          Length = 328

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 117/289 (40%), Gaps = 25/289 (8%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYK----- 106
           PP +     +   V+G   G+     GHPFD IKVR Q+ Q S+     +  + K     
Sbjct: 28  PPANAIRDNLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHA-IKIILKDARAI 86

Query: 107 ---TFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCII 163
                    ++GFY G  PPL+G   + +V        + ++ +    +  +L +     
Sbjct: 87  PTSNMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS-DSSSAQLTMGQMAA 145

Query: 164 SGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTST 223
           +G ++    + + AP E  K  LQ       T + G     K +    GV+ L+KG  +T
Sbjct: 146 AGFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIGAA---KNIVKDGGVKSLFKGSLAT 202

Query: 224 LIFR-TNFVFWWGSYELLTRWFKEHTNMSDTAI------NFWXXXXXXXXXXWTTAYPSD 276
           L         ++ SYE+  ++  +    +++        N            W   +P D
Sbjct: 203 LARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPID 262

Query: 277 VIKQVVLCNDKYDGTFRSWKLAAKDIWRTR-GYRGFFKGFVPSFLRSFP 324
            IK  +  +       +S   A ++I+  R G +GFF G  P+ LRSFP
Sbjct: 263 TIKTKLQSSSGS----QSMVAATREIYVKRGGIKGFFPGLGPALLRSFP 307

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 115/292 (39%), Gaps = 35/292 (11%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTF------ 108
           S+    +    +G   G+     GHPFD +KVR Q++Q     +  +D V          
Sbjct: 23  SQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQA----RSAMDAVSHILQAARQA 78

Query: 109 ----TQQGIRGFYLGFTPPLVGWILMDSVML-------GCLHNYRMLLKKYVYYNEEKLP 157
               +   +RGFY G  PPL+G   + +V           + +            E +L 
Sbjct: 79  AGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELT 138

Query: 158 LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLY 217
           LS    +G ++    + + AP E  K  LQ      T      +D  K++  + G + L+
Sbjct: 139 LSQMAAAGFISAIPTTLVTAPTERVKVVLQT-----TQGKASFLDAAKQIVRTQGFQSLF 193

Query: 218 KGLTSTLIFR-TNFVFWWGSYELLTRWFKE---HTNMSDTAINFWXXXXXXXXXXWTTAY 273
           KG  +TL         ++ SYE+   +  +   HT+   +  N            W   +
Sbjct: 194 KGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVF 253

Query: 274 PSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRG-YRGFFKGFVPSFLRSFP 324
           P D +K  +  + K        ++    I+ TRG  +GFF G  P+ LRSFP
Sbjct: 254 PIDTVKTQLQSSSKRQSMLEVTRM----IYNTRGGIKGFFPGVGPAILRSFP 301

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 116/302 (38%), Gaps = 49/302 (16%)

Query: 80  PFDTIKVRLQT----------------------SQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           PFD +K RLQ+                      +Q    FK     +   +  +G R  +
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P LVG I   S+        + +  K +   +E + +   +++   AGW+ S    
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIH--LMAAATAGWATSTATN 189

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSY 237
           P+ L K +LQ+     T KY    D +K V    G+ GLYKGL+++ +     +  W  Y
Sbjct: 190 PIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQWVLY 249

Query: 238 ELLTRWFKEHT-----NMSDTA------INFWXXXXXXXXXXWTTA----YPSDVI---- 278
           E +    K+ +     N+S+        I  W             A    YP +V+    
Sbjct: 250 EQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRL 309

Query: 279 KQVVLCND--KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
           +Q  L N   KY G  +S ++  K+     G    + G  P  LR+ P        +E V
Sbjct: 310 RQAPLENGKLKYTGLVQSIRVIIKE----EGLASMYGGLTPHLLRTVPNSIIMFGTWELV 365

Query: 337 LR 338
           +R
Sbjct: 366 IR 367

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 119/293 (40%), Gaps = 34/293 (11%)

Query: 55  SEAYSRIM-GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKG---------PLDCV 104
           ++A+   M   V+G   G+     GHPFD IKVR Q++Q  +              L  V
Sbjct: 15  TDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTV 74

Query: 105 YKTFT-----QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLS 159
             + T     +  ++GFY G  PPL+G   + +V       Y +  +   +      PL+
Sbjct: 75  NGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAV---SFWGYDIGKRLVTWKQASDAPLT 131

Query: 160 GCII--SGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLY 217
              +  +G ++    + + AP E  K  LQ   + K +     +   K + S+ GV+ L+
Sbjct: 132 TAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSF----IKAAKHIVSTGGVKSLF 187

Query: 218 KGLTSTLIFR-TNFVFWWGSYELLTRWFKEHTNMSD----TAINFWXXXXXXXXXXWTTA 272
            G  +TL         ++ SYEL   +  +     D       N            W   
Sbjct: 188 NGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVV 247

Query: 273 YPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTR-GYRGFFKGFVPSFLRSFP 324
           +P D IK  +    +   T  S   A KDI+  R G +GFF G  P+ LRSFP
Sbjct: 248 FPIDTIKTRL----QVATTPISMVQATKDIYIQRGGIKGFFPGLGPALLRSFP 296

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 112/287 (39%), Gaps = 20/287 (6%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQT------SQDSTRFKGPLDCVYKTFTQQGIRGFYL 118
           +SG  SG     +  PFD  K RLQ       +  S  +KG        F  +G  G Y 
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178
           G  P ++G+I    +            +KY        P      S + AG   +    P
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYD----FCRKYSVDIFPHSPFLSNASSAITAGAISTVATNP 158

Query: 179 VELAKAKLQVQYDAK--TTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGS 236
           + + K +L +Q      +T Y G +D  +K+    G + LY GL   L+   N    +  
Sbjct: 159 IWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPL 218

Query: 237 YELLTRWF--KEHTNMSD--TAINFWXXXXXXXXXXW---TTAYPSDVIK-QVVLCNDKY 288
           YE L   F   E T++S   T+ NF               T  YP ++++ ++ L +D  
Sbjct: 219 YENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLP 278

Query: 289 DGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
           +   R      K  +R  G+ GF+ GF  + +R+ P        FE+
Sbjct: 279 NTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 80.9 bits (198), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 119/303 (39%), Gaps = 51/303 (16%)

Query: 80  PFDTIKVRLQT-----------------------SQDSTRFKGPLDCVYKTFTQQGIRGF 116
           PFD +K RLQ+                       S+    FK     +   + Q+G R  
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA 176
           + G  P LVG I   S+        + +  + +   +E   +   +++   AGW+ S + 
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIH--LLAAATAGWATSTVT 187

Query: 177 APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGS 236
            P+ L K +LQ+   A T  Y   +D IK V  + GV GLYKGL+++ +     +  W  
Sbjct: 188 NPIWLVKTRLQLD-KAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQWIL 246

Query: 237 YELLTRWFKE---------HTNMSDTA--INFWXXXXXXXXXXWTTA----YPSDVI--- 278
           YE + R  KE         H +   T+  +  W             A    YP +V+   
Sbjct: 247 YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTR 306

Query: 279 -KQVVLCND--KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
            +Q    N   KY G  +S+++  K+     G    + G  P  LR+ P        +E 
Sbjct: 307 LRQAPTENGKLKYTGLVQSFRVIIKE----EGLVSMYSGLTPHLLRTVPNSIIMFGTWEL 362

Query: 336 VLR 338
           V++
Sbjct: 363 VIK 365

>Scas_721.27
          Length = 374

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 117/306 (38%), Gaps = 53/306 (17%)

Query: 80  PFDTIKVRLQTS--------------------------QDSTRFKGPLDCVYKTFTQQGI 113
           PFD +K RLQ+                           Q  T FK     +   + ++G 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173
           R  + G  P LVG I   S+        + +  K  + N ++ PL   ++S   AGW+ S
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK-AFNNGQETPLI-HLMSAATAGWATS 189

Query: 174 FIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFW 233
               P+ + K ++Q+     T KY    D +K V  S G+ GLY+GL+++ +     +  
Sbjct: 190 TATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEGILQ 249

Query: 234 WGSYELLTRWFKEH-----------TNMSDTAINFWXXXXXXXXXXWTTA----YPSDVI 278
           W  YE +    K+            T      I  W             A    YP +V+
Sbjct: 250 WLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVV 309

Query: 279 ----KQVVLCND--KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXX 332
               +Q+ + N   KY G  +S+++  K+     G    + G  P  +R+ P        
Sbjct: 310 RTRLRQMPMENGKPKYTGLVQSFRVIIKE----EGLASMYSGLTPHLMRTVPNSIIMFGT 365

Query: 333 FEFVLR 338
           +E V+R
Sbjct: 366 WELVIR 371

>Scas_602.8
          Length = 885

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 123/288 (42%), Gaps = 38/288 (13%)

Query: 58  YSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  I  F  G  +G     + +P D IK R+Q  +  T++K  +DC+ K F ++GIRG Y
Sbjct: 496 FDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLY 555

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G  P L+G     ++ L         ++K +   +  L L   ++SG  AG        
Sbjct: 556 SGLGPQLIGVAPEKAIKLTV----NDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTN 611

Query: 178 PVELAKAKLQVQYDAKTTKYTGPV---------DVIKKVYSSNGVRGLYKGLTSTLIFRT 228
           P+E+ K +LQV+     ++YT  +          +IK++     + GLYKG+ + L+   
Sbjct: 612 PLEIVKIRLQVK-----SEYTNAMIPKSQLTAFQIIKEL----KLIGLYKGVGACLLRDV 662

Query: 229 NF-VFWWGSYELLTR-WFKEHTNMSD--TAINFWXXXXXXXXXXWTTAY---PSDVIKQV 281
            F   ++ +Y  L +  F+   N  D    +  W             A+   P DVIK  
Sbjct: 663 PFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTR 722

Query: 282 V-----LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           +     +   +Y G       A + I +   +R FFKG     +RS P
Sbjct: 723 LQIEPGVGETRYTGILH----AVRTILKEESFRSFFKGGAARVMRSSP 766

>Kwal_27.12081
          Length = 369

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 113/299 (37%), Gaps = 46/299 (15%)

Query: 80  PFDTIKVRLQT-------------------SQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           PFD +K RLQ+                   S     F+     +   +  +G R  + G 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
            P LVG I   S+        + +  +  + N E+ P    +IS   AGW+ S    P+ 
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSR-AFNNGEEAPWI-HLISAATAGWATSTATNPIW 189

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELL 240
           L K +LQ+     T +Y    D +K +    G  GLYKGL+++ +     +  W  YE +
Sbjct: 190 LIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWLLYEQM 249

Query: 241 TRWFK-----------EHTNMSDTAINFWXXXXXXXXXXWTTA----YPSDVI----KQV 281
            +  K           E    +   I  W             A    YP +V+    +Q 
Sbjct: 250 KQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQA 309

Query: 282 VLCND--KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
            L ND  KY G  +S+++  K+     G    + G  P  LR+ P        +E V++
Sbjct: 310 PLENDKLKYTGLIQSFRVIIKE----EGLASMYGGLTPHLLRTVPNSIIMFGTWELVIK 364

>Scas_709.9
          Length = 365

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 125/300 (41%), Gaps = 28/300 (9%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQT----SQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           +SG  +G     +  P D  K RLQ     S ++  ++G L  +      +G+RG Y G 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 121 TPPLVG----WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA 176
            P ++G    W++  SV     + +   L   V  N + +  S C  S + AG + + + 
Sbjct: 129 IPIILGYFPTWMIYFSV-----YEFAKDLYPRVLPNSDFISHS-C--SAITAGAASTVLT 180

Query: 177 APVELAKAKLQVQ--YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWW 234
            P+ + K +L +Q       T Y G +D  KK+ +  GVR LY GL  ++    +    +
Sbjct: 181 NPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLHVAIHF 240

Query: 235 GSYELLTRWFKEHT-----NMSDTAINFWXXXXXXXXXXWTTA---YPSDVIK-QVVLCN 285
             YE L       T     N  + +++               +   YP ++++ ++ L +
Sbjct: 241 PVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKS 300

Query: 286 DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAKVN 345
           DK   +        K  +R  G  GF+ GF  + LR+ P        FE+  R +  K+N
Sbjct: 301 DKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY-FRNALLKIN 359

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 119/300 (39%), Gaps = 47/300 (15%)

Query: 80  PFDTIKVRLQT--------SQDSTR----------FKGPLDCVYKTFTQQGIRGFYLGFT 121
           PFD +K RLQ+        +Q + R          F+  +  +   +TQ+G R  + G  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 122 PPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVEL 181
           P LVG I   S+        +    + +   +E   +    ++G  AGW+ S    P+ L
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIH--FLAGATAGWATSTATNPIWL 186

Query: 182 AKAKLQVQ--YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYEL 239
            K +LQ+    D ++ +Y    D +K V  + G+ GLYKGL+++ +     +  W  YE 
Sbjct: 187 VKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVLYEQ 246

Query: 240 LTRWFKEHTNMSDTAINFWXXXXXXXXXXWTT---------------AYPSDVI----KQ 280
           +    ++ +      I+            W                  YP +V+    +Q
Sbjct: 247 MKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQ 306

Query: 281 VVLCND--KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
               N   KY G F+S+ L  K+     G+   + G  P  +R+ P        +E V++
Sbjct: 307 APKENGKLKYTGLFQSFSLIIKE----EGFASMYSGLTPHLMRTVPNSIIMFGTWELVIK 362

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 27/201 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD----STRFKGPLDCVYKTFTQQGIRGFYLG 119
           F++G  +G A +   +P   +K RLQ  +     S R+K   DC+      +GI G Y G
Sbjct: 167 FLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKG 226

Query: 120 FTPPLVG-------WILMDSVMLGCLHNYRML-LKKYVYYNEEKLPL-----SGCIISGV 166
            +   +G       W+L + +     H  R   ++++   +EE           C  SG 
Sbjct: 227 LSASYLGSVESILQWVLYEQMK----HIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGS 282

Query: 167 MAGWSV--SFIAAPVELAKAKL-QVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTST 223
                +  S +  P E+ + +L Q   +    KYTG       +    G   +Y GLT  
Sbjct: 283 AGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPH 342

Query: 224 LIFRT--NFVFWWGSYELLTR 242
           L+ RT  N +  +G++EL+ +
Sbjct: 343 LM-RTVPNSIIMFGTWELVIK 362

>Scas_589.10
          Length = 316

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 120/285 (42%), Gaps = 30/285 (10%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF--------KGP-----LDCVYKT 107
           I  F+SG  +G+++  + +P D +K R Q   +            K P     L C+ K 
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKI 73

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
             ++G +  Y G +PPL+  +   +V       ++ ++ K     E    ++  +++G  
Sbjct: 74  LKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVT--LLAGTF 131

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR 227
           AG + S I  P EL K +LQ   DA+ + Y  P+   + +  + G+ G+Y G  ST I+R
Sbjct: 132 AGITESLIVVPFELVKIRLQ---DAQ-SDYRSPIRCTRTIIENQGLFGIYAGFEST-IWR 186

Query: 228 TNFVFWWGSYELLTRWFKEHTNMSDTAINF------WXXXXXXXXXXWTTAYPSDVIKQV 281
                W  SY  L    K+    + +   F      +             + P DV+K  
Sbjct: 187 NT--IWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTR 244

Query: 282 VLCNDK-YDGTFRSWK-LAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           +  + K   G    W   +   I+RT G +G +KG +P   R  P
Sbjct: 245 MQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 155 KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTT-----------KYTGPVDV 203
           KLP     ISG +AG S + +  P+++ K + Q+Q + K             +++  +  
Sbjct: 10  KLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSC 69

Query: 204 IKKVYSSNGVRGLYKGLTSTLIFRT 228
           + K+    G + LYKG++  L+   
Sbjct: 70  LSKILKEEGFKNLYKGMSPPLLMEV 94

>Kwal_55.20868
          Length = 380

 Score = 77.8 bits (190), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 111/299 (37%), Gaps = 40/299 (13%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQT----SQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           +SG  +G        P D  K RLQ     S  S  +KG L  +      +G RG Y G 
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 121 TPPLVG----WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA 176
            P ++G    W++  SV       Y  +   + + +           S + AG   + + 
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSA--------SALTAGTVSTILT 191

Query: 177 APVELAKAKL--QVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWW 234
            PV + K +L  Q   +  +T YT   D   K+Y++ G+R  Y GL  +L+   +    +
Sbjct: 192 NPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFHVAIHF 251

Query: 235 GSYELLTRWFKEHTNMS---DTAINFWXXXXXXXXXXW---TTAYPSDVIKQ-------- 280
             YE L  W     +MS   D  +N                T  YP ++++         
Sbjct: 252 PIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYP 311

Query: 281 ----VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
                 L      G  R      K  +++ G RGF+ GF  +  R+ P        FE+
Sbjct: 312 TDPLAALQKTSRHGLIR----LIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEY 366

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 40/93 (43%), Gaps = 9/93 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ---------TSQDSTRFKGPLDCVYKTFTQQGIR 114
            ++   S +  + + +P + ++ R+Q          +   T   G +  +  T+  +G+R
Sbjct: 281 IIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLR 340

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKK 147
           GFY GFT  L   +   ++ L     +R  L K
Sbjct: 341 GFYSGFTANLARTLPASAITLVSFEYFRKYLTK 373

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 117/287 (40%), Gaps = 24/287 (8%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP-----LDCVYKTFTQQGIRGFYLG 119
           +SG F+G        P D  K RLQ     TRF+ P     +  +      +G RG Y G
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 120 FTPPLVG----WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175
             P ++G    W++  SV            KK+ +    +        + + AG + + +
Sbjct: 142 LVPIVLGYFPTWMIYFSVY--------EFSKKFFHGIFPQFDFVAQSCAAITAGAASTTL 193

Query: 176 AAPVELAKAKLQVQYD--AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFW 233
             P+ + K +L +Q +     T Y G  D  +K++   G + LY GL  +L+   +    
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIH 253

Query: 234 WGSYELLTRWFKEHTNMSDT-AINFWXXXXXXXXXXWTTA---YPSDVIK-QVVLCNDKY 288
           +  YE L   F  ++  ++T +IN               +   YP ++++ ++ L +D  
Sbjct: 254 FPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIP 313

Query: 289 DGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
           D   R      K  +   G +GF+ GF  + +R+ P        FE+
Sbjct: 314 DSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY 360

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 9/87 (10%)

Query: 68  MFSGIAK---NAVGHPFDTIKVRLQTSQDS----TRFKGPLDCVYKTFTQQGIRGFYLGF 120
           M S ++K   +AV +P + ++ R+Q   D      R   PL  +  T+ Q+G++GFY GF
Sbjct: 283 MASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPL--IKATYAQEGLKGFYSGF 340

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKK 147
           T  LV  I   ++ L     +R  L+ 
Sbjct: 341 TTNLVRTIPASAITLVSFEYFRNRLEN 367

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 119/285 (41%), Gaps = 32/285 (11%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTR--------------FKGPLDCVYK 106
           I  F +G  +G+++  V +P D +K R+Q  Q +T+              + G +DC+ K
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQL-QVTTKGHPAVVAAKAAVDHYTGVMDCLTK 70

Query: 107 TFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGV 166
              ++G    Y G T P++      ++       ++   KK       ++     I SG 
Sbjct: 71  IVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGA 130

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
            AG   +F+ AP EL K +LQ       +++  P++V+K      GV  L+ GL +T I+
Sbjct: 131 SAGAVEAFVVAPFELVKIRLQ----DVNSQFKTPIEVVKNSVVKGGVLSLFNGLEAT-IW 185

Query: 227 RTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTA----YPSDVIKQVV 282
           R   V W   Y  +    ++    + T+               T       P DV+K  +
Sbjct: 186 R--HVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 283 LCNDKYDGTFR--SWKL-AAKDIWRTRGYRGFFKGFVPSFLRSFP 324
               +  G  R  +W L +   ++R  G++  +KGF P  +R  P
Sbjct: 244 ---QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAP 285

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 78/174 (44%), Gaps = 6/174 (3%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQ 111
           P P+   ++ +   SG  +G  +  V  PF+ +K+RLQ    +++FK P++ V  +  + 
Sbjct: 114 PTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDV--NSQFKTPIEVVKNSVVKG 171

Query: 112 GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWS 171
           G+   + G    +   +L ++   G +   R LL       E+       +I+G + G  
Sbjct: 172 GVLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKT---RNDLIAGAIGGTV 228

Query: 172 VSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
              +  P ++ K+++Q +      KY   +  +  VY   G + LYKG    ++
Sbjct: 229 GCLLNTPFDVVKSRIQ-RSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVM 281

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAK-----------TTKYTGP 200
           +   LP      +G +AG S   +  P+++ K ++Q+Q   K              YTG 
Sbjct: 5   DNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGV 64

Query: 201 VDVIKKVYSSNGVRGLYKGLTSTLIFRT 228
           +D + K+    G   LYKG+TS ++   
Sbjct: 65  MDCLTKIVKKEGFSHLYKGITSPILMEA 92

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 122/309 (39%), Gaps = 26/309 (8%)

Query: 50  QQPPPSEAYSR------IMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDSTRFKGP 100
           QQP P    S        +  V+G  +G+ +    HP DTIKVR+Q    + + T+  G 
Sbjct: 41  QQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGF 100

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG 160
           L      ++ +G+  FY G    ++G I   ++       YR LL          +    
Sbjct: 101 LRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD---RQTGVVSTGN 157

Query: 161 CIISGVMAGWSVS-FIAAPVELAKAKLQVQY---DAKTTKYTGPVDVIKKVYSSNGVRGL 216
             ++GV AG + +  +  P+E+ K +LQ Q+    A+  KY   +     +    G+  L
Sbjct: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217

Query: 217 YKGLTSTLIFR-TNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY-- 273
           Y+G++ T   + TN    +  Y  L    +E+    +  +  W              +  
Sbjct: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN--LPSWETSLIGLVSGAIGPFSN 275

Query: 274 -PSDVIKQVVLCNDKYDGTFRSW---KLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXX 329
            P D IK   L  DK      +W       + + +  G+R  +KG  P  +R  P     
Sbjct: 276 APLDTIK-TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334

Query: 330 XXXFEFVLR 338
              +EFV R
Sbjct: 335 FTVYEFVRR 343

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 108/289 (37%), Gaps = 29/289 (10%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTR---FKGPLDCVYKTFTQQGIRGFYLGFT 121
           VSG  +G     +  P D  K RLQ     +    ++G +  +      +G+ G Y G  
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 122 PPLVG----WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
           P ++G    W+L  SV   C   Y   L      +           S + AG   + +  
Sbjct: 149 PIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAA---------SALTAGAISTALTN 199

Query: 178 PVELAKAKLQVQYDAK--TTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWG 235
           P+ + K +L +Q D    +T Y   +D  +K+Y S G++  Y GL  +L    +    + 
Sbjct: 200 PIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFHVAIHFP 259

Query: 236 SYELLTRWFKEHTNMSD---------TAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCND 286
            YE L  W   +T  +D                             YP ++++  +    
Sbjct: 260 VYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM--QV 317

Query: 287 KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
           ++ G   S       I  + GY GF+ GF  + +R+ P        FE+
Sbjct: 318 RHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEY 366

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 116/296 (39%), Gaps = 26/296 (8%)

Query: 57  AYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDSTRFKGPLDCVYKTFTQQG 112
           A + I G  +G+F  +      HP DTIKVR+Q    ++ +  +  G +      +T++G
Sbjct: 11  AVNLIAGGTAGLFEALC----CHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEG 66

Query: 113 IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSV 172
           +   Y G    ++G I   ++       YR  L          +      ++GV AG + 
Sbjct: 67  LLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALAD---KQTGSVSTGNTFLAGVGAGTTE 123

Query: 173 S-FIAAPVELAKAKLQVQY----DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR 227
           +  +  P+E+ K +LQ Q+     A + +Y   +     +    G+  LY+G++ T   +
Sbjct: 124 AVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQ 183

Query: 228 -TNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIKQVVL 283
            TN    +  Y  L  + +EH      A+  W              +   P D IK   L
Sbjct: 184 ATNQGANFTVYSKLKEFLQEHHKTD--ALPSWETSCIGLISGAIGPFSNAPLDTIK-TRL 240

Query: 284 CNDKYDGTFRSWK---LAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
             DK       W       K + +  G+R  +KG  P  +R  P        +EFV
Sbjct: 241 QKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 296

>Scas_691.4
          Length = 334

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 125/316 (39%), Gaps = 36/316 (11%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ--DSTRFKGPLDCVYKT 107
           Q+ P  +  S ++  V+G  +G+ +    HP DTIKVR+Q ++  +  R  G +      
Sbjct: 3   QKNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNI 62

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG-CIISGV 166
           ++ +G    Y G    ++G I   ++       YR  L       E +   +G   ++GV
Sbjct: 63  YSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTD----KETRTITTGNTFLAGV 118

Query: 167 MAGWSVS-FIAAPVELAKAKLQVQY---------------DAKTT---KYTGPVDVIKKV 207
            AG + +  +  P+E+ K +LQ Q+                A T    KY   +     +
Sbjct: 119 GAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTI 178

Query: 208 YSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXX 266
               G   LY+G++ T   + TN    +  Y  L  + +++ N    ++  W        
Sbjct: 179 VKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRE--SLPSWETSCIGLI 236

Query: 267 XXWTTAY---PSDVIKQVVLCNDKYDGTFRSWK---LAAKDIWRTRGYRGFFKGFVPSFL 320
                 +   P D IK   L  DK   +  +WK   +    + +  G+R  +KG  P  +
Sbjct: 237 SGAIGPFSNAPLDTIK-TRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVM 295

Query: 321 RSFPXXXXXXXXFEFV 336
           R  P        +EFV
Sbjct: 296 RVAPGQAVTFTVYEFV 311

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 66.2 bits (160), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 116/305 (38%), Gaps = 48/305 (15%)

Query: 80  PFDTIKVRLQTS---------------------------QDSTRFKGPLDCVYKTFTQQG 112
           PFD +K RLQ+                            Q  T FK  L  +   + Q+G
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 113 IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSV 172
            R  + G  P LVG I   S+        + +  K  + N ++ P+   +++   AGW+ 
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAK-AFNNGQETPMI-HLMAAATAGWAT 189

Query: 173 SFIAAPVELAKAKLQVQYDAKTT--KYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF 230
           +    P+ L K ++Q+    KT+  +Y    D +K V  + G  GLYKGL+++ +     
Sbjct: 190 ATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEG 249

Query: 231 VFWWGSYELLTRWFKEH-----------TNMSDTAINFWXXXXXXXXXXWTTA----YPS 275
           +  W  YE + R  KE            T  +   +  W             A    YP 
Sbjct: 250 ILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPH 309

Query: 276 DVIKQVVLCNDKYDGTFRSWKLAA--KDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXF 333
           +V++  +    K +G  +   L    K I +  G    + G  P  +R+ P        +
Sbjct: 310 EVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTW 369

Query: 334 EFVLR 338
           E V+R
Sbjct: 370 EIVIR 374

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 65.5 bits (158), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 118/289 (40%), Gaps = 41/289 (14%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTF-----TQQGIRGFYL 118
            +SG+ +G     V HP D IK+RLQ +    +     + V +       TQQ ++  Y 
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYR 75

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY------------YNEEKLPLSGCIISGV 166
           G    ++G    ++V  G         K  VY             N+ K+  S  ++S  
Sbjct: 76  GLGINIIG----NAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAG 131

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
            +G + + +  P+ + K ++     ++   YT  ++ I ++Y+  G++  ++GL  +L  
Sbjct: 132 ASGLATALLTNPMWVIKTRIMSTKSSQ--GYTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 227 RTNFVFWWGSYELLT-RWFKEHTNMSD---TAINFWXXXXXXXXXXWTTAYPSDVIKQVV 282
            T    ++  Y+ L  ++  +  ++ +    A+              ++ YP  ++K  +
Sbjct: 190 VTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNL 249

Query: 283 LC-------NDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
                    N K +   RS       IW T G  GF+KG   + +R+ P
Sbjct: 250 QTFRTEHNENSKMNSLIRS-------IWHTNGIAGFYKGLFANLVRAIP 291

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 72/181 (39%), Gaps = 22/181 (12%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQV-QYDAKTTKYTGPVDVIKKVYSSNG--V 213
           PL   IISG+ AG   + +  P++L K +LQ+   D K + Y   V  I K  S     +
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLL 70

Query: 214 RGLYKGLTSTLIFRTNFVFWWGSYELLTRWFK------------EHTNMSDTAINFWXXX 261
           +  Y+GL   +I        WG Y  L R  K            ++  M+D  +      
Sbjct: 71  KEAYRGLGINIIGN---AVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYL 127

Query: 262 XXXXXXXWTTAYPSD---VIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPS 318
                    TA  ++   VIK  ++      G + S   A   I+   G + F++G VPS
Sbjct: 128 VSAGASGLATALLTNPMWVIKTRIMSTKSSQG-YTSILNAITRIYTEEGLKTFWRGLVPS 186

Query: 319 F 319
            
Sbjct: 187 L 187

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 88/193 (45%), Gaps = 13/193 (6%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKGPLD 102
           D  Q   ++  S+   F +G  +      V +P + +K+R+Q      + +   +  P  
Sbjct: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65

Query: 103 CVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC- 161
            +   F  +GIRG   G     +  I ++   LG     R ++ K  Y ++E   +    
Sbjct: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG 125

Query: 162 --IISGVMAGWSVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVRG 215
             + +G  +G   + + +P+ L K +LQ   +A    + T YTG  + +K +Y + GV+G
Sbjct: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185

Query: 216 LYKGLTSTLIFRT 228
           L++G+ +  I RT
Sbjct: 186 LFRGIDAA-ILRT 197

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 82/190 (43%), Gaps = 21/190 (11%)

Query: 66  SGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDCVYKTFTQQGIRGFYLG 119
           +G  SGI    +G P   +K RLQ+  ++      T + G  + +   +  +G++G + G
Sbjct: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189

Query: 120 FTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178
               ++      SV L   +  +  LL+  +  +   L L+   ISG+     V+ +  P
Sbjct: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL----GVAVVMNP 245

Query: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYE 238
            ++   ++   Y+ K   Y GP+D + K     G+  LYKG  +        VF  G + 
Sbjct: 246 WDVILTRI---YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ-------VFRIGPHT 295

Query: 239 LLTRWFKEHT 248
           +L   F E T
Sbjct: 296 ILCLTFLEQT 305

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           DI +  PS      +   +   SG+    V +P+D I  R+  +Q    +KGP+DC+ KT
Sbjct: 219 DIMEDGPS------LHLTASTISGLGVAVVMNPWDVILTRIY-NQKGDLYKGPIDCLVKT 271

Query: 108 FTQQGIRGFYLGF 120
              +GI   Y GF
Sbjct: 272 VKIEGITALYKGF 284

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 114/306 (37%), Gaps = 23/306 (7%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-----STRFKGPLDCV 104
            Q   +   S+   FV+G  +      V +PFD +K R+Q   +     +  +  P+   
Sbjct: 10  NQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAF 69

Query: 105 YKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC--- 161
              F  +GI G   G     +  I ++   LG     R +L    Y N E   +      
Sbjct: 70  GVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGIN 129

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVRGLY 217
           + +G  +G   +FI +P+ L K ++Q   +A    + T YT   + +  ++ S G++GL+
Sbjct: 130 VAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLF 189

Query: 218 KGLTSTLIFRTNF--VFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPS 275
           +G+ + ++ RT          Y +   +  +H  M+D                     P 
Sbjct: 190 RGVDAAML-RTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPW 248

Query: 276 DVIKQVVLCNDK---YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXX 332
           DV+   V  N K   Y G    +        R  G    +KGF    LR  P        
Sbjct: 249 DVVLTRVY-NQKGNLYSGPIDCF----IKTVRNEGLSALYKGFGAQILRIGPHTVLCLTF 303

Query: 333 FEFVLR 338
            E  L+
Sbjct: 304 MEQTLK 309

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 81/180 (45%), Gaps = 18/180 (10%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVYKTFTQQGIRG 115
           SR+  +++G   G+A     +P DT+K R+Q +  +T  K     L    + + Q GIR 
Sbjct: 318 SRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRL 377

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK---LPLSGCIIS-------G 165
           FY G    ++G     ++ LG        LKK+    E K   LP    IIS       G
Sbjct: 378 FYRGVHIGVMGIFPYAALDLGTFS----ALKKWYIKKEAKKTGLPEDEVIISNLIVLPMG 433

Query: 166 VMAGWSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
             +G   + +  P+ L + +LQ Q   A    Y G  DV+KK     G +GL+KGL   L
Sbjct: 434 AFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNL 493

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/310 (19%), Positives = 117/310 (37%), Gaps = 35/310 (11%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDSTRFKGPLDC 103
           F++G  SG+       PFD IKV L                      + D ++ K PL  
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 104 VYKT-FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNE-EKLPLSGC 161
              T + Q G+R FY+G    +V      ++  G     + ++ +     +  +L     
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQ-VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGL 220
            I+G + G +  F   P++  K ++Q    +    K +  +   K++Y   G+R  Y+G+
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 221 TSTLIFRTNF-VFWWGSYELLTRWF----KEHTNMSDTAINFWXXXXX-----XXXXXWT 270
              ++    +     G++  L +W+     + T + +  +                   T
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 271 TAYPSDVIKQVVLCNDKYD--GTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXX 328
             YP ++++  +     Y    T+  +    K   +  GY+G FKG VP+  +  P    
Sbjct: 443 LVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSI 502

Query: 329 XXXXFEFVLR 338
               +E + R
Sbjct: 503 SYLCYENLKR 512

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 3/98 (3%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ---TSQDSTRFKGPLDCVYKTF 108
           P      S ++    G FSG     + +P + ++ RLQ   T      + G  D + KT 
Sbjct: 418 PEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTI 477

Query: 109 TQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 146
            ++G +G + G  P L       S+   C  N + L+K
Sbjct: 478 QREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKRLMK 515

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 117/307 (38%), Gaps = 54/307 (17%)

Query: 80  PFDTIKVRLQ---------------------------TSQDSTRFKGPLDCVYKTFTQQG 112
           PFD +K RLQ                           T Q +T FK  +  +   + Q+G
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 113 IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSV 172
            R  + G  P LVG I   S+        + +  K  + N ++ P    +++   AGW+ 
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSK-AFNNGQEAPWIH-LMAAATAGWAT 193

Query: 173 SFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVF 232
           +    P+ + K ++Q+    KT  Y    D +K +  + G+ GLY+GL+++ +     + 
Sbjct: 194 ATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGIL 253

Query: 233 WWGSYELLTRWFK-----------EHTNMSDTAINFWXXXX----XXXXXXWTTAYPSDV 277
            W  YE L    K           E T  +   I  W                  YP +V
Sbjct: 254 QWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEV 313

Query: 278 I----KQVVLCND--KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXX 331
           +    +Q  L N   KY G  +S+++  K+     G    + G  P  +R+ P       
Sbjct: 314 VRTRLRQSPLENGKVKYTGLVQSFRVIIKE----EGLASMYSGLTPHLMRTVPNSIIMFG 369

Query: 332 XFEFVLR 338
            +E V++
Sbjct: 370 TWEVVIK 376

>Kwal_23.3965
          Length = 307

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 80/171 (46%), Gaps = 12/171 (7%)

Query: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV 213
           +++P+   +++G ++G S   + AP++  K +LQ+Q  A   +Y G +   K++    GV
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQEGV 68

Query: 214 RGLYKGLTSTLIFRTNFVFW----WGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXW 269
           R L+KG    +     ++ +    + SY +L +   +  +     I+             
Sbjct: 69  RALWKGNVPAMAM---YILYGSTQFTSYAILNKLLSK--SQLPAQIHTGMVGALSGTCSA 123

Query: 270 TTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFL 320
             +YP DV++   + N   +    +    A++IWR  G+RGFFKG   S +
Sbjct: 124 IASYPCDVLRTRFIANHSRE--LSTMLSTAQEIWRHEGFRGFFKGVSSSIV 172

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 76/166 (45%), Gaps = 15/166 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTS-QDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
            V+G  SGI+   V  P DT+K+RLQ    +  ++ G L    +   Q+G+R  + G  P
Sbjct: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPL---SGCIISGVMAGWSVSFIAAPV 179
            +  +IL  S           LL K       +LP    +G +  G ++G   +  + P 
Sbjct: 78  AMAMYILYGSTQFTSYAILNKLLSK------SQLPAQIHTGMV--GALSGTCSAIASYPC 129

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
           ++ + +    +  + +     +   ++++   G RG +KG++S+++
Sbjct: 130 DVLRTRFIANHSRELSTM---LSTAQEIWRHEGFRGFFKGVSSSIV 172

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 71/160 (44%), Gaps = 13/160 (8%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P++ ++ ++G +SG  S IA     +P D ++ R   +  S      L    + +  +G 
Sbjct: 106 PAQIHTGMVGALSGTCSAIAS----YPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGF 160

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPL---SGCIISGVMAGW 170
           RGF+ G +  +V   +  S +L    + ++  ++    +   + L   S  +I+G+++  
Sbjct: 161 RGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVS-- 218

Query: 171 SVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS 210
               I  P++  + + QV  D +   + G  +   K Y S
Sbjct: 219 --KTIVFPIDTVRKRYQV-IDWQQLGHPGHTNKAYKAYKS 255

>Kwal_26.7967
          Length = 297

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 121/295 (41%), Gaps = 26/295 (8%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
           F++G  +G  + ++ +PF+  K RLQ   + ST  + PL  +Y+T   QG+   Y+G   
Sbjct: 13  FLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPA 72

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG--CIISGVMAGWSVSFIAA-PV 179
            +VG      V        + +L+     +     LSG   I++G+ AG   S +A  P 
Sbjct: 73  FIVGNTAKAGVRFLGFDAIKNILR-----DPTTGELSGPRGIVAGLGAGLLESVVAVTPF 127

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS----NGVRGLYKG-LTSTLIFRTNFVFWW 234
           E  K  L     + + KY      + + YSS     G  GLY+G L  ++    N     
Sbjct: 128 EAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRL 187

Query: 235 GSYELLTRWFKEHTNMS-----DTAINFWXXXXXXXXXXWTTAYPSDVIKQVV--LCNDK 287
           G Y  +    +++TN +      + + F           +TT  P D +K  +  L + K
Sbjct: 188 GCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTT-MPIDTVKTRMQSLDSSK 246

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGA 342
           Y  T   +      ++R  G + F+KG  P   R           +E VL   GA
Sbjct: 247 YSSTINCF----ATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLGA 297

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFT 121
           M FV G FSGI       P DT+K R+Q S DS+++   ++C    F ++G++ F+ G T
Sbjct: 213 MTFVVGAFSGIVTVYTTMPIDTVKTRMQ-SLDSSKYSSTINCFATVFREEGLKTFWKGAT 271

Query: 122 PPLVGWILMDSVM 134
           P L   IL   ++
Sbjct: 272 PRLGRLILSGGIV 284

>Kwal_26.7653
          Length = 325

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 88/188 (46%), Gaps = 13/188 (6%)

Query: 53  PPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDSTR-FKGPLDCVYKT 107
           P ++  S+   F++G  +      V +P + +K R+Q     S D+ R +K P+  +   
Sbjct: 17  PAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI 76

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC---IIS 164
           F  +GIRG   G +   +  I ++   LG     R +L K  Y   +   +      ++S
Sbjct: 77  FKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS 136

Query: 165 GVMAGWSVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVRGLYKGL 220
           G  +G   + + +P+ L K ++Q   +A    + T YT   + +  +Y + G +GLY+G+
Sbjct: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGV 196

Query: 221 TSTLIFRT 228
            +  I RT
Sbjct: 197 DAA-ILRT 203

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 83/202 (41%), Gaps = 21/202 (10%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDCVYKT 107
           P +  +  +  VSG  SGI    +G P   IK R+Q+  ++      T +    + +   
Sbjct: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC-IISGV 166
           +  +G +G Y G    ++      SV L   +  +  L K+    E     +G  +++  
Sbjct: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEG----TGLHLVAST 239

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
           ++G+ V  +  P ++   ++   Y+ K   Y GP+D   K     G+  LYKG  +    
Sbjct: 240 VSGFGVGVVMNPWDVILTRV---YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQ--- 293

Query: 227 RTNFVFWWGSYELLTRWFKEHT 248
               +F    + +L   F E T
Sbjct: 294 ----IFRIAPHTILCLTFMEQT 311

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 89/189 (47%), Gaps = 16/189 (8%)

Query: 49  IQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVY 105
           ++    ++  S++  F++G  +G+      +P DT+K R+Q +  +   KG    +    
Sbjct: 309 VENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAK 368

Query: 106 KTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK-------KYVYYNEEKLPL 158
           + +T+ G++ FY G T  ++G     ++ LG    + ML K       K +   EE + L
Sbjct: 369 EMYTEGGLKLFYRGVTVGVLGIFPYAALDLGT---FSMLKKWYISSKAKKLNKKEEDVEL 425

Query: 159 SGCII--SGVMAGWSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRG 215
           S  ++   G  +G   + +  P+ L + +LQ Q   A   +Y G  DV+ K     G  G
Sbjct: 426 SNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPG 485

Query: 216 LYKGLTSTL 224
           L+KGL  TL
Sbjct: 486 LFKGLVPTL 494

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 120/300 (40%), Gaps = 43/300 (14%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKV-----------RLQTSQD---------STRFKGPL-D 102
           F++G  SG+       PFD +KV            L +++D           + + PL  
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 103 CVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK-LPLSGC 161
            +   + Q GI+ FY+G     +      S+  G     + L+ K     + K L     
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQ-VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGL 220
            I+G +AG    F   P++  K ++Q    +A+       +   K++Y+  G++  Y+G+
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 221 TSTLIFRTNF-VFWWGSYELLTRWF---------KEHTNMSDTAINFWXXXXXXXXXXWT 270
           T  ++    +     G++ +L +W+         K+  ++  + +              T
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 271 TAYPSDVIKQVVLCND------KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             YP ++++  +          +YDG FR   L  K I R  GY G FKG VP+  +  P
Sbjct: 444 VVYPINLLRTRLQAQGTFAHPYRYDG-FRDVLL--KTIQR-EGYPGLFKGLVPTLAKVCP 499

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 73/193 (37%), Gaps = 30/193 (15%)

Query: 160 GCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKK------------- 206
           G  I+G ++G       AP +  K  L  + D  +T      DV+ K             
Sbjct: 202 GFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPL 261

Query: 207 ------VYSSNGVRGLY--KGLTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDT----A 254
                 +Y   G++  Y   GL +  +F  + +  +GS+E+  +   +  N  DT     
Sbjct: 262 VKAIISLYRQGGIKSFYVGNGLNALKVFPESSI-KFGSFEITKKLMTKVENCKDTKDLSK 320

Query: 255 INFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKL---AAKDIWRTRGYRGF 311
           ++ +            + YP D +K  + C    +   +  KL    AK+++   G + F
Sbjct: 321 LSTFIAGGLAGVCAQFSVYPIDTLKFRMQCA-PLNAELKGRKLMIQTAKEMYTEGGLKLF 379

Query: 312 FKGFVPSFLRSFP 324
           ++G     L  FP
Sbjct: 380 YRGVTVGVLGIFP 392

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 121/294 (41%), Gaps = 26/294 (8%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLGFTP 122
           F++G  +G  + +V +PF+  K RLQ    +++  + PL  +Y T   QGI   Y+G   
Sbjct: 13  FIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGCPA 72

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG--CIISGVMAGWSVSFIAA-PV 179
            +VG      V        + LL+     + +   LSG   +I+G+ AG   S +A  P 
Sbjct: 73  FIVGNTAKAGVRFLGFDTIKNLLR-----DPKTGELSGPRGVIAGLGAGLLESVVAVTPF 127

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS----NGVRGLYKG-LTSTLIFRTNFVFWW 234
           E  K  L     + T KY      + + Y++     G+ GLY+G L  ++    N     
Sbjct: 128 EAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRL 187

Query: 235 GSYELLTRWFKEHTNMS-----DTAINFWXXXXXXXXXXWTTAYPSDVIKQVV--LCNDK 287
           G Y  +    +++TN        + + F           +TT  P D +K  +  L + +
Sbjct: 188 GCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTT-MPIDTVKTRMQSLDSKR 246

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSG 341
           Y  T   +      I++  G + F+KG  P   R F         +E VL   G
Sbjct: 247 YSSTINCF----TTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVLG 296

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 86/186 (46%), Gaps = 13/186 (6%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDST------RFKGP 100
           ++ + P +   S   G ++G+ +G+ ++ V   PF+ IK  L   + S         KG 
Sbjct: 93  NLLRDPKTGELSGPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGM 152

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG 160
           L        +QG+ G Y G  P  +      +V LGC +  +++++ Y    ++K PLS 
Sbjct: 153 LRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDK-PLSS 211

Query: 161 CI--ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218
            +  + G  +G    +   P++  K ++Q   D+K  +Y+  ++    ++   G++  +K
Sbjct: 212 GLTFVVGAFSGIVTVYTTMPIDTVKTRMQ-SLDSK--RYSSTINCFTTIFKEEGLKAFWK 268

Query: 219 GLTSTL 224
           G T  L
Sbjct: 269 GATPRL 274

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 127/293 (43%), Gaps = 32/293 (10%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGP 100
           + ++P  + A   +MG VS   + +AK A   P + +K+ +Q   +         R+KG 
Sbjct: 3   ETKKPQSNFAIDFLMGGVS---AAVAKTAA-SPIERVKLLIQNQDEMIKQGSLDHRYKGI 58

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP--L 158
           +DC  +T  Q+GI  F+ G T  ++ +    ++        + +   + +  EE      
Sbjct: 59  VDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAM---FGFKKEEGYAKWF 115

Query: 159 SGCIISGVMA-GWSVSFIAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSN 211
           +G + SG +A G S+ F+     L  A+ ++  DAK++K      + G VDV KK  +S+
Sbjct: 116 AGNLASGGIAGGLSLMFV---YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASD 172

Query: 212 GVRGLYKGLTSTLIFRTNFVFWWGSYELLTRWFKE---HTNMSDTAINFWXXXXXXXXXX 268
           GV GLY+G   ++I     V + G Y  L    K      ++  + I  +          
Sbjct: 173 GVAGLYRGFLPSVI---GIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVTTGA 229

Query: 269 WTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
            T +YP D +++ ++        ++      + I    G    FKG   + LR
Sbjct: 230 STASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 86/177 (48%), Gaps = 12/177 (6%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT----FTQQGIR 114
           S+   +++G  +G+A     +P DT+K R+Q +   T+ KG  + +++T    F + G+R
Sbjct: 346 SKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGN-NLLFQTAKDMFREGGLR 404

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHN----YRMLLKKYVYYNEEKLPLSGCII--SGVMA 168
            FY G T  +VG     ++ LG        Y     K +   ++++ LS  ++   G  +
Sbjct: 405 LFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFS 464

Query: 169 GWSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G   + +  P+ L + +LQ Q   A    Y G  DV+ K     G +GL+KGL  TL
Sbjct: 465 GTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTL 521

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/298 (19%), Positives = 110/298 (36%), Gaps = 39/298 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDSTRFKGPLDC 103
           F++G  SG+       PFD +KV L                      + D  +   PL  
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 104 VYKT-FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK-LPLSGC 161
             K+ + Q GI+ FY+G    ++      S+  G     + ++ K     + K L     
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGL 220
            I+G +AG +  F   P++  K ++Q    D K           K ++   G+R  Y+G+
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGV 410

Query: 221 TSTLIFRTNF-VFWWGSYELLTRWF-----------KEHTNMSDTAINFWXXXXXXXXXX 268
           T  ++    +     G++  L +W+           ++   +S+  +             
Sbjct: 411 TVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVV--LPMGAFSGTVG 468

Query: 269 WTTAYPSDVIKQVVLCNDKYDG--TFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
            +  YP ++++  +     Y     +  +K          GY+G FKG VP+  +  P
Sbjct: 469 ASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCP 526

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 40/100 (40%), Gaps = 3/100 (3%)

Query: 49  IQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTR---FKGPLDCVY 105
           +  P      S ++    G FSG    +V +P + ++ RLQ          + G  D + 
Sbjct: 443 LNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLL 502

Query: 106 KTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLL 145
           KT  ++G +G + G  P L       S+   C  N +  +
Sbjct: 503 KTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYENLKKFM 542

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 83/177 (46%), Gaps = 12/177 (6%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT----FTQQGIR 114
           SR+  +V+G   GI      +P DT+K R+Q +   TR +G L  + KT    + + G+R
Sbjct: 294 SRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRG-LPLLIKTAKDMYREGGLR 352

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHN----YRMLLKKYVYYNEEKLPLSGCII--SGVMA 168
            FY G    ++G     ++ LG        Y       +  +E ++ +S  ++   G  +
Sbjct: 353 LFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFS 412

Query: 169 GWSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G   + +  P+ L + +LQ Q   A   +Y G  DV +K     G+ GLYKGL  TL
Sbjct: 413 GTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 58/299 (19%), Positives = 104/299 (34%), Gaps = 43/299 (14%)

Query: 80  PFDTIKV-----------RLQTSQ---------DSTRFKGPL-DCVYKTFTQQGIRGFYL 118
           PFD IKV            L T +         D  + + PL       + Q G+R FYL
Sbjct: 195 PFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYL 254

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE-KLPLSGCIISGVMAGWSVSFIAA 177
           G    ++      ++  G     + +L       E  +L      ++G + G    F   
Sbjct: 255 GNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGIMAQFSVY 314

Query: 178 PVELAKAKLQ-VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWG 235
           P++  K ++Q    D +       +   K +Y   G+R  Y+GL   ++    +     G
Sbjct: 315 PIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALDLG 374

Query: 236 SYELLTRWF-----------KEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLC 284
           ++  L RW+           +    MS+  +              T  YP ++++  +  
Sbjct: 375 TFSALKRWYITRRANALGISENEVVMSNLVV--LPMGAFSGTVGATVVYPINLLRTRLQA 432

Query: 285 NDKYDGTFRSWKLAAKDIWRT----RGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 339
              Y    R      +D++R      G  G +KG VP+  +  P        +E + R 
Sbjct: 433 QGTYAHPHRYDGF--QDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLKRA 489

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 113/275 (41%), Gaps = 29/275 (10%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-------RGFY 117
           +SG+ +G     + HP D  KVRLQ    ST  KG     Y+    + +       R  Y
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKG-----YRNLWSEIVGSDLSLTRELY 67

Query: 118 LGFTPPLVGWILMDSVMLGC-LHNYRMLLKKYVYY-----NEEKLPLSGCIISGVMAGWS 171
            G T  LVG    +++  G    +YR+     + Y     N++ L     + +   +G  
Sbjct: 68  RGLTVNLVG----NTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGML 123

Query: 172 VSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV 231
            + +  P+ + K ++  + ++  T      D+IK    ++GV+GL+KGL   L+  +   
Sbjct: 124 TTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIK----NDGVQGLWKGLVPALVGVSQGA 179

Query: 232 FWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTA--YPSDVIKQVVLCNDKYD 289
             +  Y+ L          SD   N             +T+  YP  ++K  +      +
Sbjct: 180 LHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQASE 239

Query: 290 GTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             F+   L +K I+   G  GF+KG   + LRS P
Sbjct: 240 NDFKLLPL-SKMIYSRSGLLGFYKGLSANLLRSVP 273

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 79/175 (45%), Gaps = 19/175 (10%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSN--GVR 214
           PL   +ISG+ AG   + I  P++L K +LQ+   + T K  G  ++  ++  S+    R
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKK--GYRNLWSEIVGSDLSLTR 64

Query: 215 GLYKGLTSTLIFRTNFVFWWGSYELLTRWFKE------HTNMSDTAINFWXXXXXXXXXX 268
            LY+GLT  L+  T     WG Y    R  K+      H   +D  ++ W          
Sbjct: 65  ELYRGLTVNLVGNT---IAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSG 121

Query: 269 WTTAYPSD---VIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFL 320
             T   ++   VIK  ++     D T  S K+  +D+ +  G +G +KG VP+ +
Sbjct: 122 MLTTVLTNPLWVIKTRMMSKANSDLT--SMKV-LRDLIKNDGVQGLWKGLVPALV 173

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 121/297 (40%), Gaps = 30/297 (10%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-----DSTRFKGPLDCVYKTFTQQGIRGF 116
           +  ++G  +G+ +    HP DTIKVR+Q  +     +  +  G +      + ++G    
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLS--GCIISGVMAGWSVS- 173
           Y G    ++G I   ++       YR LL      N+E   +S     ++GV AG + + 
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----VNKESGIVSTGNTFVAGVGAGITEAV 126

Query: 174 FIAAPVELAKAKLQVQYDAKTTKYTGPV--DVIKKVYS---SNGVRGLYKGLTSTLIFR- 227
            +  P+E+ K +LQ Q+   +    GP   + I   Y+     GV  LY+G++ T   + 
Sbjct: 127 LVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQA 186

Query: 228 TNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIKQVV-- 282
           TN    +  Y  L  + + +  M    +  W              +   P D IK  +  
Sbjct: 187 TNQGANFTVYSKLKEFLQNYHQMD--VLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK 244

Query: 283 ---LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
              +  +K  G  +   + A+ + +  G+R  +KG  P  +R  P        +E+V
Sbjct: 245 DKSISLEKQSGMKKIITIGAQ-LLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV 300

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 87/180 (48%), Gaps = 26/180 (14%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P+ AY      ++   SGIA   + +P   IK R+  +  +  +K   D VYK +  +G+
Sbjct: 112 PAHAY-----MLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGV 166

Query: 114 RGFYLGFTPPLVG-------WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCI-ISG 165
             F+ G  P L+G       + L D++    LH+            E +L +S  I I+ 
Sbjct: 167 LAFWRGVVPSLLGVSQGAIYFALYDTLKFHYLHS-------STDKAERRLSVSEIIGITC 219

Query: 166 VMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
           +    SV+ +  P +L K+KLQ  + A     +G   +++ VYS  G+RG Y+GL++ L+
Sbjct: 220 ISKMISVTSV-YPFQLLKSKLQ-DFGAP----SGITQLVQTVYSREGIRGFYRGLSANLL 273

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/273 (18%), Positives = 117/273 (42%), Gaps = 21/273 (7%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTS---QDSTRFKGPLDCVYKTFTQQGIRGFYLGFT 121
           +SG+ +G       HP D +K+RLQ S   + +T + G +  +++   QQ  R  Y G  
Sbjct: 13  ISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFE--RQQWGRELYRGLG 70

Query: 122 PPLVGWILMDSVMLGCLHNYRMLLKKYVYYN------EEKLPLSGCIISGVMAGWSVSFI 175
             L+G  +  ++  GC    + +  +++         + +LP    +++   +G + + +
Sbjct: 71  VNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAVL 130

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWG 235
             P+ + K ++     ++   Y    D + K+Y + GV   ++G+  +L+  +    ++ 
Sbjct: 131 TNPIWVIKTRIMA--TSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQGAIYFA 188

Query: 236 SYELLT-RWFKEHTNMSDTAIN---FWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGT 291
            Y+ L   +    T+ ++  ++                T+ YP  ++K  +       G 
Sbjct: 189 LYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAPSGI 248

Query: 292 FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
            +      + ++   G RGF++G   + LR+ P
Sbjct: 249 TQ----LVQTVYSREGIRGFYRGLSANLLRAVP 277

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 119/288 (41%), Gaps = 43/288 (14%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGPLDCVYKTFTQQGI 113
           ++ F+ G  S         P + +K+ +Q   +         R+ G +DC  +T   +G+
Sbjct: 10  LINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGV 69

Query: 114 RGFYLGFTPPLVGWILMDSV------MLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167
             F+ G T  ++ +    ++       +  +  +R  +  Y  +       +G + SG  
Sbjct: 70  ISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKW------FAGNLASGGA 123

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSNGVRGLYKG-- 219
           AG         ++ A+ +L    D+K+ K      + G VDV KK  +S+G+ GLY+G  
Sbjct: 124 AGGLSLLFVYSLDYARTRLAA--DSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFL 181

Query: 220 --LTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDV 277
             +   +++R     ++G Y+ L        N+  + I  +           T +YP D 
Sbjct: 182 PSVVGIVVYRG---LYFGMYDSLKPLLLTG-NLESSFIASFLLGWAVTTGASTASYPLDT 237

Query: 278 IKQVVLCND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           +++ ++       KYDG F ++    + I    G +  FKG   + LR
Sbjct: 238 VRRRMMMTSGQAVKYDGAFDAF----RKIVAAEGVKSLFKGCGANILR 281

>Scas_718.24
          Length = 337

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 130/300 (43%), Gaps = 50/300 (16%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGPLD 102
           ++P  + A   +MG VS   + +AK A   P + +K+ +Q   +        T++KG +D
Sbjct: 36  EKPQSNFAIDFLMGGVS---AAVAKTAA-SPIERVKLLIQNQNEMLKQGTLDTKYKGIVD 91

Query: 103 CVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP--LSG 160
           C  +T  Q+GI  F+ G T  ++ +    ++        +++   + +  E+      +G
Sbjct: 92  CFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLM---FGFKKEDGYGKWFAG 148

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSNGVR 214
            + SG  AG         ++ A+ +L    D+K++K      + G +DV KK   S+GV 
Sbjct: 149 NLASGGAAGGLSLLFVYSLDFARTRLAA--DSKSSKKGGSRQFNGLIDVYKKTLKSDGVA 206

Query: 215 GLYKG----LTSTLIFRTNFVFWWGSYE-----LLTRWFKEHTNMSDTAINFWXXXXXXX 265
           GLY+G    +   +++R     ++G Y+     LLT       ++  + +  +       
Sbjct: 207 GLYRGFLPSVVGIIVYRG---LYFGLYDSIKPVLLT------GSLEGSFLASFLLGWVVT 257

Query: 266 XXXWTTAYPSDVIKQVVLCND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
               T +YP D +++ ++       KY G F  +    K I    G    FKG   + LR
Sbjct: 258 TGASTCSYPLDTVRRKMMMTSGQAVKYKGAFDCF----KKIVAAEGVASLFKGCGANILR 313

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 128/313 (40%), Gaps = 33/313 (10%)

Query: 52  PPPSEAYSRI-----MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVY 105
           P PS   S +     + F++G  +G     V  PF+ +K+ LQ    +T + +G +  V 
Sbjct: 9   PQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVR 68

Query: 106 KTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYN----EEKLPLSGC 161
           + + ++G  G + G     +      +V       Y    K + + +     E+L     
Sbjct: 69  QVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV---YEACKKHFFHVDGSKGREQLQNWQR 125

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT----------TKYTGPVDVIKKVY-SS 210
           + SG + G        P++L + +L +Q    T          +K  G  D++ + Y   
Sbjct: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185

Query: 211 NGVRGLYKGLTSTLIFRTNFV-FWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXX--X 267
            G++GLY+G+  T +    +V   +  YE    +  E T+  +T  NF+           
Sbjct: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD--NTLANFYKLSIGALSGGV 243

Query: 268 XWTTAYPSDVIKQ----VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSF 323
             T  YP D++++    + +  ++    ++S   A   I +T G+RG++KG   +  +  
Sbjct: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303

Query: 324 PXXXXXXXXFEFV 336
           P        +E V
Sbjct: 304 PSTAVSWLVYEVV 316

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 117/329 (35%), Gaps = 62/329 (18%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----------------------------TSQ 92
           ++  V+G  +G+ +    HP DTIKVR+Q                               
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 93  DSTRFKGP---LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYV 149
           D+T    P   +      + Q+G    Y G    ++G I   ++       YR LL    
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADK- 130

Query: 150 YYNEEKLPLSGCIISGVMAGWSVS-FIAAPVELAKAKLQVQY-----DAKTTKYTGPVDV 203
                 +  S   I+GV AG + +  +  P+E+ K +LQ Q+     D    KYT  V  
Sbjct: 131 --QTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQA 188

Query: 204 IKKVYSSNGVRGLYKGLTSTLIFR-----TNFVFWWGSYELLTRWFKEHTNMSDTAINFW 258
              +    G+  LY+G++ T   +      NF  +    E L  +    T  S      W
Sbjct: 189 GYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPS------W 242

Query: 259 XXXXXXXXXXWTTAY---PSDVIKQVVLCNDKYDGTFR---SWKLAAK---DIWRTRGYR 309
                         +   P D IK   L  DK   +F+    WK  A     + +  G+R
Sbjct: 243 ETSCIGLISGAIGPFSNAPLDTIK-TRLQKDK-STSFKGESGWKRIAHIGTQLLKEEGFR 300

Query: 310 GFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
             +KG  P  +R  P        +EFV R
Sbjct: 301 ALYKGITPRVMRVAPGQAVTFTVYEFVRR 329

>Kwal_23.4731
          Length = 314

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 113/294 (38%), Gaps = 45/294 (15%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG------IRGFY 117
            ++G+ +G       HP D +K+RLQ   ++T   G  + + KT  +         R  Y
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVI-KTIIRDSKADSNVFREAY 75

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY---YNEEKLPLSGC------------I 162
            G    L+G    +S+  G         K  VY     + K P                +
Sbjct: 76  RGLGVNLIG----NSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYL 131

Query: 163 ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTS 222
            S  ++G   + +  P+ + K ++       + +Y    D I+KVY+  G  G ++GL  
Sbjct: 132 ASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVP 191

Query: 223 TLIFRTNFVFWWGSYELLTRWF---------KEHTNMSDTAINFWXXXXXXXXXXWTTAY 273
           +L        ++  Y+ L   +         ++  N+ + AI              T  Y
Sbjct: 192 SLFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAIT-----SVSKMLSVTAVY 246

Query: 274 PSDVIK---QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           P  ++K   Q     +K D ++R W L  K I +  G +G +KG   + LR+ P
Sbjct: 247 PFQLLKSNLQSFAAVEKRD-SYRFWNL-VKSIHQKEGLQGLYKGLSANLLRAIP 298

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 79/190 (41%), Gaps = 35/190 (18%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVY-----SSN 211
           PL   II+G+ AG   +    P++L K +LQ+  +  TT   G  +VIK +       SN
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVN--TTHSHGYKEVIKTIIRDSKADSN 69

Query: 212 GVRGLYKGLTSTLI--------------FRTNFVFWWGSYELLTRWFKEHTNMSDTAINF 257
             R  Y+GL   LI              F  + V+ +G  ++ T    + +   D A+  
Sbjct: 70  VFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTP--TQSSFQKDKAMGP 127

Query: 258 WXXXXXXXXXXWTTAYPSD---VIKQVVL-----CNDKYDGTFRSWKLAAKDIWRTRGYR 309
                        TA  ++   VIK  ++      +++Y  T   W    + ++   G+ 
Sbjct: 128 SLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTT---WD-GIRKVYAHEGFS 183

Query: 310 GFFKGFVPSF 319
           GF++G VPS 
Sbjct: 184 GFWRGLVPSL 193

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 113/274 (41%), Gaps = 26/274 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
           F++G  +G A+  + +PF+  K RLQ   + S   + PL  +YKT   QGI   Y+G   
Sbjct: 16  FLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPA 75

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC--IISGVMAGWSVSFIAA-PV 179
            ++G      +        + +L+     + E   LSG   +I+G+ AG   S  A  P 
Sbjct: 76  FIIGNTAKAGIRFLGFDTIKDMLR-----DSETGELSGTRGVIAGLGAGLLESVAAVTPF 130

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS----NGVRGLYKG-LTSTLIFRTNFVFWW 234
           E  K  L     + T KY      + + YSS     G  GLY+G L  ++    N     
Sbjct: 131 EAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRL 190

Query: 235 GSYELLTRWFKEHTNMS-----DTAINFWXXXXXXXXXXWTTAYPSDVIKQVV--LCNDK 287
           G Y  +    +++T+        + + F           ++T  P D +K  +  L + K
Sbjct: 191 GCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYST-MPLDTVKTRMQSLDSTK 249

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           Y  T   +      I++  G + F+KG  P   R
Sbjct: 250 YSSTMNCF----ATIFKEEGLKTFWKGATPRLGR 279

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D    P  +  S  + F+ G FSGI       P DT+K R+Q S DST++   ++C    
Sbjct: 202 DYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQ-SLDSTKYSSTMNCFATI 260

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVM 134
           F ++G++ F+ G TP L   +L   ++
Sbjct: 261 FKEEGLKTFWKGATPRLGRLVLSGGIV 287

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 81/186 (43%), Gaps = 13/186 (6%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKN-AVGHPFDTIKVRLQTSQDSTRFK------GP 100
           D+ +   +   S   G ++G+ +G+ ++ A   PF+ IK  L   + S   K      G 
Sbjct: 96  DMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGV 155

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG 160
           +         +G  G Y G  P  +      +V LGC +  + L++ Y    ++K PLS 
Sbjct: 156 VRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDK-PLSS 214

Query: 161 CI--ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218
            +  + G  +G    +   P++  K ++Q      +TKY+  ++    ++   G++  +K
Sbjct: 215 GLTFLVGAFSGIVTVYSTMPLDTVKTRMQ---SLDSTKYSSTMNCFATIFKEEGLKTFWK 271

Query: 219 GLTSTL 224
           G T  L
Sbjct: 272 GATPRL 277

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 115/290 (39%), Gaps = 36/290 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGF----YLG 119
            +SG+ +G       HP D +KVRLQ    + + +G  D V +         F    Y G
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRG 71

Query: 120 FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY--------------NEEKLPLSGCIISG 165
               L+G    +SV  G         K +V+               N++++     +++ 
Sbjct: 72  LGVNLLG----NSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAA 127

Query: 166 VMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            M+G + S +  P+ + K ++       +  Y   VD IKK+Y   G+ G ++GL  +L 
Sbjct: 128 AMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLF 187

Query: 226 FRTNFVFWWGSYELLTRWF--KEHTNMSD--TAINFWXXXXXXXXXXWTTAYPSDVIKQV 281
             +    ++  Y+ L   +   +H +     + + +            T  YP  ++K  
Sbjct: 188 GVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSN 247

Query: 282 V-------LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           +       + N K   + R WKL    I+   G  G +KG + + +R+ P
Sbjct: 248 LQSFEVSTVINPK--TSHRVWKLIT-TIYVRDGVTGLYKGLLANLIRAVP 294

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 74/184 (40%), Gaps = 25/184 (13%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNG---- 212
           P+   +ISG+ AG   +    P++L K +LQ+   A   K  G  DV+K++   +     
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLL--ATNKKPQGYYDVVKRIVKDSKQHSF 64

Query: 213 VRGLYKGLTSTLIFRTNFVFW---WGSYELLTRW--------FKEHTNMSD-----TAIN 256
            R  Y+GL   L+   N V W   +G Y     W         K   N  +     T++ 
Sbjct: 65  FRETYRGLGVNLL--GNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLM 122

Query: 257 FWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDG-TFRSWKLAAKDIWRTRGYRGFFKGF 315
           +                P  VIK  ++     D  ++RS     K ++R  G  GF++G 
Sbjct: 123 YLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGL 182

Query: 316 VPSF 319
           VPS 
Sbjct: 183 VPSL 186

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 120/308 (38%), Gaps = 33/308 (10%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115
           E  S     V+G  SG+       P DT+K++LQ +  +       + +     ++GIRG
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----ANVLINILKREGIRG 66

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175
           F+ G  P  + +I+      G        L+  +  N     L  C++ G +AG + S  
Sbjct: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCLV-GSLAGMTSSLA 124

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI-FRTNFVFWW 234
           + P ++ + +       +  K     D I  ++S  G+ G + G  S++I    N    +
Sbjct: 125 SYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181

Query: 235 GSYELLTRWFKEHTNMSD-----TAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYD 289
           G YE +  + +E + +SD     T +N              T +P D +++ +   +  +
Sbjct: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLAT-FPLDTVRRRIQIRNSPN 240

Query: 290 GTFRSWKLAAKDIWRTRGYRGF----------------FKGFVPSFLRSFPXXXXXXXXF 333
              R  +   KDI+++   R F                ++G   S ++S P        +
Sbjct: 241 EE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSY 299

Query: 334 EFVLRTSG 341
           E  +   G
Sbjct: 300 ELFMNKLG 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 72/171 (42%), Gaps = 10/171 (5%)

Query: 146 KKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIK 205
           KK     +E++  +  +++G ++G       AP++  K KLQV      T +    +V+ 
Sbjct: 3   KKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV------TPHNKNANVLI 56

Query: 206 KVYSSNGVRGLYKG-LTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXX 264
            +    G+RG +KG +  ++++       +GSY  +  + +   +++ +   +       
Sbjct: 57  NILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSL 116

Query: 265 XXXXWTTA-YPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKG 314
                + A YP DV++     N +  G     +     IW   G  GFF G
Sbjct: 117 AGMTSSLASYPFDVLRTRFAANSQ--GQLIKLRDEIMAIWSHEGLMGFFSG 165

>Kwal_47.18216
          Length = 333

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 116/316 (36%), Gaps = 46/316 (14%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +  V+G  +G+ +    HP DTIKVR+Q      +   R +G +       TQ+G    Y
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS-FIA 176
            G    ++G I   ++       +R LL          +      ++GV AG + +  + 
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLAD---RQTGVVSTGNTFVAGVGAGITEAVMVV 128

Query: 177 APVELAKAKLQVQY------------------------------DAKTTKYTGPVDVIKK 206
            P+E+ K +LQ Q+                               A T KY   +     
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYV 188

Query: 207 VYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKEH--TNMSDTAINFWXXXXX 263
           +    G R LY+G++ T   + TN    +  Y  L    +E+  T+M  +          
Sbjct: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248

Query: 264 XXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWK--LA-AKDIWRTRGYRGFFKGFVPSFL 320
                ++ A P D IK   L  DK       W   LA  + + R  G+R  +KG  P  +
Sbjct: 249 GALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306

Query: 321 RSFPXXXXXXXXFEFV 336
           R  P        +E +
Sbjct: 307 RVAPGQAVTFTVYELI 322

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 23/176 (13%)

Query: 64  FVSGMFSGIAKNAVG----HPFDTIKVRLQTSQDSTR------FKGPLDCVYKTFTQQGI 113
           F   + SG A  A+     +  D  + RL     S++      F G  D   KT    GI
Sbjct: 116 FAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173
            G Y GF P +VG ++   +  G   +    LK  V        L G  ++  + GW V+
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFDS----LKPLVLTGS----LDGSFLASFLLGWVVT 227

Query: 174 FIAA----PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
             A+    P++  + ++ +    +  KY G +D +KK+ +S GV  L+KG  + ++
Sbjct: 228 TGASTCSYPLDTVRRRMMMT-SGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANIL 282

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 125/297 (42%), Gaps = 38/297 (12%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGP 100
           D +Q   + A + +MG VS   + IAK A   P + +K+ +Q   +         ++ G 
Sbjct: 4   DAKQQETNFAINFLMGGVS---AAIAKTAA-SPIERVKILIQNQDEMIKQGTLDKKYSGI 59

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP--L 158
           +DC  +T  Q+G+  F+ G T  ++ +    ++        +++   + +  EE      
Sbjct: 60  VDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLM---FGFKKEEGYGKWF 116

Query: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSNG 212
           +G + SG  AG         ++ A+ +L    DAK++K      + G  DV KK   S+G
Sbjct: 117 AGNLASGGAAGALSLLFVYSLDFARTRLAA--DAKSSKKGGARQFNGLTDVYKKTLKSDG 174

Query: 213 VRGLYKGLTSTLIFRTNFVFWWGSYELLTRWFKEHT---NMSDTAINFWXXXXXXXXXXW 269
           + GLY+G   +++     V + G Y  +    K      ++  + +  +           
Sbjct: 175 IAGLYRGFMPSVV---GIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGAS 231

Query: 270 TTAYPSDVIKQVVLCND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRS 322
           T +YP D +++ ++       KY+G         K I  + G    FKG   + LRS
Sbjct: 232 TCSYPLDTVRRRMMMTSGQAVKYNGAIDCL----KKIVASEGVGSLFKGCGANILRS 284

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 89/186 (47%), Gaps = 13/186 (6%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKGPLDCVYKTFT 109
           ++  S+   FV+G  +      V +P + IK+R+Q     ++  +  +K P+  +   F 
Sbjct: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76

Query: 110 QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE--KLPLSGC-IISGV 166
            +GI+G   G     +  I ++   LG     R  L +  + ++E  K+   G  + SG 
Sbjct: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGA 136

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYD----AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTS 222
            +G   + I +P+ L K +LQ   +     + T YTG  + +  ++ + GV+GL++G+ +
Sbjct: 137 ASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196

Query: 223 TLIFRT 228
             I RT
Sbjct: 197 A-ILRT 201

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 85/202 (42%), Gaps = 21/202 (10%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD------STRFKGPLDCVYKT 107
           P +  S  +   SG  SGI    +G P   +K RLQ+  +       T + G  + +   
Sbjct: 122 PHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTI 181

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYYNEEKLPLSGCIISGV 166
           F  +G++G + G    ++      SV L   +  + +L+K  +  +   L L+   ISG+
Sbjct: 182 FKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGL 241

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
                V+ +  P ++   ++   Y+ K   Y GP+D + K     GV  LYKG  +    
Sbjct: 242 ----GVAVVMNPWDVILTRI---YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQ--- 291

Query: 227 RTNFVFWWGSYELLTRWFKEHT 248
               VF    + ++   F E T
Sbjct: 292 ----VFRIAPHTIMCLTFMEQT 309

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 24/174 (13%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVG 126
           G  +G+  + V +P D ++ RL  ++ S R     +C  + +  +G+RGF+ G +  +  
Sbjct: 121 GALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEEC-RQMWLNEGVRGFFTGISTAMTT 179

Query: 127 WILMDSVMLGCLHNYRMLLKKYVYYNEEK----LPLSGCIISGVMAGWSVSFIAAPVELA 182
             L  ++M        ++ +     N EK     P+S    SG++AG+    +  P++  
Sbjct: 180 VTLSTAIMFLTYETVNIVCE-----NHEKEFWSRPVSAS--SGIIAGFVSKTMVFPIDTL 232

Query: 183 KAKLQVQYDAKTT------------KYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           + ++QV    +T             +Y     +I K+    GV  LY+GLT  L
Sbjct: 233 RRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGL 286

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 86/169 (50%), Gaps = 15/169 (8%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVR--LQTSQDSTRFKGPLDCVYKTFTQQGIRGF 116
           S I G VSG+F+ +A      P DT+K+R  LQ  Q+  ++KG    V     ++G+R  
Sbjct: 21  SVIAGSVSGVFARMATA----PMDTVKIRYQLQPVQED-KYKGIASTVRTIMKEEGLRAL 75

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRML-LKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175
           + G  P    +++  +V  G    +  +   K+  ++++   L+     G +AG + S +
Sbjct: 76  WKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLT----VGALAGMTSSVV 131

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           + P++L + +L      +T+  T   +  ++++ + GVRG + G+++ +
Sbjct: 132 SYPLDLLRTRLIAN---RTSHRTSVAEECRQMWLNEGVRGFFTGISTAM 177

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 63/157 (40%), Gaps = 6/157 (3%)

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG- 219
            +I+G ++G       AP++  K + Q+Q   +  KY G    ++ +    G+R L+KG 
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQ-PVQEDKYKGIASTVRTIMKEEGLRALWKGN 79

Query: 220 LTSTLIFRTNFVFWWGSYELLTR-WFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVI 278
           + +T ++       +GSY      W  +    S                    +YP D++
Sbjct: 80  IPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSS-VVSYPLDLL 138

Query: 279 KQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGF 315
           +  ++ N     T  S     + +W   G RGFF G 
Sbjct: 139 RTRLIANRTSHRT--SVAEECRQMWLNEGVRGFFTGI 173

 Score = 35.0 bits (79), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 33/83 (39%), Gaps = 14/83 (16%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST--------------RFKGPL 101
           E +SR +   SG+ +G     +  P DT++ R+Q                    R+K   
Sbjct: 204 EFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSST 263

Query: 102 DCVYKTFTQQGIRGFYLGFTPPL 124
             +YK   Q+G+   Y G T  L
Sbjct: 264 AIIYKILRQEGVSALYRGLTMGL 286

>Scas_489.4
          Length = 297

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 86/186 (46%), Gaps = 13/186 (6%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDSTRFK------GP 100
           ++ + P +   S   G V+G+ +G+ ++ V   PF+ IK  L   + + + K      G 
Sbjct: 94  NMLRDPVTGELSGPRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGM 153

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG 160
           L         QGI G Y G  P  +      +V LGC +  + +++ Y    +++ PLS 
Sbjct: 154 LRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDR-PLSS 212

Query: 161 CI--ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218
            +  I G  +G    +   P++  K ++Q   DA  TKYT  V+   K++   G++  +K
Sbjct: 213 GLTFIVGAFSGVVTVYTTMPIDTVKTRMQ-SLDA--TKYTSTVNCFAKIFKEEGLKTFWK 269

Query: 219 GLTSTL 224
           G T  L
Sbjct: 270 GATPRL 275

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 110/274 (40%), Gaps = 26/274 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
           F++G  +G  + ++ +PF+  K RLQ   + ST  + PL  +Y T   QG    Y+G   
Sbjct: 14  FIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPA 73

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG--CIISGVMAGWSVSFIAA-PV 179
            +VG      +        + +L+  V        LSG   +++G+ AG   S +A  P 
Sbjct: 74  FIVGNTAKAGIRFLGFDTIKNMLRDPVTGE-----LSGPRGVVAGLGAGLLESVVAVTPF 128

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS----NGVRGLYKG-LTSTLIFRTNFVFWW 234
           E  K  L     A   KY      + + Y S     G+ GLY+G L  ++    N     
Sbjct: 129 EAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRL 188

Query: 235 GSYELLTRWFKEHTNMS-----DTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCND--K 287
           G Y  +    +++TN        + + F           +TT  P D +K  +   D  K
Sbjct: 189 GCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTT-MPIDTVKTRMQSLDATK 247

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           Y  T   +      I++  G + F+KG  P   R
Sbjct: 248 YTSTVNCF----AKIFKEEGLKTFWKGATPRLGR 277

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D    P     S  + F+ G FSG+       P DT+K R+Q S D+T++   ++C  K 
Sbjct: 200 DYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQ-SLDATKYTSTVNCFAKI 258

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLL 145
           F ++G++ F+ G TP L   IL   ++     N  + L
Sbjct: 259 FKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVFL 296

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 113/274 (41%), Gaps = 26/274 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLGFTP 122
           F++G  +G  + ++ +PF+  K RLQ    +++  + PL  +Y T    GI   Y+G   
Sbjct: 94  FLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPA 153

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG--CIISGVMAGWSVSFIAA-PV 179
            +VG      +        + LL+     +++   LSG   +++G+ AG   S +A  P 
Sbjct: 154 FIVGNTAKAGIRFLGFDTIKNLLR-----DKKTGELSGFRGVVAGLGAGLLESVVAVTPF 208

Query: 180 ELAKAKLQVQYDAKTTKYT----GPVDVIKKVYSSNGVRGLYKG-LTSTLIFRTNFVFWW 234
           E  K  L     A   KY     G V    K+ S  G  GLY+G L  ++    N     
Sbjct: 209 EAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRL 268

Query: 235 GSYELLTRWFKEHTNMS-----DTAINFWXXXXXXXXXXWTTAYPSDVIKQVV--LCNDK 287
           G Y  +    +++TN+       + + F           +TT  P D +K  +  L   +
Sbjct: 269 GCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTT-MPIDTVKTRMQSLNAGQ 327

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           Y  T   +      I++  G + F+KG  P   R
Sbjct: 328 YSSTINCF----ATIFKEEGLKTFWKGATPRLGR 357

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 13/171 (7%)

Query: 63  GFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDST------RFKGPLDCVYKTFTQQGIRG 115
           G V+G+ +G+ ++ V   PF+ IK  L   + +         KG +    K  + QG  G
Sbjct: 189 GVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSG 248

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCI--ISGVMAGWSVS 173
            Y G  P  +      +V LGC +  + L++ Y    ++K PLS  +  I G  +G    
Sbjct: 249 LYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDK-PLSSGLTFIVGAFSGIVTV 307

Query: 174 FIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           +   P++  K ++Q        +Y+  ++    ++   G++  +KG T  L
Sbjct: 308 YTTMPIDTVKTRMQ---SLNAGQYSSTINCFATIFKEEGLKTFWKGATPRL 355

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D    P  +  S  + F+ G FSGI       P DT+K R+Q S ++ ++   ++C    
Sbjct: 280 DYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQ-SLNAGQYSSTINCFATI 338

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVM 134
           F ++G++ F+ G TP L   IL   ++
Sbjct: 339 FKEEGLKTFWKGATPRLGRLILSGGIV 365

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 119/282 (42%), Gaps = 38/282 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGPLDCVYKTFTQQGIRGF 116
            + G+ + IAK     P + +K+ +Q  ++        TR+KG LDC  +T T +GI  F
Sbjct: 18  LMGGVSAAIAKTGAA-PIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP----LSGCIISGVMAGWSV 172
           + G T  ++ +    ++       ++  +K  + Y+ E+       +G + SG  AG   
Sbjct: 77  WRGNTANVLRYFPTQALNFA----FKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLS 132

Query: 173 SFIAAPVELAKAKLQVQYDAKTTKYT------GPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
                 ++ A+ +L    DA+ +K T      G +DV KK   ++G+ GLY+G   +++ 
Sbjct: 133 LLFVYSLDYARTRLAA--DARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVL- 189

Query: 227 RTNFVFWWGSYELLTRWFKE---HTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVL 283
               + + G Y  L   FK       +  + +  +           T +YP D +++ ++
Sbjct: 190 --GIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLDTVRRRMM 247

Query: 284 CND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
                  KYDG         + I +  G    FKG   +  R
Sbjct: 248 MTSGQTIKYDGALDCL----RKIVQKEGAYSLFKGCGANIFR 285

>Scas_716.29
          Length = 316

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/298 (20%), Positives = 120/298 (40%), Gaps = 32/298 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118
            V+G  SG+    V  P DT+K+RLQ     T Q  +     +  +     + G+R F+ 
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM--ILNEGGLRSFWK 83

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178
           G  P  + ++L           Y  L  +    N +   L    + G +AG + SF++ P
Sbjct: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL----VVGALAGMTSSFVSYP 139

Query: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT-NFVFWWGSY 237
            ++ + +     D   +  +      K++++  G+ G ++G T+++   T +    +G+Y
Sbjct: 140 TDVLRTRFIANQDVALSSLSHGC---KEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196

Query: 238 ELLTRWFKEHTNMSD-TAINFWXXXXXXXXXXWTTAYPSDVIKQVV-----------LCN 285
           E +  +  E++  SD T    +              YP D I++ +           + N
Sbjct: 197 ESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256

Query: 286 DKYDGTFRSWKLAA-----KDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
                 ++S+K A+      +I R  G    ++G   S  ++ P        +E V+R
Sbjct: 257 KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIK-KVYSSNG 212
           E + +S  +++G ++G     + AP++  K +LQ++        +G + ++K  + +  G
Sbjct: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77

Query: 213 VRGLYKG-LTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTT 271
           +R  +KG +  T+++       + SY      F E ++M+    +            +  
Sbjct: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSF-V 136

Query: 272 AYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSF 319
           +YP+DV++   + N   D    S     K+IW   G  GFF+G   S 
Sbjct: 137 SYPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 90/210 (42%), Gaps = 27/210 (12%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIR 114
           S+   ++   V G  +G+  + V +P D ++ R   +QD         C  + +  +GI 
Sbjct: 114 SDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIP 172

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNE--EKLPLSGCIISGVMAGWSV 172
           GF+ G T  +    L  S++ G   + ++   +Y   ++    L  S   ISGV +    
Sbjct: 173 GFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTS---- 228

Query: 173 SFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS----------------NGVRGL 216
             +  P++  + ++QV+ ++   ++     ++ ++Y S                 G+  L
Sbjct: 229 KMVTYPLDTIRRRIQVR-NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287

Query: 217 YKGLTSTL--IFRTNFVFWWGSYELLTRWF 244
           Y+G++ +L     +  V  W +YE + R +
Sbjct: 288 YQGVSMSLCKTVPSTVVSLW-AYETVMRLY 316

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 119/281 (42%), Gaps = 37/281 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGPLDCVYKTFTQQGIRGF 116
            + G+ + +AK A   P + +K+ +Q   +         ++ G LDC  +T TQ+G+  F
Sbjct: 28  LMGGVSAAVAKTAA-SPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISF 86

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP--LSGCIISGVMAGWSVSF 174
           + G T  ++ +    ++        + +   + +  EE      +G + SG  AG     
Sbjct: 87  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGAAGALSLL 143

Query: 175 IAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSNGVRGLYKG----LTSTL 224
               ++ A+ +L    D+K++K      + G +DV KK   S+GV GLY+G    +   +
Sbjct: 144 FVYSLDYARTRLAA--DSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIV 201

Query: 225 IFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLC 284
           ++R     ++G Y+ L       + +  + +  +           T +YP D +++ ++ 
Sbjct: 202 VYRG---LYFGMYDSLKPLLLTGS-LEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMM 257

Query: 285 ND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
                 KYDG F       + I    G    FKG   + LR
Sbjct: 258 TSGQAVKYDGAFDCL----RKIVAAEGVGSLFKGCGANILR 294

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 124/300 (41%), Gaps = 40/300 (13%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQ 111
           PP +  + +++   +G F+GI +++V  P D IK R+Q+S      +G +  + K  T +
Sbjct: 11  PPCAPLHHQLL---AGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAE 67

Query: 112 GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL----------PLSGC 161
           G           L  W  + SV+LG    + +    Y  +++ KL          P+   
Sbjct: 68  G----------SLALWKGVQSVILGAGPAHAVYFATY-EFSKSKLIDPQDMHTHQPIKTA 116

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
            ISG+ A      +  P ++ K ++Q+  + + + +     V K +Y   G    Y    
Sbjct: 117 -ISGMAATTVADALMNPFDVIKQRMQL--NTRESVW----HVTKNIYHKEGFAAFYYSYP 169

Query: 222 STLIFRTNF-VFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQ 280
           +TL+    F  F +  YE  T+ F   +N  +  I+              T  P D IK 
Sbjct: 170 TTLVMNIPFAAFNFAIYESATK-FMNPSNEYNPFIHCISGGLSGATCAAITT-PLDCIKT 227

Query: 281 VV------LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           V+        +++      +++ AA  I++  G++GF +G  P  + + P        +E
Sbjct: 228 VLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

>Scas_328.1
          Length = 227

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 74/164 (45%), Gaps = 19/164 (11%)

Query: 68  MFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGW 127
           +F  + KN +G    +IK     S    +F G LD   KT    G+ G Y GF P +VG 
Sbjct: 55  LFLRLCKNEIGSDAKSIK-----SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGI 109

Query: 128 ILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA----PVELAK 183
           ++   +  G   + + +L    + N          +   + GW+V+  A+    P++  +
Sbjct: 110 MVYRGLYFGLYDSLKPVLLTGSFENA--------FLPSFLLGWAVTISASTTSYPLDTVR 161

Query: 184 AKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR 227
            ++ +    +  KY G +D  +++ S  GV  L+KG  +  IFR
Sbjct: 162 RRMMMT-SGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGAN-IFR 203

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 121/322 (37%), Gaps = 67/322 (20%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTS--QDSTRFKGPLDCVYKTFT------------- 109
           +SG  +G     +  P D  K RLQ    Q +     P+  V  TF              
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 110 ---QQGIRGFYLGFTPPLVG----WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCI 162
               + IRG Y G  P ++G    W++  SV   C  +Y     +Y + N E L  S   
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSY----PRY-FNNSEFLSHS--- 219

Query: 163 ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT---TKYTGPVDVIKKVYSSNGVRGLYKG 219
           +S + AG   + +  P+ + K +L +Q        T Y   +D   K+Y   G++  Y G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 220 LTSTLIFRTNFVFWWGSYELLTRWF---------KEHTNMSDT-------AINFW----- 258
           L  +L    +    +  YE L +           +E  N++         + NF      
Sbjct: 280 LIPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLI 339

Query: 259 XXXXXXXXXXWTTAYPSDVIK-QVVLCNDKYDGTFRSWKLAAKDIWRT----RGYRGFFK 313
                      T  YP ++++ ++ L +D         K + K I RT     G RGF+ 
Sbjct: 340 VASCGSKMIASTLTYPHEILRTRLQLKSD--------MKPSIKSIIRTTYAKEGIRGFYS 391

Query: 314 GFVPSFLRSFPXXXXXXXXFEF 335
           GF+ +  R+ P        FE+
Sbjct: 392 GFLTNMFRTVPASAITLVSFEY 413

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 88/213 (41%), Gaps = 43/213 (20%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRL--QTSQD---STRFKGPLDCVYKTFTQQGIRGFYLG 119
           +S + +G     + +P   +K RL  Q+ ++    T +K  LD   K +  +GI+ FY G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 120 FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY--NEEKLPLSG----------------C 161
             P L G +L  ++        + +L  Y     N+E + ++G                 
Sbjct: 280 LIPSLFG-LLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
           I++   +    S +  P E+ + +LQ++ D K +  +    +I+  Y+  G+RG Y G  
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKS----IIRTTYAKEGIRGFYSGFL 394

Query: 222 STLI---------------FRTNFVFWWGSYEL 239
           + +                FR +F  W  S E+
Sbjct: 395 TNMFRTVPASAITLVSFEYFRKHFKLWNDSIEV 427

>Kwal_27.12481
          Length = 304

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 69/157 (43%), Gaps = 19/157 (12%)

Query: 79  HPFDTIKVRLQTSQDSTR------FKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDS 132
           +  D  + RL       +      F G +D   KT    GI G Y GF P +VG ++   
Sbjct: 133 YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRG 192

Query: 133 VMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA----PVELAKAKLQV 188
           +  G   + + LL            L G  ++  + GW+V+  A+    P++  + ++ +
Sbjct: 193 LYFGGYDSLKPLLLTG--------SLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 189 QYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
               +  KY G  D  +K+ ++ G++ L+KG  + ++
Sbjct: 245 T-SGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANIL 280

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 85/191 (44%), Gaps = 13/191 (6%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKGPLDCV 104
            +   ++  S++  F++G  +      V +PF+ +K R+Q     ++ +   ++ P   +
Sbjct: 13  HEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQAL 72

Query: 105 YKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC--- 161
              F  +G++G   G     V  I ++   LG     R +L K  +   +   L      
Sbjct: 73  GVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVN 132

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVRGLY 217
           + +G  +G   + + +P+ L K ++Q   +A    + T YT   + +  ++   GV GL+
Sbjct: 133 VTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLF 192

Query: 218 KGLTSTLIFRT 228
           +G+ +  I RT
Sbjct: 193 RGVDAA-ILRT 202

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 82/205 (40%), Gaps = 21/205 (10%)

Query: 51  QPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDCV 104
           +  P +  +  +   +G  SGI    VG P   +K R+Q+  ++      T +    + +
Sbjct: 120 ESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGL 179

Query: 105 YKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYYNEEKLPLSGCII 163
              F ++G+ G + G    ++      SV L   +  +  LL+  +      L L    +
Sbjct: 180 ATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHL----L 235

Query: 164 SGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTST 223
           S  + G  V  +  P ++   ++   Y+ K   Y GP+D + K     G+  LYKG  + 
Sbjct: 236 SSTVTGLGVGIVMNPWDVVLTRV---YNQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQ 292

Query: 224 LIFRTNFVFWWGSYELLTRWFKEHT 248
           L       F    + +L   F E T
Sbjct: 293 L-------FRIAPHTILCLTFMEQT 310

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 120/311 (38%), Gaps = 57/311 (18%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS-TRFKGPLDCVYKT----FTQQGIRGFY 117
           G   G+    AK  +  P D IK+  QTS    +++ G L  +Y+     +   GIRGF+
Sbjct: 22  GLAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G +  L+      +V        R +L     Y      L+    SG +AG    FI  
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLA----SGSLAGLCSVFITY 136

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGL----------------YKGLT 221
           P++L + +L    + K  K     D++K +Y      GL                Y+G  
Sbjct: 137 PLDLTRVRLAYVTEHKRVKLR---DIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYV 193

Query: 222 STL-------------------IFRTNFVFWWGSYELLTRWFKEHTNM-SDTAINFWXXX 261
            T+                   I +++ +  +   +L ++   E   +   T +  W   
Sbjct: 194 PTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAEL 253

Query: 262 XX---XXXXXWTTAYPSDVIK---QVVLCNDK--YDGTFRSWKLAAKDIWRTRGYRGFFK 313
                      T AYP ++I+   QV   + +  YD  F+S    A+ I++ +G+RGFF 
Sbjct: 254 VAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFV 313

Query: 314 GFVPSFLRSFP 324
           G    +++  P
Sbjct: 314 GLSIGYIKVTP 324

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 79/213 (37%), Gaps = 50/213 (23%)

Query: 53  PPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ--TSQDSTRFKGPLDCVYKTFTQ 110
           P  E  S      SG  +G+    + +P D  +VRL   T     + +  +  +Y     
Sbjct: 110 PSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPAS 169

Query: 111 QGIR-------------GFYLGFTPPLVGWI--------------------LMDSVMLGC 137
           +G+               FY G+ P ++G I                    LM    +  
Sbjct: 170 EGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQ 229

Query: 138 LHNYRMLLKKYVYYNEEKLPLS--GCIISGVMAGWSVSFIAAPVELAKAKLQVQ------ 189
           L +   L +K +    +K PL     +++G ++G      A P+E+ + +LQV       
Sbjct: 230 LSSQEELERKKL---RQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRK 286

Query: 190 -YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
            YD    K+     + + +Y   G RG + GL+
Sbjct: 287 MYD---HKFQSISSIARIIYQEKGWRGFFVGLS 316

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTR------FKGPLDCVYKTFTQQGIRGFY 117
            V+G  SGI      +P + I+ RLQ S  S R      F+         + ++G RGF+
Sbjct: 253 LVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFF 312

Query: 118 LGFTPPLVGWILMDSVMLGC 137
           +G +   +G+I + + M+ C
Sbjct: 313 VGLS---IGYIKV-TPMVAC 328

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 113/298 (37%), Gaps = 41/298 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS--TRFKGP--LDCVYKTFTQQGIRGFYLG 119
            ++G  +G+ +    HP DTIKVR+Q  +++  +  K P  +    + +  +G   FY G
Sbjct: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73

Query: 120 FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWS-VSFIAAP 178
               ++G     ++       YR LL         K+      I+GV AG +    +  P
Sbjct: 74  LGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVSTGNTFIAGVGAGITEAVVVVNP 130

Query: 179 VELAKAKLQVQY---DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR-----TNF 230
           +E+ K +LQ Q+        KY   V     +    G   LY+G++ T   +      NF
Sbjct: 131 MEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190

Query: 231 VFW---------WGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQV 281
             +         + + E+L  W      +   AI  +            +  P D IK  
Sbjct: 191 TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPF------------SNAPLDTIK-T 237

Query: 282 VLCNDKYDGTFRSWK---LAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
            L  DK        K   +  K + +  G+R  +KG  P  +R  P        +EF+
Sbjct: 238 RLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

>Scas_578.3*
          Length = 524

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 79/180 (43%), Gaps = 16/180 (8%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVYKTFTQQGIRG 115
           S++  +V+G  +G+      +P DT+K R+Q +      KG    +    + + + GIR 
Sbjct: 325 SKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRV 384

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--PLSGCIIS-------GV 166
           FY G     +G     ++ LG    +  L K Y+    +KL  P    ++S       G 
Sbjct: 385 FYRGVLLGALGIFPYAALDLGT---FSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGA 441

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            +G   +    P+ L + +LQ Q   A    YTG  DV  +     GV G YKGL  TL+
Sbjct: 442 FSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLV 501

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/299 (20%), Positives = 113/299 (37%), Gaps = 43/299 (14%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRL--QTSQDST----------------RFKGPL-DCV 104
           F++G  SG+       P D IKV L  +T   ST                + + P+   +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 105 YKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKY----VYYNEEKLP--L 158
              + Q G+R FY+G    +       S+  G     + L+       +  +  KL   +
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYV 331

Query: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQ-VQYDAKTTKYTGPVDVIKKVYSSNGVRGLY 217
           +G I +GVMA  S+     P++  K ++Q    +         +   K++Y   G+R  Y
Sbjct: 332 AGGI-AGVMAQISIY----PIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFY 386

Query: 218 KG-LTSTLIFRTNFVFWWGSYELLTRWF------KEHTNMSDTAINFWXXX---XXXXXX 267
           +G L   L          G++  L +W+      K +    D  +++             
Sbjct: 387 RGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTV 446

Query: 268 XWTTAYPSDVIKQVVLCNDKYDG--TFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             T  YP ++++  +     Y    T+  ++       +  G  GF+KG VP+ ++  P
Sbjct: 447 GATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCP 505

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 3/77 (3%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ---TSQDSTRFKGPLDCVYKTF 108
           P      S ++    G FSG       +P + ++ RLQ   T      + G  D   +T 
Sbjct: 425 PEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTL 484

Query: 109 TQQGIRGFYLGFTPPLV 125
            ++G+ GFY G  P LV
Sbjct: 485 KREGVPGFYKGLVPTLV 501

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 69/157 (43%), Gaps = 19/157 (12%)

Query: 79  HPFDTIKVRLQTSQDSTR------FKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDS 132
           +  D  + RL     S +      F G +D   KT    G+ G Y GF P +VG ++   
Sbjct: 133 YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRG 192

Query: 133 VMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA----PVELAKAKLQV 188
           +  G   + + LL            L    ++  + GW+V+  A+    P++  + ++ +
Sbjct: 193 LYFGLYDSLKPLLLTG--------SLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 189 QYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
               +  KY G  D  +K+ ++ G++ L+KG  + ++
Sbjct: 245 T-SGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANIL 280

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 118/281 (41%), Gaps = 36/281 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGPLDCVYKTFTQQGIRGF 116
           F+ G  S         P + +K+ +Q   +         R+ G ++C  +T   +G+  F
Sbjct: 14  FLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASF 73

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP--LSGCIISGVMAGWSVSF 174
           + G T  ++ +    ++        + +   + +  EE      +G + SG +AG     
Sbjct: 74  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGLAGGLSLL 130

Query: 175 IAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSNGVRGLYKG----LTSTL 224
               ++ A+ +L    D+K+ K      + G VDV KK  +S+GV GLY+G    +   +
Sbjct: 131 FVYSLDYARTRLAA--DSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIV 188

Query: 225 IFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLC 284
           ++R     ++G Y+ L       + + ++ +  +           T +YP D +++ ++ 
Sbjct: 189 VYRG---LYFGLYDSLKPLLLTGS-LENSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 285 ND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
                 KYDG F ++    + I    G +  FKG   + LR
Sbjct: 245 TSGQAVKYDGAFDAF----RKIVAAEGIKSLFKGCGANILR 281

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 110/274 (40%), Gaps = 26/274 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLGFTP 122
           FV+G  +G  + ++ +PF+  K RLQ    S++  + PL  +Y T   QG+   Y+G   
Sbjct: 14  FVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYVGCPA 73

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG--CIISGVMAGWSVSFIAA-PV 179
            +VG     +         R LLK     +++   LSG   +++G+ AG   S +A  P 
Sbjct: 74  FIVGNTAKAATRFLGYDTIRNLLK-----DKKTGELSGPRGVLAGLGAGLLESVVAVTPF 128

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS----NGVRGLYKG-LTSTLIFRTNFVFWW 234
           E  K  L     +   KY      + + Y S     G RGLY G L  ++    N     
Sbjct: 129 EAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVRL 188

Query: 235 GSYELLTRWFKEHTNMSD-----TAINFWXXXXXXXXXXWTTAYPSDVIKQVV--LCNDK 287
           G Y  +    +++T         + + F           + T  P D +K  +  L   K
Sbjct: 189 GCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYAT-MPIDTVKTRMQSLTASK 247

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           Y  T   +      I++  G + F+KG  P   R
Sbjct: 248 YSSTLNCF----TTIYKEEGLKTFWKGATPRLGR 277

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 14/181 (7%)

Query: 63  GFVSGMFSGIAKNAVG-HPFDTIKVRLQTSQDSTR--FKGPLDCVYKTFTQ----QGIRG 115
           G ++G+ +G+ ++ V   PF+ IK  L   + S R  ++     + + +      +G RG
Sbjct: 109 GVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRG 168

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCI-ISGVMAGWSVSF 174
            Y G  P  +      +V LGC +  ++L++ Y    ++K   SG   I G  +G    +
Sbjct: 169 LYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVY 228

Query: 175 IAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT---STLIFRTNFV 231
              P++  K ++Q       +KY+  ++    +Y   G++  +KG T     LI     V
Sbjct: 229 ATMPIDTVKTRMQ---SLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIV 285

Query: 232 F 232
           F
Sbjct: 286 F 286

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107
           D    P  +  +  + F+ G FSG+       P DT+K R+Q S  ++++   L+C    
Sbjct: 200 DYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQ-SLTASKYSSTLNCFTTI 258

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLL 145
           + ++G++ F+ G TP L   IL   ++     N  + L
Sbjct: 259 YKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLLYL 296

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 68/177 (38%), Gaps = 8/177 (4%)

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSN 211
           + +K+  +   ++G +AG   + I  P E AK +LQ+  D  +     P+ +I     + 
Sbjct: 4   DSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQL-IDKSSKASRNPLVLIYNTAKTQ 62

Query: 212 GVRGLYKGLTSTLIFRT-NFVFWWGSYELLTRWFKE-HTNMSDTAINFWXXXXXXXXXXW 269
           GV  +Y G  + ++  T      +  Y+ +    K+  T                     
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLLESV 122

Query: 270 TTAYPSDVIKQVVLCND-----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
               P + IK V++ +      KY    RS       + +  G+RG + G +P  +R
Sbjct: 123 VAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMR 179

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 105/273 (38%), Gaps = 33/273 (12%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQ----QGIRGFYLGFTP 122
           G F GI      HP D  KVRLQT+        P   + +  +Q    +G+ G Y G T 
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTA------PAPKPTLVRMASQILRNEGVPGLYSGLTA 68

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYV---YYNEEKLPLSGCIISGVMAGWSVSFIAAPV 179
            ++      +   G    Y  + ++Y+   Y N     L   + SG + G     I  P 
Sbjct: 69  AILRQCTYTTARFGV---YDFVKERYIPKEYLNSMLYLLPCSMFSGAVGG----LIGNPA 121

Query: 180 ELAKAKLQVQYDAKTT---KYTGPVDVIKKVYSSNGVRGLYKG----LTSTLIFRTNFVF 232
           ++   ++Q            Y    D + K+ S  GV  L+ G    L   ++  ++ V 
Sbjct: 122 DVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVV 181

Query: 233 WWGSYELLTRWFKEHTNMS-DTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGT 291
              +Y++   +  ++  +  D     +           T   P+DVIK  V+   K+  +
Sbjct: 182 ---TYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKH--S 236

Query: 292 FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             S      D  +  G    F+G++PSF+R  P
Sbjct: 237 HDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGP 269

>Kwal_23.3042
          Length = 542

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 10/176 (5%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVYKTFTQQGIRG 115
           SR   +++G   G+      +P DT+K R+Q +  +T  KG    +      + + G+R 
Sbjct: 343 SRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRI 402

Query: 116 FYLGFTPPLVG---WILMDSVMLGCLHN-YRMLLKKYVYYNEEKLPLSG--CIISGVMAG 169
           FY G T  ++G   +  MD      L   Y     +     E+++ +S    ++ G  +G
Sbjct: 403 FYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSG 462

Query: 170 WSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
              +    PV L + +LQ Q   A   +Y G  DV+ K     G +GL+KGL   L
Sbjct: 463 TVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNL 518

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 118/316 (37%), Gaps = 47/316 (14%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDSTRFKGPLDC 103
           F++G  SG+       PFD IKV L                      + D ++ K PL  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 104 VYKT-FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK-LPLSGC 161
              T + Q GIR FY+G     +      ++  G     + L+ +     +   L     
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQ-VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGL 220
            ++G + G        P++  K ++Q    + ++      +   K +Y   G+R  Y+G+
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGI 407

Query: 221 TSTLIFRTNFVFW-WGSYELLTRWF-----------KEHTNMSDTAINFWXXXXXXXXXX 268
           T  ++    +     G++  L +W+           ++   MS+  +             
Sbjct: 408 TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFV--LLMGAFSGTVG 465

Query: 269 WTTAYPSDVIKQVVLCN------DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRS 322
            T  YP ++++  +          +Y+G FR   L  K + R  GY+G FKG VP+  + 
Sbjct: 466 ATAVYPVNLLRTRLQAQGTFAHPHRYNG-FRDVLL--KTVQR-EGYQGLFKGLVPNLAKV 521

Query: 323 FPXXXXXXXXFEFVLR 338
            P        +E + R
Sbjct: 522 CPAVSISYLCYENLKR 537

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ---TSQDSTRFKGPLDCVYKTF 108
           P      S +   + G FSG       +P + ++ RLQ   T     R+ G  D + KT 
Sbjct: 443 PEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTV 502

Query: 109 TQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 146
            ++G +G + G  P L       S+   C  N +  +K
Sbjct: 503 QREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKRGMK 540

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 109/283 (38%), Gaps = 24/283 (8%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTR--FKGPLDCVYKTFTQQGIRG------F 116
           +SG+ +G     V HP D +KVRLQ S  S +    GP   + +        G       
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY----------NEEKLPLSGCIISGV 166
           Y G +  L G  +   V  G     + L+ K V            N+ K+     + +G 
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226
            +G   + +  P+ + K ++          YT   + ++++  ++G +GL+KGL   L  
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFG 193

Query: 227 RTNFVFWWGSYELLT-----RWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQV 281
            +    ++  Y+ L      R  +   ++  T +              T  YP  ++K  
Sbjct: 194 VSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSN 253

Query: 282 VLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           +      +  FR + L  K I    G+ G +KG   + +R+ P
Sbjct: 254 LQSFRANEQKFRLFPL-IKLIIANDGFVGLYKGLSANLVRAIP 295

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 27/187 (14%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRG- 215
           PL   +ISG+ AG   + +  P++L K +LQ+   +    + GP  VIK++  S+   G 
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGR 67

Query: 216 -----LYKGLTSTLIFRTNFVFWWGSY--------ELLTRWFKE--HTNM----SDTAIN 256
                LY+GL+  L         WG Y        EL+ +   +   T +    +D  +N
Sbjct: 68  SVTNELYRGLSINLFGNA---IAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMN 124

Query: 257 FWXXXXXXXXXXWTTAYPSD---VIKQVVLCNDK-YDGTFRSWKLAAKDIWRTRGYRGFF 312
                         TA  ++   VIK  ++   K   G + S     + + RT G++G +
Sbjct: 125 SLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLW 184

Query: 313 KGFVPSF 319
           KG VP+ 
Sbjct: 185 KGLVPAL 191

>Scas_667.4
          Length = 308

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/280 (20%), Positives = 119/280 (42%), Gaps = 35/280 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-------STRFKGPLDCVYKTFTQQGIRGF 116
            + G+ + +AK A   P + +K+ +Q   +        +++KG ++C  +T   +GI  F
Sbjct: 18  LMGGVSAAVAKTAA-SPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAF 76

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLP--LSGCIISGVMAGWSVSF 174
           + G T  ++ +    ++        + +   + +  EE      +G + SG  AG     
Sbjct: 77  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYGKWFAGNLASGGAAGGLSLL 133

Query: 175 IAAPVELAKAKLQVQYDAKTTK------YTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT 228
               ++ A+ +L    DAK++K      Y G +DV K+  +++G+ GLY+G   +++   
Sbjct: 134 FVYSLDYARTRLAA--DAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVV--- 188

Query: 229 NFVFWWGSYELLTRWFKEHT---NMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCN 285
             + + G Y  L    K      ++  + +  +           T +YP D +++ ++  
Sbjct: 189 GIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVTTGASTASYPLDTVRRRMMMT 248

Query: 286 D----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
                KYDG F  +    + +    G    FKG   + LR
Sbjct: 249 SGQAVKYDGAFDCF----RKVVAAEGVSSLFKGCGANILR 284

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 107/252 (42%), Gaps = 24/252 (9%)

Query: 76  AVGHPFDTIKVRLQTSQDS----TRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMD 131
           A+  P  T+  R+Q S+      TR K  L+ V + + ++G+ GFY G    + G   M 
Sbjct: 32  ALTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYG---MA 88

Query: 132 SVMLGCLHNYRMLLKKYV-YYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQY 190
           +  L   + Y +  +  +      +L  S  I+S  +AG   +  + P+ +   ++ V  
Sbjct: 89  ANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTV-- 146

Query: 191 DAKTTKYTGPV--DVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELLTRWFKEHT 248
            AK+ + T  V  D+++K    +GV  L+ GL   L+  +N +  +  +E L     + +
Sbjct: 147 -AKSEQSTLAVLLDIVRK----DGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLKWS 201

Query: 249 NMSDTAINFWXXXXXXXXXXWTTA--YPSDVIK-QVVLCNDKYDGTFRS--WKLAAKDIW 303
             SD  +  W            T   YP   +K ++ L   K D   +   W L   DI 
Sbjct: 202 G-SDVLLPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMV-DIV 259

Query: 304 RTRGYRGFFKGF 315
           +  G +G + G 
Sbjct: 260 KKEGIQGLYHGI 271

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 77/186 (41%), Gaps = 32/186 (17%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DSTRFKGPLDCVYK---TFTQQGIRGFYLGF 120
           V+G  + IA N    P   +  R+  ++ + +     LD V K   T    G+R   +  
Sbjct: 125 VAGSMTAIASN----PIWVVNTRMTVAKSEQSTLAVLLDIVRKDGVTALFNGLRPALMLV 180

Query: 121 TPPLVGWILMDSVMLGCLH--NYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178
           + P++ + + + +    L      +LL  + +       L G +      G +  +I   
Sbjct: 181 SNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAF-------LLGAVGKLAATGSTYPYITLK 233

Query: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG----LTSTLI-------FR 227
             +  AK +   D + + ++  VD++KK     G++GLY G    LT +++       F+
Sbjct: 234 TRMHLAKGKEDADTQQSMWSLMVDIVKK----EGIQGLYHGIGVKLTQSILTAAFLFYFK 289

Query: 228 TNFVFW 233
             F+ W
Sbjct: 290 EGFILW 295

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 119/288 (41%), Gaps = 40/288 (13%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQT------SQDST--------RFKGPLDCVYKTFTQ 110
           ++G  +    N   +P D  K  +Q+      S+DS         R+K  +DC+   F +
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 111 QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--------PLSGCI 162
           +GI G Y G T   V   + + V       Y  + K Y+ +    L        P++   
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFW---YTFIRKSYMKHKLLGLQSLKNRDGPITPST 124

Query: 163 ISGVMAGWSVSFIA----APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNG--VRGL 216
           I  ++ G + + I+    +P+ +   + Q  + A++ K+T   +VIK +Y  N   +   
Sbjct: 125 IEELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFT---NVIKDIYRENNGDITAF 181

Query: 217 YKGLTSTLIFRTNFVFWWGSYELLTR-WFKEHTN--MSDTAINFWXXXXXXXXXXWTTAY 273
           +KGL + L    N    + S++ L   +F +H+N   S +A+  +               
Sbjct: 182 WKGLRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQ 241

Query: 274 PSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           P  V K ++         F +++ A   +++  G +  +KG +P   +
Sbjct: 242 PLIVAKAML---QSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>Scas_379.2
          Length = 301

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 123/304 (40%), Gaps = 40/304 (13%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGPLDCVYK 106
           D +  P S   S  +  ++G F+GI +++V  P D +K R+Q TS  ST     L  + K
Sbjct: 13  DYEALPDSAPLSHQL--LAGAFAGIMEHSVMFPIDALKTRIQSTSAKST--SNMLSQMAK 68

Query: 107 TFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY-----YNEEKL----P 157
             T +G           L  W  + SV+LG    + +    Y Y      +E+ +    P
Sbjct: 69  ISTAEG----------SLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQP 118

Query: 158 LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLY 217
           L    +SG +A  +   +  P +  K ++Q+  +  TT +    +V K++Y + G    Y
Sbjct: 119 LKTA-LSGTVATIAADALMNPFDTLKQRMQL--NTNTTVW----NVTKQIYKNEGFSAFY 171

Query: 218 KGLTSTLIFRTNF-VFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSD 276
               +TL     F  F +  YE  T++F    + +                  TT  P D
Sbjct: 172 YSYPTTLAMNIPFAAFNFMIYESATKFFNPTNDYNPLVHCLSGGLSGATCAAITT--PLD 229

Query: 277 VIKQVVLCNDKYDGTFR------SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXX 330
            IK V+        + +      +++ A K I++  G +GF++G  P    + P      
Sbjct: 230 CIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAW 289

Query: 331 XXFE 334
             +E
Sbjct: 290 TAYE 293

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/192 (18%), Positives = 77/192 (40%), Gaps = 15/192 (7%)

Query: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV 213
           +  PLS  +++G  AG     +  P++  K ++Q    AK+T  +  +  + K+ ++ G 
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ-STSAKST--SNMLSQMAKISTAEGS 75

Query: 214 RGLYKGLTSTLI-FRTNFVFWWGSYELLTRWFKEHTNM-SDTAINFWXXXXXXXXXXWTT 271
             L+KG+ S ++        ++ +YE   ++  +  +M +   +                
Sbjct: 76  LALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADAL 135

Query: 272 AYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXX 331
             P D +KQ +  N         W +  K I++  G+  F+  +  +   + P       
Sbjct: 136 MNPFDTLKQRMQLNTNT----TVWNV-TKQIYKNEGFSAFYYSYPTTLAMNIP-----FA 185

Query: 332 XFEFVLRTSGAK 343
            F F++  S  K
Sbjct: 186 AFNFMIYESATK 197

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 124/308 (40%), Gaps = 47/308 (15%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLG- 119
           + F++G  +G     V  PF+ +K+ LQ    +T + KG  D + + + ++ I+G + G 
Sbjct: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84

Query: 120 -------FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNE-----EKLPLSGCIISGVM 167
                  F    V +++ +    GC        KK++++ +     E+L     + SG +
Sbjct: 85  GLNCIRVFPYSAVQFVVFE----GC--------KKHIFHVDTKGKGEQLNNWQRLFSGAL 132

Query: 168 AGWSVSFIAAPVELAKAKLQVQY----------DAKTTKYTGPVDVIKKVYSSN-GVRGL 216
            G        P++L + +L VQ            +   K  G   ++ K Y+   G+ GL
Sbjct: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192

Query: 217 YKGLTSTLIFRTNFV-FWWGSYELLTRWFKEHTN----MSDTAINFWXXXXXXXXXXWTT 271
           Y+G+  T +    +V   +  YE L  +     N    M D+                T 
Sbjct: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL-SMGAISGGVAQTI 251

Query: 272 AYPSDVIKQ----VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXX 327
            YP D++++    + +  ++    + S   A   I +T G++G++KG   +  +  P   
Sbjct: 252 TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTA 311

Query: 328 XXXXXFEF 335
                +E 
Sbjct: 312 VSWLVYEL 319

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 81/198 (40%), Gaps = 30/198 (15%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ--TSQDSTRFKGPLDCVYKTFTQQGIR------- 114
            +SG  +G+    V +P D ++VRL   T +   + +  + C+Y     + +R       
Sbjct: 122 LLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQW 181

Query: 115 -----GFYLGFTPPLVGWI------------LMDSVMLGCLHNYRMLLKKYVYYNEEKLP 157
                 FY G+TP ++G I              D      L  Y +L        +  +P
Sbjct: 182 FAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVP 241

Query: 158 LS--GCIISGVMAGWSVSFIAAPVELAKAKLQVQY--DAKTTKYTGPVDVIKKVYSSNGV 213
           L     +++G +AG +    A P E+ + +LQV    D     + G  ++ K +Y+  G 
Sbjct: 242 LKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGW 301

Query: 214 RGLYKGLTSTLIFRTNFV 231
           RG + GL+   I  T  V
Sbjct: 302 RGFFVGLSIGYIKVTPMV 319

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 14/100 (14%)

Query: 48  DIQQPPPSEAYSRIM------GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQ--DSTR--F 97
            +  P  S AY R +        V+G  +G+A     +PF+ I+ RLQ S   D TR  F
Sbjct: 226 SVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHF 285

Query: 98  KGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGC 137
            G  +     +T+ G RGF++G +   +G+I + + M+ C
Sbjct: 286 VGINEIAKIIYTEGGWRGFFVGLS---IGYIKV-TPMVAC 321

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 110/300 (36%), Gaps = 43/300 (14%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS-TRFKGPLDCVYKT----FTQQGIRGFY 117
           G   G+    AK  V  P D IK+  QTS     +F G +  + +         G RGF+
Sbjct: 23  GLAGGIAGSCAKTLVA-PLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G +  L+      ++        R ++     +      L    +SG +AG    F+  
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL----LSGSLAGLCSVFVTY 137

Query: 178 PVELAKAKLQV---QYDAKTTKYTG------PVDVIKKVYSSNGV---RGLYKGLTSTLI 225
           P++L + +L     ++DAK  K         P + ++K Y           Y+G T T+I
Sbjct: 138 PLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVI 197

Query: 226 FRTNFV-FWWGSYELLTRWFKE------------HTNMSDTAINF--WXXXXX---XXXX 267
               +    + +++L    F+              ++  D  +    W            
Sbjct: 198 GMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMA 257

Query: 268 XWTTAYPSDVIK---QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             T AYP ++I+   QV    D     F      AK I+   G+RGFF G    +++  P
Sbjct: 258 SQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTP 317

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 110/281 (39%), Gaps = 22/281 (7%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
            ++G F+GI +++V  P D +K R+Q++   S   K  L  +    T +G    + G   
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQS 96

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--PLSGCIISGVMAGWSVSFIAAPVE 180
            ++G     +V  G    Y    K  +  ++ +   P     ISG  A  +   +  P +
Sbjct: 97  VILGAGPAHAVYFG---TYEFCKKNLIDSSDTQTHHPFKTA-ISGACATTASDALMNPFD 152

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGSYEL 239
             K ++Q+   A   + T      K++Y S G+   Y    +TL+    F  F +  YE 
Sbjct: 153 TIKQRIQLNTSASVWQTT------KQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYES 206

Query: 240 LTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR------ 293
            T++       +                  TT  P D IK V+        +        
Sbjct: 207 STKFLNPSNEYNPLIHCLCGSISGSTCAAITT--PLDCIKTVLQIRGSQTVSLEIMRKAD 264

Query: 294 SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           ++  AA  I++  G++GF++G+ P  + + P        +E
Sbjct: 265 TFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 77/192 (40%), Gaps = 19/192 (9%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGL 216
           PL   +I+G  AG     +  P++  K ++Q   +AK+      +  I  + +S G   L
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTRIQ-SANAKSLSAKNMLSQISHISTSEGTLAL 90

Query: 217 YKGLTSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTA--- 272
           +KG+ S ++        ++G+YE      K   + SDT  +             T +   
Sbjct: 91  WKGVQSVILGAGPAHAVYFGTYEFCK---KNLIDSSDTQTHHPFKTAISGACATTASDAL 147

Query: 273 -YPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXX 331
             P D IKQ +  N     +   W+   K I+++ G   F+  +  + + + P       
Sbjct: 148 MNPFDTIKQRIQLNT----SASVWQ-TTKQIYQSEGLAAFYYSYPTTLVMNIP-----FA 197

Query: 332 XFEFVLRTSGAK 343
            F FV+  S  K
Sbjct: 198 AFNFVIYESSTK 209

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 13/83 (15%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST----------RFKGPLDC 103
           PS  Y+ ++  + G  SG    A+  P D IK  LQ     T           F      
Sbjct: 213 PSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASA 272

Query: 104 VYKTFTQQGIRGFYLGFTPPLVG 126
           +Y+ +   G +GF+ G+ P +V 
Sbjct: 273 IYQVY---GWKGFWRGWKPRIVA 292

>Kwal_55.21338
          Length = 323

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 75/168 (44%), Gaps = 11/168 (6%)

Query: 79  HPFDTIKVRLQTSQDSTRFKGPL-DCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGC 137
           +P   +  +LQT QD+   K  L D +   + + G  GF+ G    L G  L + V   C
Sbjct: 41  YPLIVVTTKLQT-QDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYC 99

Query: 138 LH-NYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK 196
              + R +L+     + ++L  +  ++ G +AG   +  A P+ +A  ++ VQ   +   
Sbjct: 100 YEASSRCVLRAR---HTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDR--- 153

Query: 197 YTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELLTRWF 244
             G +  I  +    G+ GL+KGL   LI   N +  +  YE L  W 
Sbjct: 154 --GTLSTIFDIVKDEGISGLFKGLNPALILVINPIIQYTVYEQLKNWI 199

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 60/147 (40%), Gaps = 12/147 (8%)

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT--NFVFWWG 235
           P+ +   KLQ Q DAK  K +   D IK +Y  +G  G + GL S L   T  NFV+++ 
Sbjct: 42  PLIVVTTKLQTQ-DAKGEKLS-LADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYY- 98

Query: 236 SYELLTRWF--KEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR 293
            YE  +R      HT    TA +             T A P  V    +       GT  
Sbjct: 99  CYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNA-TAANPLWVANTRMTVQKSDRGTLS 157

Query: 294 SWKLAAKDIWRTRGYRGFFKGFVPSFL 320
           +      DI +  G  G FKG  P+ +
Sbjct: 158 T----IFDIVKDEGISGLFKGLNPALI 180

>Kwal_14.2210
          Length = 315

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/293 (20%), Positives = 116/293 (39%), Gaps = 21/293 (7%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFK-GPLDCVYKTFTQQGIRGFYLGF 120
           + F +G  +G     V  PF+ +K+ LQ    +  +  G    V + + ++G+ G   G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLS-GCIISGVMAGWSVSFIAAPV 179
               +      +V       Y    K++   N + + L+   ++SG + G        P+
Sbjct: 79  GLNCIRIFPYSAVQFLV---YEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPL 135

Query: 180 ELAKAKLQVQYDAKTTKYT----------GPVDVIKKVYSSNG-VRGLYKGLTSTLIFRT 228
           +L + +L +Q       +           G  ++++K Y+  G + GLY+G+  T I   
Sbjct: 136 DLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVV 195

Query: 229 NFV-FWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIK---QVVLC 284
            +V   +  YE L  +     + +  ++              T  YP D+++   QV+  
Sbjct: 196 PYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAM 255

Query: 285 NDKYDG-TFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
                G  ++S   A   I RT G++G++KG   +  +  P        +E V
Sbjct: 256 GQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETV 308

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 107/292 (36%), Gaps = 34/292 (11%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKG---PLDCVYKTFTQQGIRGFYLGF 120
            ++G F+GIA+++V  P D +K RLQ     +   G   P   + +  +     G     
Sbjct: 22  LMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEG----- 76

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYY---------NEEKLPLSGCIISGVMAGWS 171
              +V W  + SV+LG    + +    Y            +  K        SG  A  +
Sbjct: 77  --SMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIA 134

Query: 172 VSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF- 230
              +  P ++ K ++Q+  +          D  K++YS  G +  Y    +TL     F 
Sbjct: 135 ADALMNPFDVIKQRIQLNTNISVW------DTAKRIYSKEGFQAFYSSYPTTLAINIPFA 188

Query: 231 VFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDG 290
            F +G Y+  TR+F      +                  TT  P D IK  +        
Sbjct: 189 AFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAGLTT--PLDCIKTALQVRGSEKV 246

Query: 291 TFR------SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
           +        ++K A + I++  G+RGF+ G  P  L + P        +EF 
Sbjct: 247 SMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFA 298

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 73/178 (41%), Gaps = 12/178 (6%)

Query: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTG-PVDVIKKVYSSNG 212
           +  PL+  +++G  AG +   +  P++  K +LQ  +   TT     P  +++++ S + 
Sbjct: 14  DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISA 73

Query: 213 VRG---LYKGLTSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXX 268
             G   L+KG+ S L+        ++ +YE++  +  +    +     F           
Sbjct: 74  QEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATI 133

Query: 269 WTTAY--PSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
              A   P DVIKQ +  N         W   AK I+   G++ F+  +  +   + P
Sbjct: 134 AADALMNPFDVIKQRIQLNTN----ISVWD-TAKRIYSKEGFQAFYSSYPTTLAINIP 186

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 18/180 (10%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVYKTFTQQGIRG 115
           S+   +++G   G+      +P DT+K R+Q +   T  KG    +    + +   G++ 
Sbjct: 314 SKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKL 373

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL---PLSGCIIS-------G 165
           FY G T  ++G     ++ LG        LKK+    + K+   P+    IS       G
Sbjct: 374 FYRGVTVGVMGIFPYAALDLGTFS----ALKKWYIARQAKMTGVPVDQVTISNFIVLPMG 429

Query: 166 VMAGWSVSFIAAPVELAKAKLQVQYD-AKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
             +G   + +  P+ L + +LQ Q   A    YTG  DV+ K     G +GL+KGL   L
Sbjct: 430 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNL 489

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 117/310 (37%), Gaps = 43/310 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRL--------------------QTSQDSTRFKGPLDC 103
           F++G  SG+       PFD IKV L                      + D ++ K PL  
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 104 VYKT-FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKY--VYYNEEKLPLSG 160
              T + Q GIR FY+G    ++      ++  G     + L+     V++  E    S 
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFS- 317

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQ-VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG 219
             I+G M G    F   P++  K ++Q    D         +   +++Y   G++  Y+G
Sbjct: 318 TYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRG 377

Query: 220 LTSTLIFRTNF-VFWWGSYELLTRWF-KEHTNMSDTAI------NF--WXXXXXXXXXXW 269
           +T  ++    +     G++  L +W+      M+   +      NF              
Sbjct: 378 VTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGA 437

Query: 270 TTAYPSDVIKQVVLCNDKY--DGTFRSWKLAAKDIWRT---RGYRGFFKGFVPSFLRSFP 324
           T  YP ++++  +     Y    T+  ++     +W+T    GY+G FKG VP+  +  P
Sbjct: 438 TVVYPINLLRTRLQAQGTYAHPHTYTGFRDV---LWKTVQREGYQGLFKGLVPNLAKVCP 494

Query: 325 XXXXXXXXFE 334
                   +E
Sbjct: 495 AVSISYLCYE 504

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 3/83 (3%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQ---TSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           G FSG     V +P + ++ RLQ   T      + G  D ++KT  ++G +G + G  P 
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 124 LVGWILMDSVMLGCLHNYRMLLK 146
           L       S+   C  N++ L+K
Sbjct: 489 LAKVCPAVSISYLCYENFKRLMK 511

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P++  +    FV G  S  A  AV  P D IK R+Q+      +K  L+C Y+ F ++GI
Sbjct: 317 PNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGI 376

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 146
             F+ G+ P L+   L   V  G       L+K
Sbjct: 377 PKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIK 409

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 109/298 (36%), Gaps = 47/298 (15%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQT-----SQDSTRFKGP-LDCVYKTFTQQGIRGFY 117
             +G F+GI ++++  P D IK R+Q      S  +TR     L  + K  T +G    +
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--PLSGCIISGVMAGWSVSFI 175
            G    ++G     +V       Y M   + +   + +   PL   + SG +A  +   +
Sbjct: 81  KGVQSVVLGAGPAHAVYFA---TYEMCKSRLIDPEDRQTHQPLKTAL-SGTLATVAADAL 136

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT-----NF 230
             P +  K +LQ+      TK         ++Y   G+   +    +T+         NF
Sbjct: 137 MNPFDTIKQRLQLHPSDSMTK------CAVRMYQREGIAAFFYSYPTTIAMNIPFAALNF 190

Query: 231 VFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSDVIKQVVLCND- 286
           V     YE  T+ F    N      N W           T A    P D +K V+     
Sbjct: 191 VI----YESSTKIFNPSNNY-----NPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGA 241

Query: 287 --------KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFV 336
                   K   TFR    AA  I +T G+ GFF+G  P  + + P        +EF 
Sbjct: 242 DSVQSQLFKEADTFRK---AASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFA 296

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 86/204 (42%), Gaps = 15/204 (7%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQ 111
           P   + +  +   +SG  + +A +A+ +PFDTIK RLQ     +  K    C  + + ++
Sbjct: 111 PEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTK----CAVRMYQRE 166

Query: 112 GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWS 171
           GI  F+  +   +   I   ++      +   +      YN    P   C+  G+ +G +
Sbjct: 167 GIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYN----PWIHCLCGGI-SGAT 221

Query: 172 VSFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKK----VYSSNGVRGLYKGLTSTLIF 226
            + I  P++  K  LQ++  D+  ++     D  +K    ++ + G  G ++GL   +I 
Sbjct: 222 CAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIIS 281

Query: 227 RT-NFVFWWGSYELLTRWFKEHTN 249
                   W SYE        ++N
Sbjct: 282 NMPATAISWTSYEFAKHLLFTNSN 305

>Scas_582.7
          Length = 329

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 111/292 (38%), Gaps = 40/292 (13%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ------TSQDSTRFKGPLDCVYKTFTQQGIRGFY 117
            ++G F+GI +++   P D +K R+Q      T Q ST     +  + K  T +G     
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSI---IKQISKISTMEG----- 91

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG--------CIISGVMAG 169
                 L  W  + SV+LG    + +    Y +     +P S           +SG  A 
Sbjct: 92  -----SLALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATAT 146

Query: 170 WSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTN 229
            +  F   P +  K ++Q+    K   Y    +V KK+Y+  G+   Y    +T+     
Sbjct: 147 VASDFFMNPFDTIKQRMQISDLKKEKVY----NVAKKIYNLEGLSAFYYSYPTTIAMNIP 202

Query: 230 F-VFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVV------ 282
           F  F +  YE  +++F    + +                  TT  P D IK V+      
Sbjct: 203 FAAFNFMIYESASKFFNPLHHYNPLIHCLCGGISGAIAAAVTT--PLDCIKTVIQIRGSS 260

Query: 283 LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           + + +      ++K A   I    G++GF++G  P  L + P        +E
Sbjct: 261 VVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 76/192 (39%), Gaps = 19/192 (9%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115
           E +  I   VSG  + +A +   +PFDTIK R+Q S    + +   +   K +  +G+  
Sbjct: 131 ETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISD--LKKEKVYNVAKKIYNLEGLSA 188

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175
           FY  +   +   I   +       +         +YN    PL  C+  G+ +G   + +
Sbjct: 189 FYYSYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYN----PLIHCLCGGI-SGAIAAAV 243

Query: 176 AAPVELAKAKLQVQYDA--------KTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR 227
             P++  K  +Q++  +        K   +      I  VY   G +G ++GL   ++  
Sbjct: 244 TTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVY---GWKGFWRGLQPRILAN 300

Query: 228 T-NFVFWWGSYE 238
                  W +YE
Sbjct: 301 MPATAISWTAYE 312

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 70/191 (36%), Gaps = 13/191 (6%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK-YTGPVDVIKKVYSSNGVRG 215
           PLS  +++G  AG        P++  K ++Q      T +  T  +  I K+ +  G   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 216 LYKGLTSTLIFR-TNFVFWWGSYELL-TRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY 273
           L+KG+ S ++        ++ +YE        +    +   I                  
Sbjct: 95  LWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMN 154

Query: 274 PSDVIKQVVLCND-KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXX 332
           P D IKQ +  +D K +  +      AK I+   G   F+  +  +   + P        
Sbjct: 155 PFDTIKQRMQISDLKKEKVYN----VAKKIYNLEGLSAFYYSYPTTIAMNIP-----FAA 205

Query: 333 FEFVLRTSGAK 343
           F F++  S +K
Sbjct: 206 FNFMIYESASK 216

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 79/188 (42%), Gaps = 12/188 (6%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTP 122
           F++G   GI  ++  H  DT+K R Q + +  ++K  L      F ++G  RG Y G+  
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCA 116

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELA 182
            ++G     ++        +  +    + N+    L+    +G +  +  SF+  P E+ 
Sbjct: 117 AMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLT----AGFLGDFFSSFVYVPSEVL 172

Query: 183 KAKLQVQ------YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWG 235
           K +LQ+Q      +      Y    + I  +Y + GV  L+ G  +TL     F    + 
Sbjct: 173 KTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFA 232

Query: 236 SYELLTRW 243
            YE   +W
Sbjct: 233 FYEKFRQW 240

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 72/181 (39%), Gaps = 14/181 (7%)

Query: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV 213
           E  P+  C ++G + G  +   +A   L   K + Q      KY   +   + ++   G 
Sbjct: 49  EHSPIWHCFLAGGVGG--IIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGF 106

Query: 214 R-GLYKGLTSTLI--FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWT 270
           R GLY G  + ++  F +  +F+  +YE   R      +++DT  +            + 
Sbjct: 107 RRGLYGGYCAAMLGSFPSAAIFF-STYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFV 165

Query: 271 TAYPSDVIKQVVLCNDKYDG-------TFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSF 323
              PS+V+K  +     Y+         ++S + A   I+RT G    F G+  +  R  
Sbjct: 166 YV-PSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDL 224

Query: 324 P 324
           P
Sbjct: 225 P 225

>Scas_717.20
          Length = 356

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 111/308 (36%), Gaps = 51/308 (16%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS-TRFKGPL----DCVYKTFTQQGIRGFY 117
           G   G+    AK  +  P D IK+  QTS    T++ G L    +     +   GIRGF+
Sbjct: 36  GLAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G +  L+      +V        R  L     Y      L    +SG +AG    F   
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRL----MSGSLAGLCSVFTTY 150

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRG-------------LYKGLTSTL 224
           P++L + +L    + K     G V  I K  +S  +                Y+G T T+
Sbjct: 151 PLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTV 210

Query: 225 IFRTNFV-FWWGSYELLTRWFKE-------------------HTNMSDTAINFWXXXXX- 263
           +    +    + +++LL    K                    H       +  W      
Sbjct: 211 LGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLSG 270

Query: 264 --XXXXXWTTAYPSDVIKQ-----VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFV 316
                   T AYP ++I++      +  +  YD  F+S    AK I++ RG+RGFF G  
Sbjct: 271 GLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLS 330

Query: 317 PSFLRSFP 324
             +++  P
Sbjct: 331 IGYIKVTP 338

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 84/210 (40%), Gaps = 44/210 (20%)

Query: 53  PPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFK--GPLDCVYKTFTQ 110
           P  E  S     +SG  +G+      +P D I+VRL    +  R    G +  +YK    
Sbjct: 124 PSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPAS 183

Query: 111 QGIRG-------------FYLGFTPPLVGWI------------LMDSVMLGCLHNYRMLL 145
             +               FY G+TP ++G I            L D +    L  Y +L 
Sbjct: 184 TTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLA 243

Query: 146 -----KKYVYYNEEKLPLS--GCIISGVMAGWSVSFIAAPVELAKAKLQVQ-------YD 191
                ++  ++  ++LPL     ++SG +AG +    A P E+ + +LQV        YD
Sbjct: 244 LSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYD 303

Query: 192 AKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
               ++    ++ K +Y   G RG + GL+
Sbjct: 304 H---RFQSISEIAKIIYKERGWRGFFVGLS 330

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 270 TTAYPSDVIKQVVLCND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPX 325
           T   P D IK +   ++    KY G+    K AAK IW   G RGFF+G   + +R FP 
Sbjct: 48  TLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPY 107

Query: 326 XXXXXXXFEFVLRT 339
                  +E +  T
Sbjct: 108 AAVKFVAYEQIRNT 121

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 10/80 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST------RFKGPLDCVYKTFTQQGIRGFY 117
            +SG  +G+A     +PF+ I+ RLQ S  S       RF+   +     + ++G RGF+
Sbjct: 267 LLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFF 326

Query: 118 LGFTPPLVGWILMDSVMLGC 137
           +G +   +G+I + + M+ C
Sbjct: 327 VGLS---IGYIKV-TPMVAC 342

>Scas_687.15*
          Length = 328

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P++  + +  F  G+FS  A  A+  P D +K R+Q+      +K  L+C Y+ F ++G+
Sbjct: 227 PTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGM 286

Query: 114 RGFYLGFTPPLVGWILMDSVMLGC---LHNYRMLLKKYVYYN 152
              + G+ P L    L   +  G    + N    LKK  Y++
Sbjct: 287 VSLWKGWLPRLFKVGLSGGISFGVYQYVENLSHTLKKEKYFD 328

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/305 (20%), Positives = 115/305 (37%), Gaps = 43/305 (14%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPL-DCVYKTFTQQGIRGFYLGF 120
           + FV+G   G     V  P + +K+ LQ    +T + G L   V + + ++G++G + G 
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISG--VMAGWS------- 171
                         + CL  +     +Y  Y   K  +     SG   +  W        
Sbjct: 78  G-------------INCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGAL 124

Query: 172 ----VSFIAAPVELAKAKLQVQ-------YDAKTTKYTGP---VDVIKKVY-SSNGVRGL 216
                  +  P++L + +L +Q       + +K      P   V+++++++    G+RG 
Sbjct: 125 GGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGW 184

Query: 217 YKGLTSTLIFRTNFV-FWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPS 275
           Y+G+  T +    FV   +  YE L        +    A               T  YP 
Sbjct: 185 YRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPF 244

Query: 276 DVIKQ--VVLCNDKYDGTFRSWKLAAK--DIWRTRGYRGFFKGFVPSFLRSFPXXXXXXX 331
           D++++   VL   + +  FR   +A     I R  G RG++KG   + ++  P       
Sbjct: 245 DLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWF 304

Query: 332 XFEFV 336
            +E +
Sbjct: 305 VYELI 309

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 79/182 (43%), Gaps = 20/182 (10%)

Query: 77  VGHPFDTIKVRL--QTS----------QDSTRFKGPLDCVYKTFTQQG-IRGFYLGFTPP 123
           V +P D ++ RL  QT+           D  R  G ++ + + F ++G +RG+Y G  P 
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAK 183
            +G +   ++        + L+     Y+   +  +   I G ++G     +  P +L +
Sbjct: 192 SLGVVPFVALNFALYERLKALIPHD--YDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLR 248

Query: 184 AKLQVQYDAKTT---KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI-FRTNFVFWWGSYEL 239
            + QV    ++    +Y    D +  +    G+RG YKGLT+ L+         W  YEL
Sbjct: 249 RRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

Query: 240 LT 241
           ++
Sbjct: 309 IS 310

>Scas_721.129
          Length = 323

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 81/186 (43%), Gaps = 13/186 (6%)

Query: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-----STRFKGPLDCVYKTFT 109
           ++  S+   F++G  +        +P + +K+R+Q   +        ++ P+  +   F 
Sbjct: 16  AQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFR 75

Query: 110 QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPL---SGCIISGV 166
            +GIRG   G     +  I ++   LG     R  L    Y NEE   +   S  + +G 
Sbjct: 76  NEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGA 135

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVRGLYKGLTS 222
            +G   + I +P+ L K ++Q   DA    + T Y    + +  +  + G +GL++G+ +
Sbjct: 136 SSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDA 195

Query: 223 TLIFRT 228
             I RT
Sbjct: 196 A-ILRT 200

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 79/183 (43%), Gaps = 18/183 (9%)

Query: 54  PSEAYSRI----MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDC 103
           P+E   +I    +   +G  SGI    +G P   +K R+Q+  D+      T ++   + 
Sbjct: 117 PNEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNG 176

Query: 104 VYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLLKKYVYYNEEKLPLSGCI 162
           +      +G +G + G    ++      SV L   +  +  LLK  +  +   L L+   
Sbjct: 177 LSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTAST 236

Query: 163 ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTS 222
           ISG+     V+ +  P ++   ++   Y+ K   Y GPVD   K   + G+  LYKG  +
Sbjct: 237 ISGL----GVAVVMNPWDVILTRI---YNQKGNLYKGPVDCFVKTVRTEGISALYKGFQA 289

Query: 223 TLI 225
            ++
Sbjct: 290 QIL 292

>Kwal_23.3529
          Length = 395

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 106/270 (39%), Gaps = 31/270 (11%)

Query: 75  NAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTPPLVGWILMDSV 133
           ++V H  DT+K R Q + ++ +++  +    K F ++GI RG Y G+T  ++G     ++
Sbjct: 100 DSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 134 MLGCLHNYRMLLKKYVY---YNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ- 189
             G    Y +  +K +     NE    L+    +G+      S +  P E+ K +LQ+Q 
Sbjct: 160 FFGT---YELTKRKLIDDWGVNETLSHLT----AGLSGDLVSSVVYVPSEVLKTRLQLQG 212

Query: 190 -----YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGSYELLTRW 243
                +      Y    D I  +    G + L+ G  +TL     F  F +  YE   +W
Sbjct: 213 CYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQW 272

Query: 244 ---FKEHTNMSD-TAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAA 299
               +  T   D + +N                 P DVIK  +           S +L  
Sbjct: 273 AFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVR 332

Query: 300 KD---------IWRTRGYRGFFKGFVPSFL 320
            +         ++R+ G  GFF G  P F+
Sbjct: 333 IENSLIKGLTAVYRSEGTLGFFSGVGPRFI 362

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 10/66 (15%)

Query: 80  PFDTIKVRLQT------SQDSTRFKGPLDCVYKTFT----QQGIRGFYLGFTPPLVGWIL 129
           P D IK R+QT      + DSTR     + + K  T     +G  GF+ G  P  +   +
Sbjct: 307 PMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSI 366

Query: 130 MDSVML 135
             S+ML
Sbjct: 367 QSSIML 372

>Kwal_47.19228
          Length = 281

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFT 109
           Q   P++  +    F  G  S  A  AV  P D IK R+Q+    + +K  L+C Y+ F 
Sbjct: 174 QMISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFV 233

Query: 110 QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK 146
           ++G   F+ G+ P L+   L   V  G       L+K
Sbjct: 234 EEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMK 270

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 293 RSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           R +    ++I+R+RG RGF +G +P+ +R
Sbjct: 129 RQFLTTVQEIYRSRGIRGFLQGTMPTIIR 157

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 55/126 (43%), Gaps = 12/126 (9%)

Query: 201 VDVIKKVYSSNGVRGLYKGLTSTLIFRT-NFVFWWGSYELLTRWFKEHTNMSDT---AIN 256
           +  ++++Y S G+RG  +G   T+I +T N    + +Y  L +    +  +++    A+ 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFALG 191

Query: 257 FWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYD-GTFRSWKLAAKDIWRTRGYRGFFKGF 315
           F                P DVIK  +    KY    +++    A  I+   G+  F+KG+
Sbjct: 192 FISSCAVV-----AVTQPIDVIKTRM--QSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGW 244

Query: 316 VPSFLR 321
            P  ++
Sbjct: 245 APRLMK 250

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/119 (18%), Positives = 49/119 (41%), Gaps = 7/119 (5%)

Query: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG 160
           L  V + +  +GIRGF  G  P ++      +V      + + ++      NE       
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYY----- 186

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG 219
               G ++  +V  +  P+++ K ++Q +Y    + Y   ++   +++   G    +KG
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQSKYTW--SNYKNSLNCAYRIFVEEGFTKFWKG 243

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 110/288 (38%), Gaps = 36/288 (12%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI-RGFYLGFTPP 123
           VSG   G   ++  H  DT+K R Q + +  +++  +      + ++G+ RG Y G+   
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAA 117

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAK 183
           ++G     ++  G     +  + +    N+    LS    +G +  +  SF+  P E+ K
Sbjct: 118 MLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS----AGFLGDFISSFVYVPSEVLK 173

Query: 184 AKLQVQ------YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL-----IFRTNFVF 232
            +LQ+Q      +      Y+   + IK V    G R L+ G  +TL          F F
Sbjct: 174 TRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAF 233

Query: 233 WWGSYELLTRWFKEHTNMSDTAI-NFWXXXXXXXXXXWTTAYPSDVIKQVV--------- 282
           +    +L  +  ++     + +I N                 P DV+K  V         
Sbjct: 234 YEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQS 293

Query: 283 ----------LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFL 320
                     + N +      S  L+ + ++++ G  GFF G  P F+
Sbjct: 294 NKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFV 341

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 292 FRSWKLAAKDIWRTRGYR-GFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 339
           +R+   A + IW   G R G + G++ + L SFP        +E+  RT
Sbjct: 90  YRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRT 138

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFT 109
           Q   P++  S    F  G+FS  A  A+  P D +K R+Q+    + ++  L+CVY+TF 
Sbjct: 236 QMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFI 295

Query: 110 QQGIRGFYLGFTPPLVGWILMDSVMLGC 137
           ++G+   + G+ P L    L   V  G 
Sbjct: 296 EEGLTSLWKGWVPRLFKVGLSGGVSFGV 323

>Scas_715.45
          Length = 305

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 81/200 (40%), Gaps = 27/200 (13%)

Query: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218
           + C + G++A         P++L K +LQV      +  +G + ++KK     G+  L+ 
Sbjct: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK----EGLGKLFT 72

Query: 219 GLTSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDV 277
           G+ +T I +       +G YEL  R +  H  + D A  +            T  + +D+
Sbjct: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHL-VKDEATAYKYRTSIYLLSSATAEFFADI 131

Query: 278 I----------KQVVL---CNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           +          +Q  +   CN+  +G    W    K ++   G  GF+KG  P + R  P
Sbjct: 132 MLCPFEAIKVKQQTTMPPWCNNVIEG----W----KKMYAKEGLNGFYKGITPLWCRQIP 183

Query: 325 XXXXXXXXFEFVLRTSGAKV 344
                   FE ++    A++
Sbjct: 184 YTMCKFTSFERIVEAIYARL 203

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           PF+ IKV+ QT+         ++   K + ++G+ GFY G TP     I     M     
Sbjct: 135 PFEAIKVKQQTTMPP-WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI--PYTMCKFTS 191

Query: 140 NYRMLLKKYVYYNEEKLPLSG------CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAK 193
             R++   Y     +K  +S         + G MAG   + ++ P ++  +K+  +    
Sbjct: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251

Query: 194 TTKYTGPVDVIKKVYSSNGVRGLYKGL-TSTLIFRTNFVFWWGSYE 238
            +        +K++YS  G  GL+ GL    L+  T   F W  Y+
Sbjct: 252 ESMNVA----LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 120/302 (39%), Gaps = 33/302 (10%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLGF 120
           + F++G  +G     V  PF+ +K+ LQ    +T + +G    + + + ++G +G + G 
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYN----EEKLPLSGCIISGVMAGWSVSFIA 176
               +      +V       Y    KK  + N    +E+L  +  + SG + G       
Sbjct: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140

Query: 177 APVELAKAKLQVQ---------YDAKT-TKYTGPVDVIKKVYS-SNGVRGLYKGLTSTLI 225
            P++L K +L +Q           AK+ +K  G   ++ + Y    G+RGLY+G+  T +
Sbjct: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 226 FRTNFV-FWWGSYELLTRWFKEHTNMSDTA----INFWXXXXXXXX--XXWTTAYPSDVI 278
               +V   +  YE L  +     N SD       N +             T  YP D++
Sbjct: 201 GVVPYVALNFAVYEQLREF---GVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLL 257

Query: 279 KQ--VVLCNDKYDGTFRSWKL--AAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           ++   VL     +  FR   +  A   I R  G  G++KG   +  +  P        +E
Sbjct: 258 RRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

Query: 335 FV 336
            V
Sbjct: 318 VV 319

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%)

Query: 49  IQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTF 108
           +Q   P +A      F +G  S  A  A+  P D IK R+Q+      +K  L+C Y+ F
Sbjct: 237 VQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIF 296

Query: 109 TQQGIRGFYLGFTPPLVGWILMDSVMLGC 137
            ++G R  + G+ P L    L   +  G 
Sbjct: 297 VEEGFRYMWKGWVPRLFKVSLSGGISFGV 325

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 62/148 (41%), Gaps = 8/148 (5%)

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT--NFVFW 233
           A PV+ A  +  + Y+ + + +      + ++Y + GVRG  +G   T IFR   N V  
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFA--GTVLEIYRTRGVRGFLQGAMPT-IFRQLGNSVVR 229

Query: 234 WGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFR 293
           + +Y  + +    H  + +     +               P DVIK  +     +  T++
Sbjct: 230 FTTYAWIVQSLSPHKALDE--YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF-TYK 286

Query: 294 SWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
           S    A  I+   G+R  +KG+VP   +
Sbjct: 287 SSLNCAYRIFVEEGFRYMWKGWVPRLFK 314

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 79/188 (42%), Gaps = 19/188 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
            VSG F G+A      P D +K RLQ +Q S+  +  L  V  T      R  + G  P 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASS-LRSVLREVRTT------RELWRGTLPS 64

Query: 124 LVGWILMDSVMLGCLHNYRMLLKK--YVYYNEEKLPLSGC---IISGVMAGWSVSFIAAP 178
            +   +  ++ L  L+  R  L +          LP       +++G ++  +V  +  P
Sbjct: 65  ALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMP 124

Query: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYE 238
           + + K    V+Y++    Y G  +  + ++ S G RG +KG  +T +    +    G Y 
Sbjct: 125 ITVIK----VRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYA---GLYV 177

Query: 239 LLTRWFKE 246
           LL    KE
Sbjct: 178 LLYEQAKE 185

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 277 VIKQVVLCNDKYDGTFRSWK---LAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           V   + +   +Y+ T  ++     A + IWR+ G RGFFKG   + LR  P
Sbjct: 121 VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAP 171

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 111/289 (38%), Gaps = 48/289 (16%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTIKVRLQT---------SQDSTRFKGPLDCVYKTFTQQGI 113
            F   + S +A   V +P D  K  +QT         S++  ++K  +DC+ K F ++G 
Sbjct: 7   AFTGAVASSLAATTV-YPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 114 RGFYLGFTPPLVGWILMDSVML----GCLHNY------RMLLKKYVYYNE----EKLPLS 159
            G Y G    +    + + +          NY      R+ LK    + E    E+L L 
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELAL- 124

Query: 160 GCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVY-SSNG-VRGLY 217
                G+ AG     +  P+ +   + Q+  D +         VIK++Y  SNG +   +
Sbjct: 125 -----GMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKA---VIKQIYEESNGDLTAFW 176

Query: 218 KGLTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDT---------AINFWXXXXXXXXXX 268
           KG    L+  TN    +GSY+ L         +S +           NF           
Sbjct: 177 KGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMIST 236

Query: 269 WTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVP 317
           + T     ++ ++ L        F++++   + I++  G+   +KG +P
Sbjct: 237 FVT--QPLIVAKITLQGK--GSKFKTFQEVLQHIYQNEGFLSLWKGVIP 281

>Scas_662.12
          Length = 308

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 113/290 (38%), Gaps = 37/290 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQ--------------DSTRFKGPLDCV 104
            +SG+ +G     + HP D IKVRLQ     T+Q              ++++  G    +
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 105 YKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIIS 164
           Y    ++  RG  +      V W L  ++      +Y M    Y++ N   + L+    S
Sbjct: 71  YN-LIKESYRGLPINLLGNAVAWSLYFTIY-NSTKDY-MFQNNYLHNNNTTIFLT----S 123

Query: 165 GVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G+++G S + +  P+ + K ++          Y       K + +  G + ++ GL  +L
Sbjct: 124 GLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSL 183

Query: 225 IFRTNFVFWWGSYELLTRWFKEHTNMS-----DTAINFWXXXXXXXXXXWTTAYPSDVIK 279
           +  +    ++  Y+ L   F  + N S     +  +               + YP  ++K
Sbjct: 184 LGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLK 243

Query: 280 QVV-----LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
             +     + N+     +    L  K I+R  G +G +KG   + LR+ P
Sbjct: 244 SNLQTFRSVTNNIPQNDYHFITLIRK-IYRDNGIKGLYKGLSANLLRAIP 292

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 75/185 (40%), Gaps = 19/185 (10%)

Query: 153 EEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK----YTGPVDVI---- 204
            E  P+   IISG+ AG   + I  P++L K +LQ+     T +    YT  ++ +    
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 205 KKVYSS----NGVRGLYKGLTSTLIFRTNFVFWWGSYELLTR----WFKEHTNMSDTAIN 256
           KK+ S     N ++  Y+GL   L+   N V W   + +        F+ +   ++    
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLL--GNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTI 119

Query: 257 FWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYD-GTFRSWKLAAKDIWRTRGYRGFFKGF 315
           F                P  VIK  ++   ++   +++S +   K +    G +  + G 
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

Query: 316 VPSFL 320
           +PS L
Sbjct: 180 LPSLL 184

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/281 (19%), Positives = 109/281 (38%), Gaps = 22/281 (7%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ-DSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
            ++G F+GI ++++  P D +K R+Q +  +     G +  + K  T +G    + G   
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--PLSGCIISGVMAGWSVSFIAAPVE 180
            ++G     +V  G    Y     + +   + +   P+    +SG +A  +   +  P +
Sbjct: 87  VILGAGPAHAVYFG---TYEFCKARLISPEDMQTHQPMKTA-LSGTIATIAADALMNPFD 142

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGSYEL 239
             K +LQ+  + +        +V K++Y + G    Y    +TL     F  F +  YE 
Sbjct: 143 TVKQRLQLDTNLRV------WNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYES 196

Query: 240 LTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWK--- 296
            +++F    + +                  TT  P D IK V+        +    K   
Sbjct: 197 ASKFFNPQNSYNPLIHCLCGGISGATCAALTT--PLDCIKTVLQVRGSETVSIEIMKDAN 254

Query: 297 ---LAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
               A++ I    G++GF++G  P  + + P        +E
Sbjct: 255 TFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 83/200 (41%), Gaps = 29/200 (14%)

Query: 52  PPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQ 111
           P   + +  +   +SG  + IA +A+ +PFDT+K RLQ   +   +    +   + +  +
Sbjct: 112 PEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVW----NVTKQIYQNE 167

Query: 112 GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL--PLSGCIISGVMAG 169
           G   FY  +   L   I   +       N+ +      ++N +    PL  C+  G+ +G
Sbjct: 168 GFAAFYYSYPTTLAMNIPFAAF------NFMIYESASKFFNPQNSYNPLIHCLCGGI-SG 220

Query: 170 WSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIK----------KVYSSNGVRGLYKG 219
            + + +  P++  K  LQV+        T  ++++K           +   +G +G ++G
Sbjct: 221 ATCAALTTPLDCIKTVLQVR-----GSETVSIEIMKDANTFGRASRAILEVHGWKGFWRG 275

Query: 220 LTSTLIFRT-NFVFWWGSYE 238
           L   ++         W +YE
Sbjct: 276 LKPRIVANIPATAISWTAYE 295

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 74/186 (39%), Gaps = 28/186 (15%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST-RFKGPLDCVYKTFTQQGIR 114
           EA S +   V+G  SG+   +V  P DT+K+R Q    S  ++ G L        ++G+R
Sbjct: 20  EAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVR 79

Query: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL-----PLSGCIISGVMAG 169
             + G  P    ++L  S+  G           Y + N         P +  +  G +AG
Sbjct: 80  ALWKGNVPASAMYVLYGSLQFGT----------YAWLNTAAASAGLPPQAHSLAVGALAG 129

Query: 170 WSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG---------L 220
              S +  P++L + +L     A          VI   + + G  G ++G         L
Sbjct: 130 LVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVI---WDTEGPAGFFRGGAWAIAATTL 186

Query: 221 TSTLIF 226
           T+ LIF
Sbjct: 187 TTGLIF 192

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 6/155 (3%)

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG- 219
            +++G ++G     + AP++  K + Q+Q  A   KY G +   + V    GVR L+KG 
Sbjct: 27  AVVAGSVSGLVARSVTAPMDTVKIRRQLQL-ASEHKYHGILHTFRTVAREEGVRALWKGN 85

Query: 220 LTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIK 279
           + ++ ++       +G+Y  L         +   A +              T YP D+++
Sbjct: 86  VPASAMYVLYGSLQFGTYAWLNT-AAASAGLPPQAHSLAVGALAGLVSSLLT-YPLDLLR 143

Query: 280 QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKG 314
             ++ N      F S +  A+ IW T G  GFF+G
Sbjct: 144 TRLVANRSAH--FFSLRRQARVIWDTEGPAGFFRG 176

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 82/212 (38%), Gaps = 35/212 (16%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118
           +R+   V G F+GI  + V +PFD ++ RL  + +          V   +  +G+ GF+ 
Sbjct: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFK 169

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE-----------KLPLSGCIISGVM 167
           G    +    L  S+M G     R+    Y   NE+            L  S   I GV+
Sbjct: 170 GSIASMTTITLTASIMFGTYETIRI----YCDENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTTKYT------------GPVDVIKKVYSSNGVRG 215
           A      I  P+E  + ++Q        K++            G   +  ++    GV  
Sbjct: 226 A----KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281

Query: 216 LYKGLTSTL--IFRTNFVFWWGSYELLTRWFK 245
           LY+G+   L     T FV +WG YE    + +
Sbjct: 282 LYRGILVALSKTIPTTFVSFWG-YETAIHYLR 312

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPV-DVIKKVYSSNGVRGLYKG 219
            +++G ++G     I AP++  K +LQ+        +   V +V + +  + G+R  +KG
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

Query: 220 -LTSTLIFRTNFVFWWGSYELLTRW---FKEHTNMSDTAINFWXXXXXXXXXXWTTAYPS 275
            +  +L++ T     + SY L  R+   F     +    +  +             +YP 
Sbjct: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSS-----IVSYPF 133

Query: 276 DVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSF 319
           DV++  ++ N++      S     +DIW+  G  GFFKG + S 
Sbjct: 134 DVLRTRLVANNQMHSM--SITREVRDIWKLEGLPGFFKGSIASM 175

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 79/188 (42%), Gaps = 12/188 (6%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGP--LDCVYKTFTQQGIRGFYLGF 120
            ++G  SG+   ++  P DTIK+RLQ T  +  +  G   ++        +GIR F+ G 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180
            P  + ++   S        +   L  +    E +L     ++ G  AG + S ++ P +
Sbjct: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGL--EARLH---SLVVGAFAGITSSIVSYPFD 134

Query: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG-LTSTLIFRTNFVFWWGSYEL 239
           + + +L       +   T  V   + ++   G+ G +KG + S           +G+YE 
Sbjct: 135 VLRTRLVANNQMHSMSITREV---RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191

Query: 240 LTRWFKEH 247
           +  +  E+
Sbjct: 192 IRIYCDEN 199

>Scas_645.9
          Length = 391

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 105/277 (37%), Gaps = 33/277 (11%)

Query: 87  RLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGC---LHNYRM 143
            L     S RF G L+   K +  +GI   + G +  L+  I  + V       L +   
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 144 LLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQV--QYDAKTTKYTGPV 201
           L      +N    PL    I+ ++A  +V    AP+EL K KLQ   +    TT +    
Sbjct: 179 LATSSPTFN----PLMCGAIARILAASTV----APLELLKTKLQSIPRVSKSTTSWMMVK 230

Query: 202 DVIKKVYSSNGVRG----LYKGLTSTLIFRTNF-VFWWGSYELLTRWFKEHTNMSDTAIN 256
           +++K+      + G    L+KGL  TL     F   +WGSYE         T+ S + + 
Sbjct: 231 ELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLT 290

Query: 257 FWXXXXXXXXXXWTTA----YPSDVIK---QVVLCNDKYDGTFRSWKLAA--------KD 301
           F+           T A    +P DV K   Q+    +      +S  +          ++
Sbjct: 291 FFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRN 350

Query: 302 IWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
           IW+  G+   + G VP  ++  P        +E   R
Sbjct: 351 IWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

>Kwal_26.7972
          Length = 358

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 108/313 (34%), Gaps = 63/313 (20%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-----STRFKGPLDCVYKTFTQQGIRGFY 117
           G   G+    AK  +  P D IK+  QTS       S    G +          GIRGFY
Sbjct: 31  GLAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G +  L+      ++        R  +     Y      L+    SG MAG    F+  
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLA----SGSMAGLCSVFMTY 145

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGL----------------YKGLT 221
           P++L + +L    D    K    + VIK++Y+      L                Y+G T
Sbjct: 146 PLDLIRVRLAYVTDRSRIKM---LPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFT 202

Query: 222 STL-------------------IFRTNF-----VFWWGSYELLTRWFKEHTNMSDTAINF 257
            T+                   I R+       V      EL  R  K+    S   +  
Sbjct: 203 PTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQ----SSRPLKT 258

Query: 258 WXXXXX---XXXXXWTTAYPSDVIK---QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGF 311
           W              T +YP ++I+   QV + +      F++     + I++ RG+RGF
Sbjct: 259 WAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGF 318

Query: 312 FKGFVPSFLRSFP 324
           F G    +++  P
Sbjct: 319 FVGLSIGYIKVTP 331

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 101/247 (40%), Gaps = 54/247 (21%)

Query: 53  PPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG 112
           P  E  +      SG  +G+    + +P D I+VRL    D +R K  L  + + +T++ 
Sbjct: 119 PSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKM-LPVIKQIYTERA 177

Query: 113 IRG----------------FYLGFTPPLVGWI------------LMDSVMLGCLHNYRML 144
                              FY GFTP ++G I              D +  G L  Y +L
Sbjct: 178 SESLTSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVL 237

Query: 145 LKKYVYYNEEKL----------PLS--GCIISGVMAGWSVSFIAAPVELAKAKLQVQYDA 192
                  ++E+L          PL     +++G +AG +    + P E+ + +LQV   +
Sbjct: 238 P-----ISDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVS 292

Query: 193 KTTKY---TGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV----FWWGSYELLTRWFK 245
            T+ +   T P D+I+ +Y   G RG + GL+   I  T  V    F     E+++ + +
Sbjct: 293 PTSIHNFQTIP-DMIRIIYKERGWRGFFVGLSIGYIKVTPMVACSFFRLRKNEVVSEYLR 351

Query: 246 EHTNMSD 252
            +T  S 
Sbjct: 352 TYTIFSS 358

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 104/290 (35%), Gaps = 54/290 (18%)

Query: 79  HPFDTIKVRLQTSQD-----STRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSV 133
           +P +T+K RLQ   +     S  + GP   V   +  +G+RG   G              
Sbjct: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQG-------------- 75

Query: 134 MLGCLHNYRMLLK--KYVYYNEEKLPLSGCIIS-----GVMA-----------GWSVSFI 175
            L C + Y++LL   +   Y+  +  L GC++S     G  A           G   + +
Sbjct: 76  -LACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAAL 134

Query: 176 AAPVELAKAKLQVQYDAKTTKYTGPVD-VIKKVYSSNGVRGLYKGLTSTLIFRT------ 228
            +P++L K ++Q     +     G +   +  ++   GVRGLY+G+ + L+ RT      
Sbjct: 135 GSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALL-RTGVGSAV 193

Query: 229 NFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKY 288
               +  + E L+R      ++ D    +                P DV   +       
Sbjct: 194 QLAVYSHAKEALSR------HVPDGMALYTLASALSSVAVCIAMNPFDV--AMTRMYHHR 245

Query: 289 DGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
            G +R          R  G+   +KG +   LR  P         E  LR
Sbjct: 246 GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPL 124
           ++   S +A     +PFD    R+   +    ++GPLDC+ KT  Q+G    Y G    L
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQL 276

Query: 125 V 125
           +
Sbjct: 277 L 277

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 79/179 (44%), Gaps = 22/179 (12%)

Query: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113
           P  +   I GFV G+ S I    V  PFD +K RLQ ++D+T + G L  +      +  
Sbjct: 5   PKTSSHLIGGFVGGLTSAI----VLQPFDLLKTRLQQNKDTTLW-GTLKEI------RSP 53

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE-------KLPLSGCIISGV 166
           +  + G  P  +   +  ++ L  L+ +R  + K              +L +   + SG 
Sbjct: 54  KQLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGA 113

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
                V FI  P+ + K    V+Y++    Y    +  + +YS+ G+RG + G  +T++
Sbjct: 114 FTRGVVGFITMPITIIK----VRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVM 168

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118
           S ++  +S   S      +  PFDTIK R+Q   D T+F G    +    +++  +  + 
Sbjct: 210 STVVNSISAFMSASLATTITSPFDTIKTRMQL--DPTKFSGFYKTLVLIVSKEKFKNLFD 267

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNE 153
           G T  L        +  G    Y  L+K+++ Y++
Sbjct: 268 GLTLRLTRKAFSAGIAWGI---YEELIKRFMAYSK 299

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 64/174 (36%), Gaps = 7/174 (4%)

Query: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV 213
           E+   S  +I G + G + + +  P +L K +LQ   D         +   K+++     
Sbjct: 3   ERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQLWRGALP 62

Query: 214 RGLYKGLTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY 273
             L   + S L   T  VF       + +   +  N   + +             +T   
Sbjct: 63  SSLRTSIGSALYLSTLNVFRTA----MAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGV 118

Query: 274 PSDVIKQVVLCNDKYDGTFRSWKL---AAKDIWRTRGYRGFFKGFVPSFLRSFP 324
              +   + +   +Y+ T  S+K    A + I+ T G RGFF G   + +R  P
Sbjct: 119 VGFITMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAP 172

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 116/306 (37%), Gaps = 48/306 (15%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD----------STRFKGPLDCVYKTFTQQGI 113
            ++G F+GI ++++  P D +K R+Q   +                       T  QQ  
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKL---------PLSGCIIS 164
           R         L  W  + S+++G    + +    Y +  E+ +         PL   + S
Sbjct: 84  R--ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAV-S 140

Query: 165 GVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
           GV A  +   +  P +  K +LQ+Q  +  +       +   +Y + G    +    +TL
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQLQSKSSDSSM---WRMAFNIYKNEGPMAFFYSYPTTL 197

Query: 225 IFRT-----NFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY---PSD 276
                    NFV     YE  T++F   TN    A N W           T A    P D
Sbjct: 198 AMNIPFAALNFVI----YESSTKFFNP-TN----AYNPWIHCLCGGIAGATCAAVTTPLD 248

Query: 277 VIKQVV------LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXX 330
            IK V+        + +   T  ++K AA+ IW++ G++GF++G  P  + + P      
Sbjct: 249 CIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISW 308

Query: 331 XXFEFV 336
             +EF 
Sbjct: 309 TSYEFA 314

>Kwal_33.14050
          Length = 314

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 109/294 (37%), Gaps = 29/294 (9%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
             +G F+GI ++++  P D IK R+Q    +         +     QQ  R      +  
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 124 LVGWILMDSVMLGC-------LHNYRM----LLKKYVYYNEEKLPLSGCIISGVMAGWSV 172
           L  W  + SV+LG           Y M    L+    +   + L  +    SG+ A  + 
Sbjct: 80  L--WKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAA---SGIAATVAA 134

Query: 173 SFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-V 231
             +  P +  K ++Q++  +K   ++    V  ++Y + G+   +    +T+     F  
Sbjct: 135 DLLMNPFDTIKQRMQLRTFSKDRMWS----VASRIYRNEGLAAFFYSYPTTIAMNIPFAA 190

Query: 232 FWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIK---QVVLCNDKY 288
           F +  YE  T++F      +                  TT  P D IK   QV       
Sbjct: 191 FNFAIYESATKFFNPENTYNPLIHCLCGGISGATCAAITT--PLDCIKTVLQVRGSESVV 248

Query: 289 DGTFR---SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 339
           D  FR   ++  AA  I +  G+ GF++G  P  + + P        +E    T
Sbjct: 249 DPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYECAKHT 302

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 75/203 (36%), Gaps = 32/203 (15%)

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQV------QYDAKTTKYTGPVDVIKKVYSS 210
           PL+  + +G  AG     I  P++  K ++Q         +A     +  V  I ++ ++
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 211 NGVRGLYKGLTSTLI-FRTNFVFWWGSYELLTRW------FKEHTNMSDTAINFWXXXXX 263
            G   L+KG+ S ++        ++ +YE+   +      F+ H  +   A         
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVAA 134

Query: 264 XXXXXWTTAYPSDVIKQVVLCNDKYDGTF---RSWKLAAKDIWRTRGYRGFFKGFVPSFL 320
                     P D IKQ +        TF   R W +A++ I+R  G   FF  +  +  
Sbjct: 135 DLLMN-----PFDTIKQRMQLR-----TFSKDRMWSVASR-IYRNEGLAAFFYSYPTTIA 183

Query: 321 RSFPXXXXXXXXFEFVLRTSGAK 343
            + P        F F +  S  K
Sbjct: 184 MNIP-----FAAFNFAIYESATK 201

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 117/308 (37%), Gaps = 51/308 (16%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS-TRFKGPL----DCVYKTFTQQGIRGFY 117
           G   G+    AK  +  P D IK+  QTS    T++ G L    +     +   G+RGF+
Sbjct: 37  GLAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G +  L+      +V        R  L     +      L    +SG +AG    FI  
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRL----VSGSLAGLCSVFITY 151

Query: 178 PVELAKAKLQVQYDAKTTK--------YTGPVD--VIKKVYSSNGVR---GLYKGLTSTL 224
           P++L + +L  + + K  K        Y  P    +IK  Y  N        Y+G   T+
Sbjct: 152 PLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTV 211

Query: 225 IFRTNFV-FWWGSYELL-----TRWFKEHTNMS---DTAINFWXXXXXXXXXXW------ 269
           +    +    + +++LL     + +F  ++ +    D  +             W      
Sbjct: 212 LGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISG 271

Query: 270 --------TTAYPSDVIK---QVVLCNDK--YDGTFRSWKLAAKDIWRTRGYRGFFKGFV 316
                   T AYP ++I+   QV   + K  YD  F+S    A  I++ RG RGFF G  
Sbjct: 272 GLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLS 331

Query: 317 PSFLRSFP 324
             +++  P
Sbjct: 332 IGYIKVTP 339

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 10/80 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDCVYKTFTQQGIRGFY 117
            +SG  +G+A     +PF+ I+ RLQ S  S       +F+   +  +  F ++G+RGF+
Sbjct: 268 LISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFF 327

Query: 118 LGFTPPLVGWILMDSVMLGC 137
           +G +   +G+I + + M+ C
Sbjct: 328 VGLS---IGYIKV-TPMVAC 343

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query: 270 TTAYPSDVIKQVVLCND----KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPX 325
           T   P D IK +   ++    KY G+      AAK IW   G RGFF+G   + LR FP 
Sbjct: 49  TLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPY 108

Query: 326 XXXXXXXFEFVLRT 339
                  +E +  T
Sbjct: 109 AAVKFVAYEQIRNT 122

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 73/163 (44%), Gaps = 16/163 (9%)

Query: 86  VRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF-TPPLVGWILMDSVM----LGCLHN 140
           + L++ Q + ++KG LD + + +  +G+ G Y G  +  + G+I   S      L   H 
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY 120

Query: 141 YRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGP 200
           +R+   K     + +      ++ G++A  +      P+ +   + Q +  A      G 
Sbjct: 121 FRL---KQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQA-----AGA 172

Query: 201 VD---VIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSYELL 240
            D   V ++V++ NG RG + GL  +L+   N    + +YE L
Sbjct: 173 ADMRTVAREVHAENGWRGFWAGLKVSLVLTVNPSITYATYERL 215

>Scas_669.6
          Length = 373

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 113/289 (39%), Gaps = 63/289 (21%)

Query: 79  HPFDTIKVRLQTSQDSTRFKGPLDCVYKT-FTQQGI-RGFYLGFTPPLVGWILMDSVMLG 136
           H  DT+K R Q +  + ++K  +   Y+T F ++GI RG Y G+   ++G     ++  G
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKN-MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 137 CLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTT- 195
                +  +   + +N+    LS    +G++  +  SF+  P E+ K +LQ+Q       
Sbjct: 129 TYEWCKRKMIGDLGFNDTVSHLS----AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPF 184

Query: 196 -----KYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF-VFWWGSYE--------LLT 241
                 Y      I+ + ++ GV+ L+ G  +TL     F    +G YE        L  
Sbjct: 185 FQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEK 244

Query: 242 RWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQ--------------------- 280
           +   +H N+S     F            TT  P DVIK                      
Sbjct: 245 KDITKH-NLSIPNEIFTGAIAGGLAGIITT--PMDVIKTRLQTQQADINPNSATTVGAIS 301

Query: 281 ---------VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFL 320
                    +VL N      FRS KL    ++++ G  GFF G  P F+
Sbjct: 302 AKTNKKSRPIVLSNS----IFRSLKL----VYQSEGVIGFFSGVGPRFV 342

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 72/188 (38%), Gaps = 35/188 (18%)

Query: 66  SGMFSGIAKNAVGHPFDTIKVRLQTS--------QDSTRFKGPLDCVYKTFTQQGIRGFY 117
           +G+      + V  P + +K RLQ          Q    ++     +      +G++  +
Sbjct: 152 AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALF 211

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRM----LLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173
            G+   L   +   ++  G    +R     L KK +   +  L +   I +G +AG    
Sbjct: 212 FGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDI--TKHNLSIPNEIFTGAIAGGLAG 269

Query: 174 FIAAPVELAKAKLQVQ--------------YDAKTTKYTGPVDV-------IKKVYSSNG 212
            I  P+++ K +LQ Q                AKT K + P+ +       +K VY S G
Sbjct: 270 IITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEG 329

Query: 213 VRGLYKGL 220
           V G + G+
Sbjct: 330 VIGFFSGV 337

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 60/155 (38%), Gaps = 12/155 (7%)

Query: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV-RGLYKGLTSTLI--FRTNFVFWWGS 236
            L   K + Q    T KY       + ++   G+ RGLY G  + ++  F +  +F+ G+
Sbjct: 71  SLDTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFF-GT 129

Query: 237 YELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTF---- 292
           YE   R        +DT  +            +    PS+V+K  +    + +  F    
Sbjct: 130 YEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYV-PSEVLKTRLQLQGRVNNPFFQSG 188

Query: 293 ---RSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
              RS + A + I  T G +  F G+  +  R  P
Sbjct: 189 YNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLP 223

>Scas_613.24
          Length = 177

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 71/168 (42%), Gaps = 18/168 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
            VSG   G++      P D +K R+Q  + +T +    D   K   Q     F+ G  P 
Sbjct: 12  LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDI--KDPIQ-----FWRGTLPS 64

Query: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNE-------EKLPLSGCIISGVMAGWSVSFIA 176
            +   +  ++ L CL+  R  L      +         +L +   +++G MA   V +I 
Sbjct: 65  ALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYIT 124

Query: 177 APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
            P+ +    L+V+Y++    Y    + IK +Y   G+ G +KG   T+
Sbjct: 125 MPITI----LKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 281 VVLCNDKYDGTFRSWKL---AAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           + +   +Y+ T+ S+K    A KDI++  G  GFFKGF P+     P
Sbjct: 127 ITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTVGIGIP 173

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 107/282 (37%), Gaps = 31/282 (10%)

Query: 87  RLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGC---LHNYRM 143
            L     S +F G L+   K  + +GI   + G +  L+  I  + V       + +   
Sbjct: 92  ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSP 151

Query: 144 LLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQ-VQYDAKTTKYTGPV- 201
           +   Y   N    PL    I+ V A  S+    AP+EL K KLQ +   +K+TK    V 
Sbjct: 152 IASTYPTLN----PLFCGAIARVFAATSI----APLELVKTKLQSIPRSSKSTKTWMMVK 203

Query: 202 DVIKKVYSSNGV----RGLYKGLTSTLIFRTNF-VFWWGSYELLTR--WFKEHTNMSDTA 254
           D++ +      +    R L+KGL  TL     F   +W SYEL     W       S  A
Sbjct: 204 DLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDA 263

Query: 255 -----INFWXXXXXXXXXXWTTAYPSDVIK---QVVLCNDKY-DGTFRSWKLAA--KDIW 303
                IN +              +P DV K   Q+ + N+    G  RS  +    + IW
Sbjct: 264 NWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIW 323

Query: 304 RTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAKVN 345
           RT G    + G     ++  P        +E   +  G K++
Sbjct: 324 RTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFGNKLH 365

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 83/222 (37%), Gaps = 56/222 (25%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQT----------------SQDST------------- 95
           +SG  +    N V +P D +K  +QT                SQD               
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 96  ------RFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMD-------SVMLGCLHNYR 142
                 ++    D +YK + Q+GIRG Y G T  ++             S +  C    +
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 143 MLLKKYVYYNE-EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ--YDAKTTKYTG 199
           ++ +K   +   E+L L      G++A  +      P+ L  A+ Q +   D      T 
Sbjct: 128 LINRKNTKFTTIEELLL------GIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLT- 180

Query: 200 PVDVIKKVYSSN-GVRGLYKGLTSTLIFRTNFVFWWGSYELL 240
              V K++Y     ++G +KGL  +L+   N    + SYE L
Sbjct: 181 ---VAKEIYKEQRSIKGFWKGLKVSLMLTINPSITYTSYEKL 219

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 70/174 (40%), Gaps = 20/174 (11%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD---STRFKGPLDCVYKTFTQQGIRGFY 117
           ++G V+   S I  N    P   I  R QT Q       F      +YK   Q+ I+GF+
Sbjct: 143 LLGIVAAATSQIFTN----PISLISARQQTRQGIDGDNDFLTVAKEIYKE--QRSIKGFW 196

Query: 118 LGF-------TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGW 170
            G          P + +   + +         M LKK +  +  +L        GV++  
Sbjct: 197 KGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNFTLGVLSKM 256

Query: 171 SVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
             + I  P+ ++KA LQ       + ++    V+  +Y + G+R  +KGL+  L
Sbjct: 257 ISAIITMPLIISKAWLQ----RNGSNFSSFQQVLYYLYKNEGLRSWWKGLSPQL 306

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFT 121
           +G +S M S I    +  P    K  LQ  ++ + F      +Y  +  +G+R ++ G +
Sbjct: 250 LGVLSKMISAI----ITMPLIISKAWLQ--RNGSNFSSFQQVLYYLYKNEGLRSWWKGLS 303

Query: 122 PPLVGWILMDSVMLGCLHNYRMLLKKYVYY 151
           P L   +L+  ++         L+K+ + Y
Sbjct: 304 PQLAKGVLVQGLLFMFKGELTKLMKRLLLY 333

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 105/266 (39%), Gaps = 39/266 (14%)

Query: 79  HPFDTIKVRLQTSQDSTRFKGP--LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG 136
           HP D  KVRLQ +        P  +  +      +GI G Y G +  L+      +   G
Sbjct: 25  HPLDLTKVRLQAAP----IPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFG 80

Query: 137 CLHNYRMLLKKYVYYNEEKLP-----LSGCIISGVMAGWSVSFIAAPVELAKAKLQ---- 187
                   LK++V    +KL      L   ++SG + G + +F     +L   ++Q    
Sbjct: 81  MYD----ALKEHV-IPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLINIRMQNDSA 131

Query: 188 VQYDAKTTKYTGPVDVIKKVYSSNGVRGLY------KGLTSTLIFRTNFVFWWGSYELLT 241
           +  D K   Y   +D + K+Y + G + L+        +   L+  +  V    +Y++  
Sbjct: 132 LPLD-KRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVV----TYDMFK 186

Query: 242 RWFKEHTNMSDTAINFWXXXXXXXXXXWTTA-YPSDVIKQVVLCNDKYDGTFR--SWKLA 298
            +     NM     +             TT   P+DVIK +V+   K  G     S+K+ 
Sbjct: 187 NFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFKIL 246

Query: 299 AKDIWRTRGYRGFFKGFVPSFLRSFP 324
            + I +  G    F+G+VPSF R  P
Sbjct: 247 MEAINK-EGPSFMFRGWVPSFTRLAP 271

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 70/162 (43%), Gaps = 12/162 (7%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQ----DSTR-FKGPLDCVYKTFTQQGIRGFYL 118
            VSG   G+A N      D I +R+Q       D  R +K  +D + K +  +G +  +L
Sbjct: 106 MVSGALGGLAGNFA----DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFL 161

Query: 119 -GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAA 177
            G+ P +V  +LM +  +     ++  L     YN +    S  + S ++AG+  + + +
Sbjct: 162 TGWKPNMVRGVLMTASQVVTYDMFKNFL--VTKYNMDPKKNSTHLTSSLLAGFVATTVCS 219

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG 219
           P ++ K  +   +      +     ++ +  +  G   +++G
Sbjct: 220 PADVIKTIVMNAHKKPGHNHDSSFKILMEAINKEGPSFMFRG 261

>Kwal_55.21106
          Length = 328

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 81/209 (38%), Gaps = 38/209 (18%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQ--------------------DSTRFKGPLDCV 104
           ++G  +    N V +P D +K  +QT                         R+K  LD +
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 105 YKTFTQQGIRGFYLGFTPPLVGWILMD-------SVMLGCLHNYRMLLKKYVYYNE-EKL 156
            K F  +G+ G Y G    ++   L         S++      Y++L  +   ++  E+L
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEEL 127

Query: 157 PLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS-NGVRG 215
            L      G++A        +P+ +   +   Q  + +    G  +V+ ++YS  N + G
Sbjct: 128 LL------GIVAAAVSQIFTSPIGVISTR---QQTSTSGSKGGFREVLHQIYSEQNNITG 178

Query: 216 LYKGLTSTLIFRTNFVFWWGSYELLTRWF 244
            ++G   +LI   N    + SYE L   F
Sbjct: 179 FWRGFKVSLILTVNPSITFASYEKLQDIF 207

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 4/89 (4%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122
           F+ G+FS +    +  P    K  LQ T  +   F+  L  +YK   Q+G+   + G  P
Sbjct: 233 FLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLYK---QEGLISLWKGLAP 289

Query: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYY 151
            L   IL+  ++         L+K+ ++Y
Sbjct: 290 QLSKGILVQGLLFMFKGELTKLIKRCIFY 318

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 104/272 (38%), Gaps = 31/272 (11%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTS--QDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPL 124
           G  +GI    V HP D  KVRLQ +     T F+     +      +G+ G Y G +  +
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFR----MLESILANEGVVGLYSGLSAAV 75

Query: 125 VGWILMDSVMLGCLHNYRMLLKKYVYYNEE------KLPLSGCIISGVMAGWSVSFIAAP 178
           +      +V  G       LLK+ V   E+       LP S  + SG + G + +F A  
Sbjct: 76  LRQCTYTTVRFGAYD----LLKENVIPREQLTNMAYLLPCS--MFSGAIGGLAGNF-ADV 128

Query: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYS-SNGVRGLYKGLTSTLIFRTNFVFWWGSY 237
           V +          AK   Y   +D + K+Y    G++ L+ G    ++     +    S 
Sbjct: 129 VNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMV---RGILMTASQ 185

Query: 238 ELLTRWFKEH--TNMS-DTAINF--WXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTF 292
            +    FK +  T +  D + N+              T   P+DV+K  ++      G  
Sbjct: 186 VVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNG---SGDH 242

Query: 293 RSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           +       D  R  G    F+G++PSF R  P
Sbjct: 243 QPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%)

Query: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLG 119
           ++G+ +     A+  P D +K R+ +    T +K  L+C+Y+ F Q+G+  F+ G
Sbjct: 199 ITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKG 253

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 91/200 (45%), Gaps = 15/200 (7%)

Query: 54  PSEAYSRIMGFV-SGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG 112
           PS A+S ++  V +G   G   ++V H  DT+K R Q +    +++  +        ++G
Sbjct: 46  PSSAHSPLLHCVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEG 105

Query: 113 I-RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLS-GCIISGVMAGW 170
           + RG Y G+   ++G     +V  G    Y  + ++ +  NE ++  +   + +G +   
Sbjct: 106 VRRGLYGGYGAAMLGSFPSAAVFFG---TYEWVKRQMI--NEWQIHETYSHLAAGFLGDL 160

Query: 171 SVSFIAAPVELAKAKLQVQ--YDAKTTK----YTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
             S +  P E+ K +LQ+Q  Y+ +  +    Y G  D ++ +  + GV  L+ G  +TL
Sbjct: 161 FSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATL 220

Query: 225 IFRTNF-VFWWGSYELLTRW 243
                F    +  YE   +W
Sbjct: 221 SRDLPFSALQFAFYERFRKW 240

>Kwal_27.11419
          Length = 298

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 108/278 (38%), Gaps = 42/278 (15%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           F+ G   G+    +  PFD +K RLQ ++ S      LD V    T   +   + G  P 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL----LDVVRSIETPGQL---WKGTLPS 63

Query: 124 LVGWILMDSVMLGCLHNYRMLL-----KKYVYYNEE-----KLPLSGCIISGVMAGWSVS 173
            +   +  ++ L  L+  R  +     K     N       +L +   +ISG +   +V 
Sbjct: 64  ALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVG 123

Query: 174 FIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI----FRTN 229
               P+ +    L+V++++    Y    +    +Y S G+RGL+ G  +T++    +   
Sbjct: 124 VATMPITV----LKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGL 179

Query: 230 FVFWWGSYEL-----LTRWFKEH------TNMSDTAINFWXXXXXXXXXXWTTAYPSDVI 278
           +V ++   +L     L  W  EH      +  + T IN              T+ P D I
Sbjct: 180 YVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITS-PFDTI 238

Query: 279 KQVVLCN-DKYDGTFRSWKLAAKDIWRTRGYRGFFKGF 315
           K  +  N  +Y G  +++    K I R    R  F G 
Sbjct: 239 KTRMQLNPSQYYGFIQTF----KSIIRYERPRNLFDGL 272

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 79/196 (40%), Gaps = 25/196 (12%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
            +SG  +  A      P   +KVR +++  + +  G  +     +  +GIRG + G    
Sbjct: 112 LISGAITRAAVGVATMPITVLKVRFESTMYNYKSLG--EAATHIYRSEGIRGLFSGCG-- 167

Query: 124 LVGWILMDSVMLGC---------LHNYRMLLKKYVYYNEEKL--PLSGCIISGVMAGWSV 172
               ++ D+   G          L   R+L    V +NE  +    +  II+ + A  S 
Sbjct: 168 --ATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSA 225

Query: 173 SF---IAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT- 228
           S    I +P +  K ++Q+      ++Y G +   K +      R L+ GL+  L  +  
Sbjct: 226 SLATTITSPFDTIKTRMQLN----PSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKAL 281

Query: 229 NFVFWWGSYELLTRWF 244
           +    WG YE L + F
Sbjct: 282 SAGIAWGIYEELVKKF 297

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 104/265 (39%), Gaps = 30/265 (11%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           +   VSG  +G + + V  P DT+K RLQ        KG        F   G RG Y G 
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQA-------KGGF------FHNGGYRGIYRGL 52

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYV---YYNEEKLPLSGCIISGVMAGWSVSFIAA 177
              +V      S+      + +  L+  +     +E+   +   ++S  +   S   +  
Sbjct: 53  GSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRV 112

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNG-VRGLYKGLTSTLIFRTNFV-FWWG 235
           P E+ K + Q  +   + +    + +I +  +  G VRGLY+G  +T++    F    + 
Sbjct: 113 PAEVIKQRTQTHHTNSSLQ---TLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFP 169

Query: 236 SYELLTRWFKEHTNMSDTAINFWXXX---XXXXXXXWTTAYPSDVIKQVVLCNDKYDGTF 292
            YE L + +  +  +    ++ W                  P DV+K  ++ +++     
Sbjct: 170 LYEYLKKKWAAYAEIER--VSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPML 227

Query: 293 RSWKLAAKDIWRTRGYRGFFKGFVP 317
                 A+ ++R  G R FF+G  P
Sbjct: 228 H----LARTLFREEGARVFFRGIGP 248

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 84/193 (43%), Gaps = 24/193 (12%)

Query: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFK-GPLDCVYK 106
           D++Q    E+    + F++G  +G     V  PF+ +K+ LQ    ++ +  G ++ V +
Sbjct: 2   DLKQLAKQESS---IAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQ 58

Query: 107 TFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY-----NEEKLPLSGC 161
            + ++G+ G + G     V      +V    ++ +    KK++++      +E+L     
Sbjct: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQF-VVYEW---CKKHIFHVDGTVGKEQLLNWQR 114

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQ-------YDAKTTKYTGPVDV----IKKVYSS 210
           + +G + G        P++L + +L +Q         +K      P  V    +K     
Sbjct: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEE 174

Query: 211 NGVRGLYKGLTST 223
            G+RGLY+G+  T
Sbjct: 175 GGIRGLYRGIYPT 187

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 109/262 (41%), Gaps = 40/262 (15%)

Query: 77  VGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG 136
           +G P + +K  +  +++ T     L+ V   +++ GI G+Y G  P    W  +++   G
Sbjct: 37  LGQPLEVVKTTMAANRNFTF----LESVKHVWSRGGILGYYQGLIP----WAWIEASTKG 88

Query: 137 CLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA-------APVELAKAKLQVQ 189
            +  +     +Y + +      +  I+ GV  G + +++          VE+ + K    
Sbjct: 89  AVLLFVSAEAEYRFKSLGLNNFASGILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASA 148

Query: 190 YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKE-- 246
                + ++    V K +Y   G+RG+ KG+ +  I + TN    WGS   L+R  ++  
Sbjct: 149 GGVPQSSWS----VFKNIYKKEGIRGINKGVNAVAIRQMTN----WGSRFGLSRLVEDGI 200

Query: 247 -----HTNMSDTAINFWXXXXXXXXXXWTTAY--PSDVIKQVVLCNDKYDGTFRSWKLAA 299
                 TN  D  +N +            +A+  P +VI+  V    K +   R   L  
Sbjct: 201 RKITGKTN-KDDKLNPFEKIGASALGGGLSAWNQPIEVIR--VEMQSKKEDPNRPKNLTV 257

Query: 300 ----KDIWRTRGYRGFFKGFVP 317
               K I+++ G +G ++G  P
Sbjct: 258 GKTFKYIYQSNGLKGLYRGVTP 279

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 11/95 (11%)

Query: 158 LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGL 216
           +    + G ++ W+      P+E+ + ++Q +  D    K        K +Y SNG++GL
Sbjct: 219 IGASALGGGLSAWN-----QPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGL 273

Query: 217 YKGLTSTL---IFRTNFVFWWG--SYELLTRWFKE 246
           Y+G+T  +   I++T F+  +G  + E + R   E
Sbjct: 274 YRGVTPRIGLGIWQTVFMVGFGDMAKEFVARMTGE 308

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 105/268 (39%), Gaps = 29/268 (10%)

Query: 92  QDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY 151
           + + R +G L+ + K    +G+   + G    LV  +  + V       Y  L       
Sbjct: 75  EPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNSPLA 131

Query: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPV--DVIKKV-- 207
           +  +LP++  ++ G  A    +   AP+EL + +LQ    A+ T+ T  +  D+++++  
Sbjct: 132 S--RLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRH 189

Query: 208 -YSSNGVRGLYKGLTSTLIFRTNF-VFWWGSYELL-TRWFKEHTNMSDTA-----INFWX 259
             S  G R L+KGL  TL     F   +WG+YE   T+++  H    + +     I  + 
Sbjct: 190 EVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFA 249

Query: 260 XXXXXXXXXWTTAYPSDVIK----------QVVLCNDKYDGTFRSWKLAA--KDIWRTRG 307
                        +P DV K          Q +    K   T  S  + +    I ++ G
Sbjct: 250 CGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEG 309

Query: 308 YRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
            R  + G +P  ++  P        +E 
Sbjct: 310 IRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 12/97 (12%)

Query: 160 GCIISGVMAGWSVSFIAAPVELAKAKLQVQYDA-----------KTTKYTGPVDVIKKVY 208
           G    G M G   + +  P ++ K ++Q+   +           KT    G    +  + 
Sbjct: 246 GSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIR 305

Query: 209 SSNGVRGLYKGLTSTLI-FRTNFVFWWGSYELLTRWF 244
            S G+R LY GL   ++    +      +YEL  ++F
Sbjct: 306 KSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVG 126
           G+ S  A      P D IK R+Q       ++  ++C Y+ F ++G    + G+ P L+ 
Sbjct: 241 GLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMK 300

Query: 127 WILMDSVMLG 136
             L  SV  G
Sbjct: 301 VGLSGSVSFG 310

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 69/183 (37%), Gaps = 16/183 (8%)

Query: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGL 220
           C + G++A         P++L K +LQV     T+   G     +K+ ++ G + +Y G 
Sbjct: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGF 76

Query: 221 TSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIK 279
            +T + +       +G YE     +    +   T                   + +  +K
Sbjct: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136

Query: 280 QVV----LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEF 335
           Q       CN+  DG    WK   K    + G + F+KG VP + R  P        FE 
Sbjct: 137 QQTTMPPFCNNVVDG----WK---KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEK 189

Query: 336 VLR 338
           +++
Sbjct: 190 IVQ 192

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 97/251 (38%), Gaps = 32/251 (12%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K RLQ   +   +   L    K    +G +  Y GF    VG+ L  +   G   
Sbjct: 38  PLDLVKCRLQV--NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95

Query: 140 NYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA----APVELAKAKLQVQYDAKTT 195
            ++ L   +         LS  +   +MA  +  F+A     P E  K K Q        
Sbjct: 96  YFKHLYSSW---------LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146

Query: 196 KYTGPVDVIKKVYS-SNGVRGLYKGLTS--------TLIFRTNFV-FWWGSYELLTRWFK 245
                VD  KK+Y+ S G++  YKG+          T+   T+F       Y +L +  +
Sbjct: 147 NV---VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKE 203

Query: 246 EHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRT 305
           E   +   +++F              ++P+DV+   +    K +    S  +A+K I++ 
Sbjct: 204 EMNALQQISVSF-VGGYLAGILCAAVSHPADVMVSKINSERKAN---ESMSVASKRIYQK 259

Query: 306 RGYRGFFKGFV 316
            G+ G + G +
Sbjct: 260 IGFTGLWNGLM 270

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 70/182 (38%), Gaps = 17/182 (9%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQG-IRGFYLGFTPPLVGWILMDSVMLGCL 138
           PF+ IKV+ QT+         +D   K + + G ++ FY G  P     I          
Sbjct: 129 PFEAIKVKQQTTMPPF-CNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187

Query: 139 HN-----YRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAK 193
                  Y +L KK    N  +  +S   + G +AG   + ++ P ++  +K+  +  A 
Sbjct: 188 EKIVQKIYSVLPKKKEEMNALQ-QISVSFVGGYLAGILCAAVSHPADVMVSKINSERKAN 246

Query: 194 TTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV-FWWGSYELLTRWFKEHTNMSD 252
            +         K++Y   G  GL+ GL   ++       F W    L+   FK +  +  
Sbjct: 247 ESMSVAS----KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQW----LIYDSFKAYVGLPT 298

Query: 253 TA 254
           T 
Sbjct: 299 TG 300

>Scas_705.9
          Length = 323

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/292 (18%), Positives = 108/292 (36%), Gaps = 36/292 (12%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST-------------RFKGPLDCVY 105
           S +   ++G  +    N + +P D  K  +Q+   +              R +  + C+ 
Sbjct: 2   SNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLI 61

Query: 106 KTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHN-YRMLLKKY----VYYNEEKLPLSG 160
           + F ++G+RG Y G +      +    V   C    Y  L +KY    +  N +  P++ 
Sbjct: 62  RIFRKRGLRGLYQGMSTS----VFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINS 117

Query: 161 C-----IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVY-SSNGVR 214
                 +I GV A      +  P+E+   K Q   D     +     V+K++Y  SNG  
Sbjct: 118 ISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDF---YSVLKQIYVESNGKL 174

Query: 215 GLY-KGLTSTLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAY 273
             Y KG   +LI   N    + +Y+       +  + S+ + +                 
Sbjct: 175 SSYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKI 234

Query: 274 PSDVIKQVVLCN----DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321
            S +I Q ++       + +  F+ ++   + +++  G    +KG  P   +
Sbjct: 235 ISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

>Kwal_23.4354
          Length = 343

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGPLDCVYKTFTQ----QGIRG 115
           +  FV G F G     + HPFD  K R+Q T  +ST  K P   ++K   Q    +G+  
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAA 311

Query: 116 FYLGFTPPLV 125
            Y G  P ++
Sbjct: 312 LYTGLVPRVI 321

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 153 EEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQV--QYDAKTTKYTGPVDVIKKV--- 207
           ++K P    ++ G +A    +   AP+EL + +LQ   +   K+T      D+IK+    
Sbjct: 135 QDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYE 194

Query: 208 YSSNGVRGLYKGLTSTLIFRTNF-VFWWGSYE 238
            S  G + L++GL  TL     F   +WG YE
Sbjct: 195 ISKVGYKALFRGLEITLWRDVPFSSIYWGCYE 226

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/338 (19%), Positives = 121/338 (35%), Gaps = 58/338 (17%)

Query: 52  PPPS----------EAYSRIMG-FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP 100
           PPPS           AYS I+   ++G   G   ++  H  DT+K R Q +  + ++K  
Sbjct: 36  PPPSGGKTNADSTENAYSPIVHCMLAGGIGGAIGDSAMHSLDTVKTRQQGAPSTVKYKNM 95

Query: 101 LDCVYKTFTQQGIR-GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLS 159
           +        ++G+R G Y G++            MLG   +  +    Y Y   + +   
Sbjct: 96  IGAYRTIILEEGLRKGLYGGYS----------GAMLGSFPSAAIFFATYEYTKRKMIGEW 145

Query: 160 GC------IISGVMAGWSVSFIAAPVELAKAKLQVQ------YDAKTTKYTGPVDVIKKV 207
           G       + +G +  +  SF+  P E+ K +LQ+Q      +      Y    D +  +
Sbjct: 146 GINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTI 205

Query: 208 YSSNGVRGLYKGLTSTL-----IFRTNFVFWWG----SYELLTRWFKEHTNMSDTAINFW 258
               G   L+ G  +TL          F F+      ++ +  + F E  ++S+  I   
Sbjct: 206 VRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIIT-- 263

Query: 259 XXXXXXXXXXWTTAYPSDVIKQVVLC-----------NDKYDGTFRSWKLAAKDIWRTRG 307
                          P DV+K  +             N K      S       +++T G
Sbjct: 264 --GAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEG 321

Query: 308 YRGFFKGFVPSFLRSFPXXXXXXXXFEFVLRTSGAKVN 345
             G F G  P F+ +          ++  L+T  +K++
Sbjct: 322 LAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTLDSKLS 359

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 102/271 (37%), Gaps = 31/271 (11%)

Query: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115
           ++ S ++   SG  +G + +    P DT+K RLQ        KG        F   G +G
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQA-------KGGF------FANGGYKG 48

Query: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRM----LLKKYVYYNEEKLPLSGCIISGVMAGWS 171
            Y G    ++      S+      + ++    ++ KYV  N +       + S  +   S
Sbjct: 49  VYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVS 108

Query: 172 VSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV-RGLYKGLTSTLIFRTNF 230
              +  P E+ K + Q     KT         I +  +  GV R LY+G  +T++    F
Sbjct: 109 ACLVRVPAEVIKQRTQTH---KTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPF 165

Query: 231 V-FWWGSYELLTR-WFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKY 288
               +  YE L + W K +                       T  P DV+K  ++ + K 
Sbjct: 166 TCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHK- 224

Query: 289 DGTFRSWKLA--AKDIWRTRGYRGFFKGFVP 317
                S  +A  AK+I+   G++ FF G  P
Sbjct: 225 -----SIPVAQLAKNIYAEEGFKVFFSGVGP 250

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 76/190 (40%), Gaps = 32/190 (16%)

Query: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
           + SG  AG S      P++  K +LQ +                  +++ G +G+Y+GL 
Sbjct: 10  LASGAAAGTSTDLAFFPIDTLKTRLQAK---------------GGFFANGGYKGVYRGLG 54

Query: 222 STLIFRT-NFVFWWGSYE--------LLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTA 272
           S +I    +   ++ SY+        +++++   +  M+DT  + +              
Sbjct: 55  SAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRV 114

Query: 273 YPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRG---YRGFFKGFVPSFLRSFPXXXXX 329
            P++VIKQ      +   T  SW+   K +    G    R  ++G+  + +R  P     
Sbjct: 115 -PAEVIKQ----RTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQ 169

Query: 330 XXXFEFVLRT 339
              +EF+ +T
Sbjct: 170 FPLYEFLKKT 179

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 71/173 (41%), Gaps = 31/173 (17%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKG--PLDCVYKTFTQQGIRGFYL 118
           I GF  G+ S +A      P D +K R Q ++  T ++    LD  ++          + 
Sbjct: 9   IGGFAGGLSSAVAL----QPLDLLKTRFQQTKGGTLWQTVKSLDTPWQ---------LWR 55

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY------------NEEKLPLSGCIISGV 166
           G  P  +   +  ++ L  L+  R  L K   +            N  +L +   +++G 
Sbjct: 56  GTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGA 115

Query: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG 219
            A  +V +I  P+ + K    V+Y++    Y    +  K + +  G+RG ++G
Sbjct: 116 FARGTVGYITMPITIIK----VRYESTLYNYKSIAEAAKSIAAQEGIRGFFRG 164

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 281 VVLCNDKYDGT---FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           + +   +Y+ T   ++S   AAK I    G RGFF+GF P+ LR  P
Sbjct: 128 ITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAP 174

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 178 PVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL--IFRTNFVFWWG 235
           P+     KLQ Q + +  +    ++ IK++Y  +G+ G Y GL S +  +  TNFV+++ 
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYY- 91

Query: 236 SYELLTR 242
            YEL +R
Sbjct: 92  FYELTSR 98

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 104/261 (39%), Gaps = 38/261 (14%)

Query: 77  VGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG 136
           +G P + IK  +  ++  + F    + +   +++ G+ GFY G  P    W  +++   G
Sbjct: 35  LGQPLEVIKTTMAANRSFSFF----NAIKHVWSRGGVFGFYQGLIP----WAWIEASTKG 86

Query: 137 CLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK 196
            +  +     +Y +           I+ GV  G + +++   +        V+   K + 
Sbjct: 87  AVLLFVSAESEYQFKRMGLSNFGSGIMGGVTGGVAQAYLT--MGFCTCMKTVEITKKKSA 144

Query: 197 YTGPV-----DVIKKVYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKE---- 246
             G +        K++Y  +G++G+ KG+ +  I + TN    WGS    +R  +E    
Sbjct: 145 GAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTN----WGSRFGFSRLVEEGIRN 200

Query: 247 ---HTNMSD--TAIN-FWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKL--- 297
               TN  D  TA+              W    P +VI+  V    K +   R   L   
Sbjct: 201 ATGKTNPDDKLTALEKIAASAIGGGLSAWN--QPIEVIR--VEMQSKKEDPNRPKNLTVS 256

Query: 298 -AAKDIWRTRGYRGFFKGFVP 317
            A K I+++ G +G ++G  P
Sbjct: 257 SAFKYIYQSSGIKGLYRGVAP 277

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 158 LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGL 216
           ++   I G ++ W+      P+E+ + ++Q +  D    K        K +Y S+G++GL
Sbjct: 217 IAASAIGGGLSAWN-----QPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGL 271

Query: 217 YKGLTSTL---IFRTNFVFWWG 235
           Y+G+   +   +++T F+  +G
Sbjct: 272 YRGVAPRIGLGVWQTVFMVGFG 293

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/241 (19%), Positives = 87/241 (36%), Gaps = 24/241 (9%)

Query: 96  RFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSV-----MLGCLHNYRMLLKKYVY 150
           R+K  LD + K +  +G  G Y G +  L+G  +          L   H +R+   K V 
Sbjct: 86  RYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRV---KKVK 142

Query: 151 YNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSS 210
               +      ++  ++A  +      P+ +   K Q +   +         + K+VY  
Sbjct: 143 GEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKA--IAKEVYDE 200

Query: 211 NGVRGLYKGLTSTLIFRTNFVFWWGSYELL------TRWFKEHTNMSDTAI----NFWXX 260
           +G+ G +K L  +L+   N    + S E L        W  +  N S   +    NF   
Sbjct: 201 DGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIG 260

Query: 261 XXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFL 320
                     T +P  V K  +    +    F S++     ++R  G    +KG +P   
Sbjct: 261 VLSKIISTCLT-HPLIVAKASL---QRSSSKFTSFQEVLTYLYRHEGAHALWKGLLPQLT 316

Query: 321 R 321
           +
Sbjct: 317 K 317

>Scas_558.2
          Length = 289

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 102/272 (37%), Gaps = 38/272 (13%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           +M  +SG  +G + + V  P DT+K RLQ        KG        F   G  G Y G 
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQA-------KGGF------FQNGGYHGIYRGL 53

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC-----------IISGVMAG 169
              +V      S+      + ++ ++ +V   E  +  SG            +I+  M  
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHV---ERVINSSGTRSPHSVDTIVHMIASSMGE 110

Query: 170 WSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTN 229
            +   +  P E+ K + QV   +  + +     ++K       +R LY+G ++T++    
Sbjct: 111 LAACLVRVPAEVIKQRTQVH--STNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIP 168

Query: 230 FV-FWWGSYELLTRWFKEHTNMSDTAINFWXXX---XXXXXXXWTTAYPSDVIKQVVLCN 285
           F    +  YE + + +  + N     +  W               T  P D +K  ++ N
Sbjct: 169 FTCIQFPLYEFMKKEWALYDN-EVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN 227

Query: 286 DKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVP 317
                     K   ++I++  G++ FF G  P
Sbjct: 228 KDSI----PIKSLIRNIYKEEGFKIFFSGIYP 255

>Scas_696.9
          Length = 312

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 11/125 (8%)

Query: 202 DVIKKVYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKEHTNMS--DTAINFW 258
           +V + +Y+  G+RG+YKG+ +  I + TN+   +G   L+  W ++ T  +  +  +N W
Sbjct: 155 NVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAW 214

Query: 259 XXXXXXXXXXWTTAY--PSDVIKQVVLCNDKYDGTFRSWKLAA----KDIWRTRGYRGFF 312
                       +A+  P +VI+  V    K +   R   L      K I +T G +G +
Sbjct: 215 EKIGATAVGGGLSAWNQPIEVIR--VEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLY 272

Query: 313 KGFVP 317
           +G  P
Sbjct: 273 RGVTP 277

>Scas_562.12
          Length = 300

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 67/150 (44%), Gaps = 17/150 (11%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 138
           P D +K++ QT+ ++ + +G      K    +GI   Y G+     GW    +      L
Sbjct: 138 PLDVLKIKRQTNPEAFKGRG----FVKILKDEGIFNLYRGW-----GWTAARNAPGSFAL 188

Query: 139 HNYRMLLKKYVYYNEE--KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTT 195
                  K+Y+   E+  +   S   IS ++       ++AP+++ K ++Q + +D   T
Sbjct: 189 FGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPET 248

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
             T    ++K  + + G+   +KGLT  L+
Sbjct: 249 GLT----IVKNTFKNEGITAFFKGLTPKLL 274

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVYKTFTQQGIRGFYLGF 120
           F+S +        V  P D IK R+Q       F  P   L  V  TF  +GI  F+ G 
Sbjct: 214 FISSIVGASCSLIVSAPLDVIKTRIQNRS----FDNPETGLTIVKNTFKNEGITAFFKGL 269

Query: 121 TPPLV 125
           TP L+
Sbjct: 270 TPKLL 274

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 55/128 (42%), Gaps = 10/128 (7%)

Query: 74  KNAVGHPFDTIKVRLQTSQD-STRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDS 132
           +  V +PF+  K RLQ +Q  S   + PL  +Y+T   QG    Y+G    +VG      
Sbjct: 24  EGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAG 83

Query: 133 VMLGCLHNYRMLLKKYVYYNEEKLPLSG--CIISGVMAGWSVSFIAA-PVELAKAKLQVQ 189
           V        R  L+      +E+  LSG   +++G+ AG   S +A  P E  K  L   
Sbjct: 84  VRFLGFDALRRALQ------DERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDD 137

Query: 190 YDAKTTKY 197
             A   +Y
Sbjct: 138 RQAARPRY 145

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 105/280 (37%), Gaps = 34/280 (12%)

Query: 88  LQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKK 147
           +Q    + RF    +   K    +G+   + G +  L+  I  + V       Y M    
Sbjct: 88  IQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFS---GYEMFRDH 144

Query: 148 YVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQV--QYDAKTTKYTGPVDVIK 205
                 +  P    +  G  A    +   AP+EL K +LQ   +    TT      D++K
Sbjct: 145 SPM--RDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLK 202

Query: 206 KVYS---SNGVRGLYKGLTSTLIFRTNF-VFWWGSYELLTR--W--FKEHT---NMS--- 251
           +  +   S G + L+KGL  TL     F   +WGSYE   +  W  F E     N+S   
Sbjct: 203 ETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNW 262

Query: 252 DTAINFWXXXXXXXXXXWTTAYPSDVIK---QVVL-CNDKYDGTFRSWK--LAAK----- 300
           D  IN +              +P DV K   Q+ +   +K   T  S K  ++A+     
Sbjct: 263 DFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKF 322

Query: 301 --DIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 338
             +I +T GY   + G +P  ++  P        +E   R
Sbjct: 323 LYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKR 362

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQD 93
           I  F+ G  SG +   + HPFD  K R+Q + D
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMD 298

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 74/171 (43%), Gaps = 21/171 (12%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           I GF  G+ S I    +  PFD +K RLQ  + ST +K  L  + +T +Q      + G 
Sbjct: 12  IGGFSGGLVSAI----ILQPFDLLKTRLQQDKTSTLWK-TLKSI-ETPSQ-----LWRGA 60

Query: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE------KLPLSGCIISGVMAGWSVSF 174
            P  +   +  ++ L  L++ R  + K             +L +   + SG +       
Sbjct: 61  LPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGL 120

Query: 175 IAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
           I  P+ + K    V+Y++   +YT        ++ + G+RG ++G  +T +
Sbjct: 121 ITMPITVIK----VRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATAL 167

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 270 TTAYPSDVIKQVVLCNDKYDGT---FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           T A    +   + +   +Y+ T   + S + A   I+RT G RGFF+GF  + LR  P
Sbjct: 114 TRALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAP 171

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118
           S ++   S   + +   ++  PFDT+K R+Q   +  +F       +   T++ +R  + 
Sbjct: 209 STLINGSSAFSAAVIATSITAPFDTVKTRMQL--EPAKFHSFTSTFWHIATKESVRNLFA 266

Query: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYV 149
           G +  L        +  G    Y  ++KK+V
Sbjct: 267 GISLRLTRKAFSAGIAWGI---YEEIVKKFV 294

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 1/62 (1%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           FVS +F   A   V  P D IK R+Q+    +   G    V  T   +G   F+ G TP 
Sbjct: 212 FVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESG-FTIVKNTLKNEGATAFFKGLTPK 270

Query: 124 LV 125
           L+
Sbjct: 271 LL 272

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 67/150 (44%), Gaps = 18/150 (12%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 138
           P D +K++ QT+ +S R +G L    +    +G+ G Y G+     GW    +      L
Sbjct: 137 PLDVLKIKRQTNPESFRGRGFL----RILRDEGM-GLYRGW-----GWTAARNAPGSFAL 186

Query: 139 HNYRMLLKKYV--YYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTT 195
                  K+Y+    +  +       +S +    +   ++AP+++ K ++Q + +++  +
Sbjct: 187 FGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAES 246

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            +T    ++K    + G    +KGLT  L+
Sbjct: 247 GFT----IVKNTLKNEGATAFFKGLTPKLL 272

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 270 TTAYPSDVIK---QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXX 326
           T AYP ++I+   QV    +  +  F S    AK I+  RG+RGFF G    +++  P  
Sbjct: 306 TAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMV 365

Query: 327 XXXXXXFE 334
                 +E
Sbjct: 366 ACSFFVYE 373

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDSTRFKGPLDCVYKTFTQQGIRGFYLG 119
            ++G  +G+A     +PF+ I+ RLQ    T+    +F    +     F ++G RGF++G
Sbjct: 294 LLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVG 353

Query: 120 FTPPLVGWILMDSVMLGC 137
            +   +G+I + + M+ C
Sbjct: 354 LS---IGYIKV-TPMVAC 367

 Score = 34.7 bits (78), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 77/211 (36%), Gaps = 42/211 (19%)

Query: 53  PPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ--TSQDSTRFKGPLDCVYKTFTQ 110
           P  E  +      SG  +G+      +P D I+VRL   T     R    +  +Y     
Sbjct: 145 PSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPAS 204

Query: 111 QGIR-------------GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY------ 151
           + +               FY G+ P ++G I    V       +  +L+  V        
Sbjct: 205 EALSSKAYVPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLR 264

Query: 152 -----------------NEEKLPLS--GCIISGVMAGWSVSFIAAPVELAKAKLQVQY-- 190
                              +++PL+    +++G +AG +    A P E+ + +LQV    
Sbjct: 265 VDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVT 324

Query: 191 DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
           +    K+T   ++ K ++   G RG + GL+
Sbjct: 325 NPLEHKFTSMSEMAKIIFHERGWRGFFVGLS 355

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%)

Query: 287 KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXXXXXXXFE 334
           KY G+F+    A   IW     RG F+G   + LR FP        +E
Sbjct: 90  KYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRIFPYAAVKFIAYE 137

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 19/172 (11%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQ----QGIRGF 116
           IMG VSG   G+A+  +   F T    ++ ++  +   G     +  F +    +GIRG 
Sbjct: 109 IMGGVSG---GVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGI 165

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYN--EEKLPLSGCIISGVMAGWSVSF 174
             G     +  +       G        L+K+      ++KL     I +  + G  +S 
Sbjct: 166 NKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGG-GLSA 224

Query: 175 IAAPVELAKAKLQVQYDAKTTKYTGPVDVI-----KKVYSSNGVRGLYKGLT 221
              P+E+    ++V+  +KT     P D+      + +Y SNGV+GLY+G+T
Sbjct: 225 WNQPIEV----IRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVT 272

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 33.5 bits (75), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 49  IQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQT-----SQDSTRFKGPLDC 103
           +  P  +  Y   MG +SG   G+A+  V +PFD ++ R Q      ++   R+K   D 
Sbjct: 3   VTDPNLANLYKLAMGAISG---GVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDA 58

Query: 104 VYKTFTQQGIRGFYLGFTPPL 124
           +      +G +G+Y G T  L
Sbjct: 59  LITIGKTEGPKGYYKGLTANL 79

>Kwal_33.15597
          Length = 305

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 57/146 (39%), Gaps = 6/146 (4%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K R+Q  + +   KG +    +  + +G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 140 NYRMLLKKYVYYNEE-KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYT 198
            ++ L    + Y++      S  I S  +A +       P+E  + +L  Q     T   
Sbjct: 92  VFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ----PTFAN 147

Query: 199 GPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G V    ++    G+   Y G T  L
Sbjct: 148 GLVGGFSRILKEEGLSSFYNGFTPIL 173

>Kwal_27.11626
          Length = 299

 Score = 34.7 bits (78), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           FVS +    A   V  P D IK R+Q         G    V  T   +GI  F+ G TP 
Sbjct: 212 FVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESG-FRIVQNTLKNEGITAFFKGLTPK 270

Query: 124 LV 125
           L+
Sbjct: 271 LL 272

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 64/150 (42%), Gaps = 18/150 (12%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 138
           P D +K++ QT+ +S + +G      K    +G  G Y G+     GW    +      L
Sbjct: 137 PLDVLKIKRQTNPESFKGRG----FIKILKDEGF-GLYRGW-----GWTAARNAPGSFAL 186

Query: 139 HNYRMLLKKYV--YYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQV-QYDAKTT 195
                  K+Y+    +      S   +S ++   +   ++AP+++ K ++Q   +D   +
Sbjct: 187 FGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPES 246

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            +     +++    + G+   +KGLT  L+
Sbjct: 247 GFR----IVQNTLKNEGITAFFKGLTPKLL 272

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 56/146 (38%), Gaps = 6/146 (4%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K R+Q  + +   KG +    +  + +G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 140 NYRMLLKKYVYYNEE-KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYT 198
            ++ L    + Y++      S  I S  +A +       P+E  + +L  Q     T   
Sbjct: 92  VFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ----PTFAN 147

Query: 199 GPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G V    ++    G    Y G T  L
Sbjct: 148 GLVGGFSRILKEEGAGSFYNGFTPIL 173

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 70/197 (35%), Gaps = 23/197 (11%)

Query: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218
           + C + GV+A         P++L K +LQV        Y   +D  K +  S G+  ++ 
Sbjct: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL----YRSNLDGWKTIVRSEGLSKVFT 71

Query: 219 GLTSTLI-FRTNFVFWWGSYELLTRWFKE-HTNMSDTAINFWXXXXXXXXXXWTTAYPSD 276
           G+ +T I +       +G YE    +FK+ ++N+                   +  + +D
Sbjct: 72  GVGATFIGYSLQGACKYGGYE----YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLAD 127

Query: 277 V---------IKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPXXX 327
           +         +KQ              W      I    G  G +KG  P + R  P   
Sbjct: 128 ILLCPWEAIKVKQQTTIPPFCKNFLEGW----SKITAAEGLSGLYKGITPLWCRQIPYTM 183

Query: 328 XXXXXFEFVLRTSGAKV 344
                FE ++    AK+
Sbjct: 184 CKFTSFERIVEMIYAKL 200

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 9/145 (6%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P++ IKV+ QT+      K  L+   K    +G+ G Y G TP     I           
Sbjct: 132 PWEAIKVKQQTTIPPF-CKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190

Query: 140 N-YRMLLKKYVYYNEEKLP---LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTT 195
               M+  K     +E  P   +    + G +AG   + ++ P ++  +K+    +A   
Sbjct: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV----NADRK 246

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGL 220
           +    V+  K++YS  G  GL+ GL
Sbjct: 247 QGESMVEASKRIYSRIGFGGLWNGL 271

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           F+S +    +   V  P D IK R+Q         G L  V  T   +G+  F+ G TP 
Sbjct: 214 FISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESG-LRIVKNTLKNEGVTAFFKGLTPK 272

Query: 124 LV 125
           L+
Sbjct: 273 LL 274

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 66/150 (44%), Gaps = 17/150 (11%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 138
           P D +K++ QT+ +S + +G      K    +G+   Y G+     GW    +      L
Sbjct: 138 PLDVLKIKRQTNPESFKGRG----FIKILRDEGLFNLYRGW-----GWTAARNAPGSFAL 188

Query: 139 HNYRMLLKKYVY--YNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTT 195
                  K+Y+    +  +   S   IS ++   S   ++AP+++ K ++Q + +D   +
Sbjct: 189 FGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPES 248

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
                + ++K    + GV   +KGLT  L+
Sbjct: 249 G----LRIVKNTLKNEGVTAFFKGLTPKLL 274

>Scas_673.17
          Length = 314

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 88/245 (35%), Gaps = 17/245 (6%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K R+Q  + +   KG +    K    +G      GF P L+G+ +  +   G   
Sbjct: 40  PVDVVKTRIQL-EPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYE 98

Query: 140 NYRML-LKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYT 198
            ++ L +    Y N      S  + S  +A +       P+E  + +L  Q     T   
Sbjct: 99  VFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQ----PTFAN 154

Query: 199 GPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF------VFWWGS--YELLTRWFKEHTNM 250
           G V    ++    GV   Y G T  L  +  +      VF   S  Y  +    +  ++M
Sbjct: 155 GLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDM 214

Query: 251 SDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRG 310
           ++T IN            + +  P+D +   V    K  G      LA   + +  G  G
Sbjct: 215 TNTGINLLSGLTAGFAAAFVSQ-PADTLLSKVNKTKKAPGQSTIGLLA--QLAKQLGVIG 271

Query: 311 FFKGF 315
            F G 
Sbjct: 272 SFAGL 276

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 65/151 (43%), Gaps = 12/151 (7%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P +  ++RL +    T   G +    +   ++G+  FY GFTP L   I  +        
Sbjct: 138 PLEATRIRLVS--QPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 195

Query: 140 NYRMLLKKYVYYNEEKLPLSGC---IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK 196
               +    V   E    ++     ++SG+ AG++ +F++ P +   +K+      KT K
Sbjct: 196 RASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVN-----KTKK 250

Query: 197 YTG--PVDVIKKVYSSNGVRGLYKGLTSTLI 225
             G   + ++ ++    GV G + GL + LI
Sbjct: 251 APGQSTIGLLAQLAKQLGVIGSFAGLPTRLI 281

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 82/184 (44%), Gaps = 12/184 (6%)

Query: 63  GFVSGMFSGIAKNAVGHPFDTI--KVRLQTSQDSTRFKGPLDCVYKTFTQ----QGIRGF 116
           G + G+  G+A+  +   F T    V +  S+ ++    P+    + F Q    +G+RG 
Sbjct: 110 GILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGI 169

Query: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY-YNEEKLPLSGCIISGVMAGWSVSFI 175
             G     +  +       G        +++  +  ++EKL     I++  + G  +S  
Sbjct: 170 NKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGG-GLSAW 228

Query: 176 AAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTL---IFRTNFV 231
             P+E+ + ++Q +  D    K        + +Y +NG+RGLY+G+T  +   +++T F+
Sbjct: 229 NQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRIGLGVWQTIFM 288

Query: 232 FWWG 235
             +G
Sbjct: 289 VGFG 292

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 57/146 (39%), Gaps = 6/146 (4%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K R+Q  + +   KG +    +  + +G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 140 NYRML-LKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYT 198
            ++ L +    Y N      +  I S  +A +       P+E  + +L  Q       + 
Sbjct: 92  LFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLFG 151

Query: 199 GPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G   ++K+     GV   Y G T  L
Sbjct: 152 GFSRILKE----EGVGSFYNGFTPIL 173

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 56/146 (38%), Gaps = 6/146 (4%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K R+Q  + +   KG +    K   ++G      GF P L+G+ +  +   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYE 91

Query: 140 NYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA-APVELAKAKLQVQYDAKTTKYT 198
            ++      + Y+      +   I    A   ++ IA  P+E  + +L  Q     T   
Sbjct: 92  VFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ----PTFAN 147

Query: 199 GPVDVIKKVYSSNGVRGLYKGLTSTL 224
           G V    ++    GV   Y G T  L
Sbjct: 148 GLVGGFSRILKEEGVGSFYSGFTPIL 173

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 102/271 (37%), Gaps = 42/271 (15%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           ++  +SG  +G + + V  P DT+K RLQ        KG        F   G RG Y G 
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQA-------KGGF------FRNGGYRGVYRGL 52

Query: 121 TPPLVG--------WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSV 172
              +V         +I  D+        +R LL      +     +   + S  M   + 
Sbjct: 53  GSAVVASAPGASLFFITYDTCKAETRGFFRGLLP-----SSNVADVVTHMFSSSMGEIAA 107

Query: 173 SFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV- 231
             +  P E+ K + Q    A  + +    +++K        R LY+G ++T++    F  
Sbjct: 108 CMVRVPAEVVKQRSQTH--ASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTC 165

Query: 232 FWWGSYELLTRWFKEHTNMSDTAINFWXXX---XXXXXXXWTTAYPSDVIK-QVVLCNDK 287
             +  YE + + + E  + SD  +  W               T  P D +K +++LC   
Sbjct: 166 IQFPLYEYMKKVWAE-LDESDR-VEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKS 223

Query: 288 YD-GTFRSWKLAAKDIWRTRGYRGFFKGFVP 317
              GT  S       I++  G++ FF G  P
Sbjct: 224 IPLGTLVS------TIYKEEGFKVFFSGVGP 248

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 98/267 (36%), Gaps = 34/267 (12%)

Query: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFT 121
           +  +SG  +G + + V  P DTIK RLQ        KG        F   G +G Y G  
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQA-------KGGF------FANGGYKGIYRGLG 52

Query: 122 PPLVGWILMDSVMLGCLHNYRM-----LLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA 176
             +V      S+        ++     + K Y   +E+ +  +  ++S  +       + 
Sbjct: 53  SAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVR 112

Query: 177 APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVR-GLYKGLTSTLIFRTNFV-FWW 234
            P E+ K + QV     T      +  I +  +  G+R  LY+G ++T++    F    +
Sbjct: 113 VPAEVVKQRTQVH---STNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQF 169

Query: 235 GSYELLTR-WFKEHTNMSDTAINFWXXX---XXXXXXXWTTAYPSDVIKQVVLCNDKYDG 290
             YE L + W K +     + +  W               T  P D +K  ++ N     
Sbjct: 170 PLYEYLKKTWAKAN---GQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNK---- 222

Query: 291 TFRSWKLAAKDIWRTRGYRGFFKGFVP 317
           T  S       I+R  G   FF G  P
Sbjct: 223 TTASLGSVIIRIYREEGPAVFFSGVGP 249

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 7/65 (10%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGP---LDCVYKTFTQQGIRGFYLGF 120
           FVS +    A   +  P D IK R+Q       F+ P      V  T   +G   F+ G 
Sbjct: 212 FVSSIVGASASLIISAPLDVIKTRIQNKN----FENPESGFTIVKNTLKNEGFSAFFKGL 267

Query: 121 TPPLV 125
           TP L+
Sbjct: 268 TPKLL 272

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 67/150 (44%), Gaps = 18/150 (12%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 138
           P D +K++ QT+ ++ + +G      K    +G+ G Y G+     GW    +      L
Sbjct: 137 PLDVLKIKRQTNPEAFKGRG----FVKILKDEGL-GLYRGW-----GWTAARNAPGSFAL 186

Query: 139 HNYRMLLKKYVY--YNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTT 195
                  K+Y+    +  +   S   +S ++   +   I+AP+++ K ++Q + ++   +
Sbjct: 187 FGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPES 246

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            +T    ++K    + G    +KGLT  L+
Sbjct: 247 GFT----IVKNTLKNEGFSAFFKGLTPKLL 272

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 163 ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTS 222
           I+G + G +   +  P+      LQ + +    K    ++ IK++Y+ NG+ G + GL S
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPK----LETIKEIYNKNGIIGYFLGLES 71

Query: 223 TL--IFRTNFVFWW 234
            +  +  TNFV+++
Sbjct: 72  AVYGMATTNFVYYY 85

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 67/150 (44%), Gaps = 17/150 (11%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG-CL 138
           P D +K++ QT+ ++ + +G L    K    +GI   Y G+     GW    +      L
Sbjct: 138 PLDVLKIKRQTNPEAFKGRGFL----KILKDEGIFNLYRGW-----GWTAARNAPGSFAL 188

Query: 139 HNYRMLLKKYVYYNEE--KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTT 195
                  K+Y+   ++  +   S   IS ++   +   ++AP+++ K ++Q + +D   +
Sbjct: 189 FGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPES 248

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225
            +     ++K    + G    +KGLT  L+
Sbjct: 249 GF----KIVKNTLKNEGFTAFFKGLTPKLL 274

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 1/62 (1%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           F+S +    A   V  P D IK R+Q         G    V  T   +G   F+ G TP 
Sbjct: 214 FISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG-FKIVKNTLKNEGFTAFFKGLTPK 272

Query: 124 LV 125
           L+
Sbjct: 273 LL 274

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 274 PSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           P DVIK  +  N  +D     +K+  K+  +  G+  FFKG  P  L + P
Sbjct: 230 PLDVIKTRI-QNRNFDNPESGFKIV-KNTLKNEGFTAFFKGLTPKLLTTGP 278

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 70/181 (38%), Gaps = 35/181 (19%)

Query: 50  QQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKG--PLDCVYKT 107
           Q   P  +   I GF  G+ S +A      P D +K R+Q  + +T +K    +D   + 
Sbjct: 4   QATKPRNSSHLIGGFFGGLTSAVAL----QPLDLLKTRIQQDKKATLWKNLKEIDSPLQ- 58

Query: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKK-------------YVYYNEE 154
                    + G  P  +   +  ++ L CL+  R  L K              VY    
Sbjct: 59  --------LWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSS 110

Query: 155 KLP---LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSN 211
            LP   +   +++G  A   V +I  P+ + K    V+Y++    Y+   + I  +Y+  
Sbjct: 111 SLPRLTMYENLLTGAFARGLVGYITMPITVIK----VRYESTLYNYSSLKEAITHIYTKE 166

Query: 212 G 212
           G
Sbjct: 167 G 167

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 143 MLLKKYVYYNEE-----KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKY 197
           +L  ++++YN E         +    S V++    + + AP +  K ++Q++     +K+
Sbjct: 203 VLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLE----PSKF 258

Query: 198 TGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV--FWWGSYELLTRWF 244
           T   +    +  +  V  L+ GL+  L  R  F     WG YE L + F
Sbjct: 259 TNSFNTFTSIVKNENVLKLFSGLSMRLA-RKAFSAGIAWGIYEELVKRF 306

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 50/255 (19%), Positives = 99/255 (38%), Gaps = 25/255 (9%)

Query: 77  VGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLG 136
           +G P + +K    T+  + R    L      +++ GI GFY G  P    W  +++   G
Sbjct: 29  LGQPLEVVK----TTMAAHREFNFLQATKHVWSRGGIFGFYQGLIP----WAWIEASTKG 80

Query: 137 CLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK 196
            +  +     +Y +           I+ G+  G + +++          +++    K   
Sbjct: 81  AVLLFVSAEAEYRFKVLGLNNFGAGIMGGITGGVTQAYLTMGFCTCMKTVEITRQ-KAAN 139

Query: 197 YTGPV-----DVIKKVYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKEHTNM 250
             G +      V K +Y   G+RG+ KG+ +  I + TN+   +G   L+    ++ T  
Sbjct: 140 VPGVIPQSSWQVFKSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGK 199

Query: 251 S--DTAINFWXXXXXXXXXXWTTAY--PSDVIKQVVLCNDKYDGTFRSWKLAA----KDI 302
           +  D  +               +A+  P +VI+  V    K +   R   L      K I
Sbjct: 200 TGKDDKLTALEKIMASAIGGGLSAWNQPIEVIR--VEMQSKKEDPNRPKNLTVGKTFKYI 257

Query: 303 WRTRGYRGFFKGFVP 317
           +++ G +G ++G  P
Sbjct: 258 YQSNGLKGLYRGVTP 272

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 9/77 (11%)

Query: 163 ISGVMAGWSVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLT 221
           I G ++ W+      P+E+ + ++Q +  D    K        K +Y SNG++GLY+G+T
Sbjct: 217 IGGGLSAWN-----QPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVT 271

Query: 222 STL---IFRTNFVFWWG 235
             +   I++T F+  +G
Sbjct: 272 PRVGLGIWQTVFMVGFG 288

>Scas_702.10
          Length = 302

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 100/269 (37%), Gaps = 24/269 (8%)

Query: 67  GMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVG 126
           G  +GI    + HP D  KVRLQ +       G +  +      + + G Y G +  ++ 
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRM--LTTILRNENVMGLYSGLSAAVLR 73

Query: 127 WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKL 186
                +V  G     +  L    + N+    L   + SG + G   +F     ++   ++
Sbjct: 74  QCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNF----ADVVNIRM 129

Query: 187 QVQYDAKTT---KYTGPVDVIKKVY-SSNGVRGLYKG-----LTSTLIFRTNFVFW--WG 235
           Q     K      Y   +D + K+Y    G++ L  G     +   L+  +  V +  + 
Sbjct: 130 QNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFK 189

Query: 236 SYELLTRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYDGTFRSW 295
           +Y +    F    N +  + +             T   P+DVIK  ++   K +    + 
Sbjct: 190 NYLVTKLSFDPKKNSTHLSASLLAGLVAT-----TICSPADVIKTRIMNAHKTESE-SAI 243

Query: 296 KLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
           K+    I +  G    F+G++P F R  P
Sbjct: 244 KILTSAI-KKEGPSFMFRGWLPIFTRLGP 271

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 1/62 (1%)

Query: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123
           FVS +    A   V  P D IK R+Q         G    +  T   +G   F+ G TP 
Sbjct: 213 FVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG-FKIIKNTLKNEGFTAFFKGLTPK 271

Query: 124 LV 125
           L+
Sbjct: 272 LL 273

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 112/294 (38%), Gaps = 56/294 (19%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCV-YKTFTQQGIRGFY 117
           +R++G  S   +GI +  V HP DTI  RL ++         L+ V ++ F  +      
Sbjct: 12  ARVLGSAS---AGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASE------ 62

Query: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY-----------------YNEEKLPLSG 160
                PL   +L     LG    Y++L + Y Y                 +++     +G
Sbjct: 63  -----PLGRRLLSLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTG 117

Query: 161 CIISGVMAGWSV---SFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLY 217
             +    AG  +     +  P+++ K K Q   + ++ K  G + +IK      G  GLY
Sbjct: 118 KALRSATAGSLIGIGEIVLLPLDVLKIKRQT--NPESFKGRGFLKIIK----DEGF-GLY 170

Query: 218 KGL--TSTLIFRTNFVFWWGSYELLTRWFKEHT-NMSDTAINFWX----XXXXXXXXXWT 270
           +G   T+      +F  + G+      + KE+   + D     W                
Sbjct: 171 RGWGWTAARNAPGSFALFGGNA-----FAKEYILGLKDYGQATWSQNFVSSIVGASASLI 225

Query: 271 TAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324
            + P DVIK  +  N  +D     +K+  K+  +  G+  FFKG  P  L + P
Sbjct: 226 VSAPLDVIKTRI-QNRNFDNPESGFKII-KNTLKNEGFTAFFKGLTPKLLTTGP 277

>Scas_671.1*
          Length = 123

 Score = 30.4 bits (67), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 55 SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ 89
          S + S ++  VS + S     A+  PFDTIK R+Q
Sbjct: 34 STSTSTVVNSVSAIASASLATAITAPFDTIKTRMQ 68

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 92/268 (34%), Gaps = 34/268 (12%)

Query: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGF 120
           I   VSG  +G + +    P DT+K RLQ        KG        F   G +G Y G 
Sbjct: 7   IASLVSGAAAGTSTDLAFFPIDTLKTRLQA-------KGGF------FANGGYKGVYRGL 53

Query: 121 TPPLVG--------WILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSV 172
              +V         ++  DS+          LL K      + L     ++S      S 
Sbjct: 54  GSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTL---SHMVSSSFGEISA 110

Query: 173 SFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV-RGLYKGLTSTLIFRTNFV 231
             +  P E+ K + Q     +T      +  + +  +  G+ R LY+G ++T++    F 
Sbjct: 111 CMVRVPAEVIKQRTQTH---RTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFT 167

Query: 232 -FWWGSYELL-TRWFKEHTNMSDTAINFWXXXXXXXXXXWTTAYPSDVIKQVVLCNDKYD 289
              +  YE +  RW +                            P DV+K  ++ + K  
Sbjct: 168 CIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSV 227

Query: 290 GTFRSWKLAAKDIWRTRGYRGFFKGFVP 317
                    AK + +  G + FF G  P
Sbjct: 228 SALH----LAKTMLQEEGVKVFFSGVGP 251

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 31.6 bits (70), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 63/158 (39%), Gaps = 28/158 (17%)

Query: 96  RFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEK 155
           +F G L+   K    +G+   + G +  L+  I  + V                 Y  ++
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYE-----------YVRDR 157

Query: 156 LPLSGC------IISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPV----DVIK 205
            PL+G       +I G  A    +   AP+EL K KL  Q    ++   G V    D+  
Sbjct: 158 SPLNGLYPTINPLICGAFARTLAATSVAPLELIKTKL--QSIPSSSMKNGSVIMYRDLFN 215

Query: 206 KVYSSNGVRG----LYKGLTSTLIFRTNF-VFWWGSYE 238
           ++ S   +RG    ++KGL  TL     F   +W SYE
Sbjct: 216 EIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYE 253

>Sklu_1982.3 YDL238C, Contig c1982 3793-5223
          Length = 476

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 20/35 (57%)

Query: 288 YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRS 322
           YD + + W++   D +R +G   FF GFV + + +
Sbjct: 60  YDASLKPWEIGVVDTFREQGSTFFFPGFVDTHVHA 94

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 55/148 (37%), Gaps = 10/148 (6%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P D +K R+Q  +      G +    K   ++G      GF P L+G+ +  +   G   
Sbjct: 35  PIDVVKTRIQL-EPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYE 93

Query: 140 NYRMLLKKYVYYN---EEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTK 196
            ++      + Y    + + P+   I S  +A +       P+E  + +L  Q     T 
Sbjct: 94  VFKKAFVDALGYETACQYRTPIY--IGSAAIAEFFADIALCPLEATRIRLVSQ----PTF 147

Query: 197 YTGPVDVIKKVYSSNGVRGLYKGLTSTL 224
             G V    ++    G+   Y G T  L
Sbjct: 148 ANGLVGGFARILKEEGIGSFYNGFTPIL 175

>Kwal_23.5757
          Length = 307

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 62/164 (37%), Gaps = 9/164 (5%)

Query: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139
           P++ IKVR QT+      +   D   K    +G    Y G TP     I           
Sbjct: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195

Query: 140 N-YRMLLKKYVYYNEEKLPLSGCIIS---GVMAGWSVSFIAAPVELAKAKLQVQYDAKTT 195
               M+  +      E   L    +S   G +AG   + ++ P ++  +K  V  + K+ 
Sbjct: 196 RIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK--VNNERKSG 253

Query: 196 KYTGPVDVIKKVYSSNGVRGLYKGLT-STLIFRTNFVFWWGSYE 238
           + T  +    ++Y   G  GL+ GL    L+  T   F W  Y+
Sbjct: 254 EST--LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

>Kwal_0.232
          Length = 274

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 55/271 (20%), Positives = 95/271 (35%), Gaps = 37/271 (13%)

Query: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118
           S I   ++G  +G + +    P DT+K RLQ +                F   G  G Y 
Sbjct: 5   SFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAGG-------------FFANGGYLGVYR 51

Query: 119 GFTPPLVGWILMDSVML----GCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSF 174
           G    +V      S+      G     R +    +  +++    +  + S      +   
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 175 IAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVY-SSNGV---RGLYKGLTSTLIFRTNF 230
           +  P E+ K + Q      T K    +  +KK+  + NG    R LY+G ++T++    F
Sbjct: 112 VRVPAEVIKQRTQ------THKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPF 165

Query: 231 V-FWWGSYELLTRWFKEHTNMSDTAINFWXXX---XXXXXXXWTTAYPSDVIKQVVLCND 286
               +  YE L + +         A   W               T  P DV+K  ++ + 
Sbjct: 166 TCIQFPLYEFLKKQWAISGGREQVAP--WQGAFCGCVAGGIAAATTTPLDVLKTRLMLSH 223

Query: 287 KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVP 317
                       A+ I+ T G++ FF G  P
Sbjct: 224 TSVPVLH----LARQIYATEGWKVFFSGVGP 250

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,857,596
Number of extensions: 379310
Number of successful extensions: 2320
Number of sequences better than 10.0: 209
Number of HSP's gapped: 1575
Number of HSP's successfully gapped: 449
Length of query: 345
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 243
Effective length of database: 13,065,073
Effective search space: 3174812739
Effective search space used: 3174812739
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)