Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2014.488883516e-45
Kwal_33.1544288862129e-24
YJR010C-A (SPC1)94872015e-22
Scas_647.390881668e-17
AGR325C91861563e-15
KLLA0E09724g91821399e-13
CAGL0H04169g69838563.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2014.4
         (88 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement      139   6e-45
Kwal_33.15442                                                          86   9e-24
YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit...    82   5e-22
Scas_647.3                                                             69   8e-17
AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH] (1337706....    65   3e-15
KLLA0E09724g 862612..862887 weakly similar to sp|P46965 Saccharo...    58   9e-13
CAGL0H04169g 394311..396407 similar to sp|Q04533 Saccharomyces c...    26   3.6  

>Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement
          Length = 88

 Score =  139 bits (351), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 71/88 (80%), Positives = 71/88 (80%)

Query: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATXXXXXXXXX 60
          MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLAT         
Sbjct: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATLVYCYGACC 60

Query: 61 XXXXXXXXPSYPTYNKRRLKWAGTKIET 88
                  PSYPTYNKRRLKWAGTKIET
Sbjct: 61 LLCLLLVLPSYPTYNKRRLKWAGTKIET 88

>Kwal_33.15442
          Length = 88

 Score = 86.3 bits (212), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 51/86 (59%)

Query: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATXXXXXXXXX 60
          MSE+LQEI + +VFPIDF SQ+ T++L  R L FGT+ +C IG  TQSLA          
Sbjct: 1  MSEVLQEIQKKLVFPIDFASQRETDRLVNRTLIFGTIAACFIGLFTQSLANLMMSFGVSL 60

Query: 61 XXXXXXXXPSYPTYNKRRLKWAGTKI 86
                  PSY  YNKRR +W  TKI
Sbjct: 61 ALCFAAVLPSYSAYNKRRPEWVKTKI 86

>YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit
          of the signal peptidase complex [285 bp, 94 aa]
          Length = 94

 Score = 82.0 bits (201), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 51/87 (58%)

Query: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATXXXXXXXXX 60
          MSE+LQ++ R +VFPIDFPSQ+ TEK     L  G +V+C +GF  QSL           
Sbjct: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60

Query: 61 XXXXXXXXPSYPTYNKRRLKWAGTKIE 87
                  P+YP YNK++L+WA  KIE
Sbjct: 61 VITLICVLPAYPWYNKQKLRWAQPKIE 87

>Scas_647.3
          Length = 90

 Score = 68.6 bits (166), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 46/88 (52%)

Query: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATXXXXXXXXX 60
          MS +L EI + +V PIDFPSQ+ T +L   IL  G + +   GF+TQSL           
Sbjct: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGVTF 60

Query: 61 XXXXXXXXPSYPTYNKRRLKWAGTKIET 88
                  P YP YNK++L+W   K+ T
Sbjct: 61 VVTLLLVVPPYPFYNKQKLQWVQPKLAT 88

>AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH]
          (1337706..1337981) [276 bp, 91 aa]
          Length = 91

 Score = 64.7 bits (156), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%)

Query: 3  ELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATXXXXXXXXXXX 62
          E+  ++SR +VFPID+PSQ+   KL   IL  GT+VSC +GF   SL+            
Sbjct: 2  EIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSLTLYAFAAAYGL 61

Query: 63 XXXXXXPSYPTYNKRRLKWAGTKIET 88
                P+Y  Y +++L W G+   T
Sbjct: 62 ALLLVVPAYGKYRQQKLAWVGSAAAT 87

>KLLA0E09724g 862612..862887 weakly similar to sp|P46965
          Saccharomyces cerevisiae YJR010ca SPC1 signal peptidase
          10.8 kDa subunit singleton, hypothetical start
          Length = 91

 Score = 58.2 bits (139), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%)

Query: 3  ELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATXXXXXXXXXXX 62
          E+LQ++ R +VFPIDF SQ YTE ++ + L   T  S   G++T+S+             
Sbjct: 2  EVLQDLGRQLVFPIDFESQSYTESISNKALYLITFFSFISGYLTESIKVSGIVFVLGLIV 61

Query: 63 XXXXXXPSYPTYNKRRLKWAGT 84
                P Y  YNK R +WA +
Sbjct: 62 VLVIVLPPYSAYNKHRPQWANS 83

>CAGL0H04169g 394311..396407 similar to sp|Q04533 Saccharomyces
           cerevisiae YML082w, start by similarity
          Length = 698

 Score = 26.2 bits (56), Expect = 3.6,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 5   LQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSI 42
           L+E+S + VFPI F     +  L   IL +G ++  S+
Sbjct: 455 LKELSDLFVFPIIFDISMGSGVLNYNILKYGDIICMSL 492

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,945,657
Number of extensions: 40190
Number of successful extensions: 76
Number of sequences better than 10.0: 7
Number of HSP's gapped: 70
Number of HSP's successfully gapped: 7
Length of query: 88
Length of database: 16,596,109
Length adjustment: 60
Effective length of query: 28
Effective length of database: 14,519,029
Effective search space: 406532812
Effective search space used: 406532812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)