Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2075.21131135093e-68
Kwal_33.154481131071901e-19
KLLA0D09669g1351191851e-18
Scas_647.5116101985e-06
YJR012C20750963e-05
Kwal_33.1483538446621.1
YOL122C (SMF1)57537611.8
CAGL0H10604g41625601.9
Scas_709.3282247583.7
CAGL0C03982g62965574.9
CAGL0H05533g190434569.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2075.2
         (113 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2075.2 YJR012C, Contig c2075 940-1281                            200   3e-68
Kwal_33.15448                                                          78   1e-19
KLLA0D09669g 816343..816750 no similarity, hypothetical start          76   1e-18
Scas_647.5                                                             42   5e-06
YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protei...    42   3e-05
Kwal_33.14835                                                          28   1.1  
YOL122C (SMF1) [4701] chr15 complement(89691..91418) General met...    28   1.8  
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    28   1.9  
Scas_709.32                                                            27   3.7  
CAGL0C03982g complement(391909..393798) similar to sp|P40549 Sac...    27   4.9  
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...    26   9.1  

>Sklu_2075.2 YJR012C, Contig c2075 940-1281
          Length = 113

 Score =  200 bits (509), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 99/113 (87%), Positives = 99/113 (87%)

Query: 1   MNRQLSYEELVDHIXXXXXXXXXXXXXXITLDSSMRTESLLKPRLKPWERKAQGATVEEP 60
           MNRQLSYEELVDHI              ITLDSSMRTESLLKPRLKPWERKAQGATVEEP
Sbjct: 1   MNRQLSYEELVDHIVNNKPVPNVVSVPNITLDSSMRTESLLKPRLKPWERKAQGATVEEP 60

Query: 61  QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHFMDGSGKDATA 113
           QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHFMDGSGKDATA
Sbjct: 61  QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHFMDGSGKDATA 113

>Kwal_33.15448
          Length = 113

 Score = 77.8 bits (190), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 2   NRQLSYEELVDHIXXXXXXXXXXXXXXITLDSSMRTESLLKPRLKPWERKAQ-GATVEEP 60
            +QL+YEELVDHI              IT D S+ T+S L+PR KPWE+K +   T+E  
Sbjct: 3   GQQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIEGA 62

Query: 61  QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHFMDGS 107
            +   +A+ I     +V+ + S ESLS YYA+E EFE+Q+Q ++ G+
Sbjct: 63  SD---EAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSYLGGN 106

>KLLA0D09669g 816343..816750 no similarity, hypothetical start
          Length = 135

 Score = 75.9 bits (185), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 64/119 (53%), Gaps = 13/119 (10%)

Query: 4   QLSYEELVDHIXXXXXXXXXXXXXXITLDSSMRTESLLKPRLKPWER----KAQGATVEE 59
           +LSY+EL+D I              I LD S+ TE  LKPRLKPWE+       G  V +
Sbjct: 9   ELSYDELMDIIVNNKPVPNVVDVPDIILDQSLATEHHLKPRLKPWEQAKDVPVMGGLVRQ 68

Query: 60  PQELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHF-----MDGSGKDATA 113
            +E     K + E+VE V K+ S E L+ YYA+E EF+KQL+ +     + G G+ + A
Sbjct: 69  KEE----TKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYESSTGLKGRGRSSAA 123

>Scas_647.5
          Length = 116

 Score = 42.4 bits (98), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 4/101 (3%)

Query: 1   MNRQLSYEELVDHIXXXXXXXXXXXXXXITLDSSMRTESLLKPRLKPWERKAQGATVEEP 60
           M+ +LSY++LV+HI                LDS + ++  L  R+KPWE+  + A  E P
Sbjct: 1   MSEELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQ-VEVAGEETP 59

Query: 61  QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQ 101
                    +     + + ++  ++LS+ YA+EA++   LQ
Sbjct: 60  ---TNDNFGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQ 97

>YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protein
           of unknown function [624 bp, 207 aa]
          Length = 207

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 4   QLSYEELVDHIXXXXXXXXXXXXXXITLDSSMRTESLLKPRLKPWERKAQ 53
           +LSYEEL+DHI              +TLD  + +   L+PR +PWE + Q
Sbjct: 81  ELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRPRPRPWEGQLQ 130

>Kwal_33.14835
          Length = 384

 Score = 28.5 bits (62), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 37 TESLLKPRLKPWERKAQGATVEEPQELIQKAKEITEHVESVNKTQS 82
          + S++KPR KPWE +A         + I  + E+ E++ S   T +
Sbjct: 2  SSSVVKPRAKPWETQAS-------HDAIIPSGELQENISSTTNTDA 40

>YOL122C (SMF1) [4701] chr15 complement(89691..91418) General metal
           ion transporter with high affinity for manganese [1728
           bp, 575 aa]
          Length = 575

 Score = 28.1 bits (61), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 39  SLLKPRLKPWERKAQGATVEEPQELIQKAKEITEHVE 75
           +L++PRL  ++ K    TV E Q+ ++K+K   E +E
Sbjct: 285 ALVQPRLLDYDVKHGNYTVSEEQDKVKKSKSTEEIME 321

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
          Saccharomyces cerevisiae YNL016w PUB1, hypothetical
          start
          Length = 416

 Score = 27.7 bits (60), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 19/25 (76%)

Query: 57 VEEPQELIQKAKEITEHVESVNKTQ 81
          +E P+E+I+K +E+++ VE  N +Q
Sbjct: 10 IETPEEVIEKPEEVSQEVEGDNASQ 34

>Scas_709.32
          Length = 822

 Score = 26.9 bits (58), Expect = 3.7,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 41 LKPRLKPWERKAQGATVEEPQELIQKAKEITEHVESVNKTQSFESLS 87
          L+ R KP+E   + +++   QEL+ +A+  T  + S N  Q F+S S
Sbjct: 31 LQNREKPFEESKKNSSMSFNQELLSQAQSPT--INSFNINQPFQSSS 75

>CAGL0C03982g complement(391909..393798) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 629

 Score = 26.6 bits (57), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 29  ITLDSSMRTESLLKPRLKPWERKAQGATVEEPQELIQKAKEITEHVESVNKTQSFESLSR 88
           ITL  +     LL+   K  +R+      E P ++IQK  E+T  +ES+ K  + E+   
Sbjct: 241 ITLTIAPGDIKLLRSLFKVLQRQGN----EYPVQIIQKGGEMTPKMESLIKKYALETEQD 296

Query: 89  YYAIE 93
            Y I+
Sbjct: 297 VYIID 301

>CAGL0H05533g 538045..543759 highly similar to sp|P32333
           Saccharomyces cerevisiae YPL082c MOT1, start by
           similarity
          Length = 1904

 Score = 26.2 bits (56), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 33  SSMRTESLLKPRLKPWERKAQGATVEEPQELIQK 66
           SS+   S L P+L P  R    +  EEP E +QK
Sbjct: 963 SSVLMFSELPPKLNPIIRSLMDSVKEEPNEALQK 996

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,858,621
Number of extensions: 87849
Number of successful extensions: 425
Number of sequences better than 10.0: 34
Number of HSP's gapped: 422
Number of HSP's successfully gapped: 34
Length of query: 113
Length of database: 16,596,109
Length adjustment: 83
Effective length of query: 30
Effective length of database: 13,722,815
Effective search space: 411684450
Effective search space used: 411684450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)