Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2014.363163132740.0
Kwal_33.1543858057319010.0
Scas_617.558158018060.0
KLLA0E09746g58057617320.0
YGR194C (XKS1)60058617100.0
CAGL0G09339g58258215960.0
AGR324C56457515140.0
YOR017W (PET127)80046702.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2014.3
         (631 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement       1265   0.0  
Kwal_33.15438                                                         736   0.0  
Scas_617.5                                                            700   0.0  
KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces c...   671   0.0  
YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...   663   0.0  
CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces c...   619   0.0  
AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH] (1335916..1...   587   0.0  
YOR017W (PET127) [4830] chr15 (361411..363813) Mitochondrial mem...    32   2.6  

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score = 1265 bits (3274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/631 (96%), Positives = 607/631 (96%)

Query: 1   MIYRICMYLYTFSYKWRGINILYLSDSSTQTPQPTNRSLDRMTKENNDNNKGNDPSSGYF 60
           MIYRICMYLYTFSYKWRGINILYLSDSSTQTPQPTNRSLDRMTKENNDNNKGNDPSSGYF
Sbjct: 1   MIYRICMYLYTFSYKWRGINILYLSDSSTQTPQPTNRSLDRMTKENNDNNKGNDPSSGYF 60

Query: 61  LGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWCDA 120
           LGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWCDA
Sbjct: 61  LGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWCDA 120

Query: 121 LDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDXXXXXXXXXXPKAF 180
           LDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLD          PKAF
Sbjct: 121 LDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDAQQTLLTQLAPKAF 180

Query: 181 SRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPEVYAN 240
           SRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPEVYAN
Sbjct: 181 SRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPEVYAN 240

Query: 241 TANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIKRKLK 300
           TANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIKRKLK
Sbjct: 241 TANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIKRKLK 300

Query: 301 GSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSLGTST 360
           GSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSLGTST
Sbjct: 301 GSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSLGTST 360

Query: 361 TILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHSWDPFNKAL 420
           TILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHSWDPFNKAL
Sbjct: 361 TILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHSWDPFNKAL 420

Query: 421 LDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKHDVKNIVE 480
           LDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKHDVKNIVE
Sbjct: 421 LDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKHDVKNIVE 480

Query: 481 SQALSCRVRISPLLXXXXXXXXXXXXXXYTVKFDYDTFPISEYRKRPRRAFFVGGASRND 540
           SQALSCRVRISPLL              YTVKFDYDTFPISEYRKRPRRAFFVGGASRND
Sbjct: 481 SQALSCRVRISPLLSDNCAAASNNSSTSYTVKFDYDTFPISEYRKRPRRAFFVGGASRND 540

Query: 541 AIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLFLNEHFDWQH 600
           AIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLFLNEHFDWQH
Sbjct: 541 AIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLFLNEHFDWQH 600

Query: 601 DAEFICDSETESWEYYNTKIQALSALEATLE 631
           DAEFICDSETESWEYYNTKIQALSALEATLE
Sbjct: 601 DAEFICDSETESWEYYNTKIQALSALEATLE 631

>Kwal_33.15438
          Length = 580

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/573 (61%), Positives = 429/573 (74%), Gaps = 3/573 (0%)

Query: 60  FLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWCD 119
           +LGFDLSTQQLKCLV+DQ L+L+HSE ++FD+DL  Y T KGVY  DDG++E PVAMW +
Sbjct: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68

Query: 120 ALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDXXXXXXXXXXPKA 179
           ALD +F  ++      L  V  +SGSCQQHGSVYW+++G + L  LD          P A
Sbjct: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSLKDQLFPDA 128

Query: 180 FSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPEVYA 239
           FSRSVAPNWQDHSTG+EC+ FE S GGP  LA +TGSRAH+RFTGPQ+ K++ +EPEVY 
Sbjct: 129 FSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEVYR 188

Query: 240 NTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIKRKL 299
            TA I+LVS+FLAS+L G    LEEADACGMNLY+I  RDY+  LL+NID D+  ++ KL
Sbjct: 189 KTAKISLVSSFLASVLAGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLREKL 248

Query: 300 KGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSLGTS 359
            G+P   D   P+  +SSY+V++YGLN  CQVFPFTGDNLATICSL LK NDVLVSLGTS
Sbjct: 249 GGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLGTS 308

Query: 360 TTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHSWDPFNKA 419
           TTIL+VTDQY+PSPNYHLFIHPTIP  YMGMICYCNG+LARE +RD LS  H W+PFN A
Sbjct: 309 TTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSDSHDWEPFNAA 368

Query: 420 LLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSD--NDINLEPVEQFSDIKHDVKN 477
           +  ++++N +EI  YFPL EIVP+V S  +RA F KS+  + + L  +E F+++ HD +N
Sbjct: 369 VTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVAHDARN 428

Query: 478 IVESQALSCRVRISPLLXXXXXXXXXXXXXXYTVKFDYDTFPISEYRKRPRRAFFVGGAS 537
           IVESQALSCRVRISPLL                V FDYD FP+SEYRKRPRRAFFVGGAS
Sbjct: 429 IVESQALSCRVRISPLLSSDCTDTNSEMGDS-KVLFDYDNFPLSEYRKRPRRAFFVGGAS 487

Query: 538 RNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLFLNEHFD 597
           +NDAIV  FAQV+GAT+GN++LETPNSCALGGCY+ALWS+++        FD FLNE F 
Sbjct: 488 KNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQFLNEAFR 547

Query: 598 WQHDAEFICDSETESWEYYNTKIQALSALEATL 630
           W  D + +  ++ + W++YNTKIQALS LE TL
Sbjct: 548 WDFDVQSLGLTDEKDWKHYNTKIQALSELEKTL 580

>Scas_617.5
          Length = 581

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/580 (59%), Positives = 425/580 (73%), Gaps = 12/580 (2%)

Query: 59  YFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMWC 118
           Y+LG DLSTQQLK L +++ L++V +E VDFD++LP Y+T KGVY N +  IE PV MW 
Sbjct: 6   YYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGN-DIECPVGMWL 64

Query: 119 DALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNL--DXXXXXXXXXX 176
           +ALD LF     +  FSL+ V  ISGSCQQHGSVYWS++    L+NL  D          
Sbjct: 65  EALDLLFEKFKKKG-FSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVSHLI 123

Query: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236
           P AFSR  APNWQDHSTG++C+ FE   GGPQ LA ITGSRAH+RFTGPQI K+A +EP 
Sbjct: 124 PDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEKEPG 183

Query: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIK 296
            YANT++++LVS+F+ SLLCG + PLEEAD+CGMNLYDI  R ++  LL  ID + ++I+
Sbjct: 184 NYANTSSVSLVSSFITSLLCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNEDNIR 243

Query: 297 RKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSL 356
            KL   P   D    L  +S Y+V++YG NP C +FP TGDNLATICSLPLK NDVLVSL
Sbjct: 244 TKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDVLVSL 303

Query: 357 GTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLS---ADHSW 413
           GTSTTIL+VT+QY PSPNYHLFIHPTIP  YMGMICYCNG+LARE +RD L+     +SW
Sbjct: 304 GTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGEGNSW 363

Query: 414 DPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKH 473
           + FN+A+LD ++DN DE+G+YFPL EIVPSV +  KRAKF K+  +I    V++F++ KH
Sbjct: 364 NLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIK-AIVDEFANKKH 422

Query: 474 DVKNIVESQALSCRVRISPLLXXXXXXXXXXXXXXY--TVKFDYDTFPISEY-RKRPRRA 530
           D KNIVESQALSCR+RISPLL                 TVKFDY   PIS+Y  KRP RA
Sbjct: 423 DAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKRPNRA 482

Query: 531 FFVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDL 590
           FFVGGAS+NDAIV+ FAQ+IGA EGNY+LETPNSCALGGCYKA+WS +Y  G TK SFD+
Sbjct: 483 FFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKESFDV 542

Query: 591 FLNEHFDWQHDAEFICDSETESWEYYNTKIQALSALEATL 630
           +L++HF W  + E IC+ + ++WE YN KI  +S LEA L
Sbjct: 543 YLDKHFPW-GEVERICEPDEKAWELYNKKIVPMSHLEALL 581

>KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase singleton, start by
           similarity
          Length = 580

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/576 (57%), Positives = 401/576 (69%), Gaps = 10/576 (1%)

Query: 57  SGYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAM 116
           SGY+LGFDLSTQQLKCL +D QL +V +  ++FD+D P Y+T KGVY  D+G I+APVAM
Sbjct: 4   SGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAPVAM 63

Query: 117 WCDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDXXXXXXXXXX 176
           W +A+D  F  L       L +V  +SGSCQQHG+V+W+ D    L              
Sbjct: 64  WLEAIDLCFERLGK--CIDLKKVKSMSGSCQQHGTVFWNCD---HLPKDLQPSSNLVKQL 118

Query: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236
              FSR VAPNWQDHST  +C       GGPQ LA ITGS +HYRF+G QI KV   EPE
Sbjct: 119 ASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPE 178

Query: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIK 296
           VYANT  I+LVS+FLAS+L G I PLEEADACGMNLY I   +++  LL  +D D+ SIK
Sbjct: 179 VYANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIK 238

Query: 297 RKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSL 356
           RKL   PT +D    L  VS+Y+  +YG+NP CQ++PFTGDNLATICSLPL+KNDVL+SL
Sbjct: 239 RKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVLISL 298

Query: 357 GTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSAD---HSW 413
           GTSTTIL++TDQY+ SPNYHLFIHPT+P  YMGMICYCNGSLARE +RD ++ +   H W
Sbjct: 299 GTSTTILLITDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDW 358

Query: 414 DPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKH 473
             FN+ALLD+S+ N +EIG+YFPL EIVP++ + TKR  F   DN + L  V  F D + 
Sbjct: 359 TKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFPDKRL 418

Query: 474 DVKNIVESQALSCRVRISPLLXXXXXX--XXXXXXXXYTVKFDYDTFPISEYRKRPRRAF 531
           D KNIVESQALSCRVRISPLL                  VKFDYD FP++ Y KRP RAF
Sbjct: 419 DAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRAF 478

Query: 532 FVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLF 591
           FVGGAS+N+AI++T A VIGA  GNY+LET NSCALGGCYKALWS +        SFD +
Sbjct: 479 FVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDRW 538

Query: 592 LNEHFDWQHDAEFICDSETESWEYYNTKIQALSALE 627
           LN  F+W+ D EF+C+S+   WE YN KI+ LS +E
Sbjct: 539 LNAFFNWERDCEFVCNSDAAKWENYNNKIRTLSEIE 574

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/586 (56%), Positives = 404/586 (68%), Gaps = 20/586 (3%)

Query: 58  GYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMW 117
            Y+LGFDLSTQQLKCL ++Q L++VHSE V+F++DLP YHT KGVY + D +IE PVAMW
Sbjct: 21  SYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECPVAMW 79

Query: 118 CDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDXXXXXXXX--X 175
            +ALD L      +  F L++V+ +SGSCQQHGSVYWS   E  L  L+           
Sbjct: 80  LEALD-LVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLHYV 138

Query: 176 XPKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREP 235
              AF+R  APNWQDHST  +C+ FE   GGP+ +A +TGSRAH+RFTGPQI K+A  EP
Sbjct: 139 SSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEP 198

Query: 236 EVYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVE-- 293
           E Y  T  I+LVSNFL S+L G++  LEEADACGMNLYDI  R +   LL  ID   +  
Sbjct: 199 EAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSKDK 258

Query: 294 SIKRKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVL 353
           +I++KL  +P     AG    +  Y++ +YG N  C+V P TGDNLATICSLPL+KNDVL
Sbjct: 259 TIRQKLMRAPMKNLIAG---TICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDVL 315

Query: 354 VSLGTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHS- 412
           VSLGTSTT+L+VTD+Y+PSPNYHLFIHPT+P  YMGMICYCNGSLARE +RD L+ +   
Sbjct: 316 VSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKEREN 375

Query: 413 -------WDPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPV 465
                  W  FN+A+LD S  + +E+GVYFPL EIVPSV++  KR  F      I  E V
Sbjct: 376 NYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIERE-V 434

Query: 466 EQFSDIKHDVKNIVESQALSCRVRISPLLXXXXXXXXXXXXXXYTVKFDYDTFPISEY-R 524
            +F D +HD KNIVESQALSCRVRISPLL                VKFDYD  P+ +Y  
Sbjct: 435 AKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYLN 494

Query: 525 KRPRRAFFVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFT 584
           KRP R FFVGGAS+NDAIV+ FAQVIGAT+GN++LETPNSCALGGCYKA+WS +Y     
Sbjct: 495 KRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNKI 554

Query: 585 KLSFDLFLNEHFDWQHDAEFICDSETESWEYYNTKIQALSALEATL 630
            + FD FLN++F W H  E I D + E+W+ YN+KI  LS LE TL
Sbjct: 555 AVPFDKFLNDNFPW-HVMESISDVDNENWDRYNSKIVPLSELEKTL 599

>CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase, start by
           similarity
          Length = 582

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/582 (53%), Positives = 394/582 (67%), Gaps = 12/582 (2%)

Query: 58  GYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMW 117
           GY+LG DLSTQQLKCL +D  +Q+ H+EVVDFDRDLP Y+THKGVY + D  +E PV MW
Sbjct: 5   GYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECPVGMW 63

Query: 118 CDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNL-DXXXXXXXXXX 176
            +A+D +F        F L +V  ISGSCQQHGSVYW     + L++L D          
Sbjct: 64  LEAIDLVFEKYKGAG-FDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQLY 122

Query: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236
           P  FSR  APNWQDHSTG +C   E   GGP+ LA ITGSRAH+RFTGPQI K+A  E +
Sbjct: 123 PDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENEED 182

Query: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDV--ES 294
            Y NT  I+LVS+FL S+LC  + P+EEADACGMN+YDI  + YD  LL  I      E 
Sbjct: 183 NYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGKED 242

Query: 295 IKRKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLV 354
           + +KL GS T  ++   +  +++Y+V +YG + +C ++PFTGDNLATICSLPL+KND+LV
Sbjct: 243 LLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDILV 302

Query: 355 SLGTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADH--S 412
           SLGTSTTIL+VTDQY+PSPNYHLF HP I   YM MICYCNGSLARE VRD L+ +   S
Sbjct: 303 SLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQSTS 362

Query: 413 WDPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIK 472
           W  F++A+LD S+D   E+ VYFPL EIVPSV + TKR  +   + +I ++ V++F + +
Sbjct: 363 WTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEI-VKYVDKFDNNR 421

Query: 473 HDVKNIVESQALSCRVRISPLLXXXXXXXXXXXXXXYTVKFDYDTFPISEY-RKRPRRAF 531
           HD K IVESQALS RVR++PLL                V FDYD+   SEY  KRP R +
Sbjct: 422 HDAKIIVESQALSARVRVAPLLSGTVDESNDEKSET-MVHFDYDSMKFSEYSSKRPNRVY 480

Query: 532 FVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFT--KLSFD 589
           FVGGAS+NDAIV+ F++V+GA  GN++LETPNSCALGGC+KALWS ++       K++FD
Sbjct: 481 FVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFD 540

Query: 590 LFLNEHFDWQHDAEFICDSETESWEYYNTKIQALSALEATLE 631
            FLN +F      E   D  T+ WE Y  KI  LS LE  L+
Sbjct: 541 SFLNRYFPTDELEEIKVDDITKKWEAYKDKIIPLSKLEEELK 582

>AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH]
           (1335916..1337610) [1695 bp, 564 aa]
          Length = 564

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/575 (52%), Positives = 373/575 (64%), Gaps = 15/575 (2%)

Query: 57  SGYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAM 116
           S  +LGFDLSTQQLKCL +D+ L +  + VVDFDRDL  Y T KGVY  +D  +E+PV M
Sbjct: 4   SKLYLGFDLSTQQLKCLAIDEDLAIKCTAVVDFDRDLAGYETVKGVYTREDNVVESPVEM 63

Query: 117 WCDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDXXXXXXXXXX 176
           W +ALD  F  LA +    L  V  ISGSCQQH SVYW++D +  +R LD          
Sbjct: 64  WLEALDLCFERLARE--VDLGAVEAISGSCQQHASVYWTEDVKTRIRELDSRSGLRAQLG 121

Query: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236
           P   SR+ APNWQDHST  + + FE+ CGGPQ LA +TGS+AH+RFTG QI K+   EP 
Sbjct: 122 P-CLSRANAPNWQDHSTEAQREQFEAHCGGPQELAQLTGSKAHFRFTGLQIKKIRDTEPA 180

Query: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIK 296
               T +I+L S+FLAS+L G + P EEADACGM LY+I    Y  GLLQ +D   +++ 
Sbjct: 181 TLTATPSISLASSFLASVLVGKLVPPEEADACGMILYNIAQHRYVEGLLQMVD---DALF 237

Query: 297 RKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSL 356
            KL G+P   DN  PL  VS Y+  +YG+N  C ++  TGDNLATICSLPL+KND+LVSL
Sbjct: 238 DKLCGNPVRCDNVRPLGTVSRYFKEKYGINTSCNIYQLTGDNLATICSLPLQKNDLLVSL 297

Query: 357 GTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHSWDPF 416
           GTSTT+L VT++Y PSPNYH+FIHPTIPG YMGM+CYCNG+LARE ++D L  +  W  F
Sbjct: 298 GTSTTVLAVTEKYSPSPNYHMFIHPTIPGNYMGMVCYCNGALARERIKDTLGDESGWAAF 357

Query: 417 NKALLDSSVDNHDEIGVYFPLSEIVPSV-RSCTKRAKFTKSDNDINLEPVEQFSDIKHDV 475
           +KAL D SVD   E+GVYFPL EIVPSV     KR + +       L+ VE F+   HD 
Sbjct: 358 SKALEDDSVDTSAELGVYFPLPEIVPSVDHPLVKRVRISPK----GLQEVESFASPAHDA 413

Query: 476 KNIVESQALSCRVRISPLLXXXXXXXXXXXXXXYTVKFDYDTFPISEYRKRPRRAFFVGG 535
           KNIVESQALSCRVR++PLL                  FD     ++E+ +RP R FFVGG
Sbjct: 414 KNIVESQALSCRVRVAPLLSTPPEISDTGGH----AAFDGQQRDVAEFTRRPNRVFFVGG 469

Query: 536 ASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLFLNEH 595
           AS+NDAIVR    ++GA  GNY+LET NSCALGGCYKA WS +     T  SF  +L+  
Sbjct: 470 ASKNDAIVRAMPNILGAKGGNYRLETSNSCALGGCYKAFWSDLLYKQKTNASFADWLDSV 529

Query: 596 FDWQHDAEFICDSETESWEYYNTKIQALSALEATL 630
           F W  D + +C ++   W     KI ALS LE TL
Sbjct: 530 FKWDRDCKMLCKTDNRKWAASLGKIAALSRLEETL 564

>YOR017W (PET127) [4830] chr15 (361411..363813) Mitochondrial
           membrane-associated protein involved in stability and
           processing of mitochondrial mRNAs [2403 bp, 800 aa]
          Length = 800

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 36  NRSLDRMTKENNDNNKGNDPSSGYFLGFDLSTQQLKCLVVDQQLQL 81
           N   D + KE ND  KG      Y L +D   +++ CLV +++ ++
Sbjct: 485 NSKFDSLLKEKNDITKGIYGEEDYILHYDRDDRKIACLVANREFKM 530

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,634,668
Number of extensions: 963379
Number of successful extensions: 2646
Number of sequences better than 10.0: 13
Number of HSP's gapped: 2675
Number of HSP's successfully gapped: 13
Length of query: 631
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 523
Effective length of database: 12,857,365
Effective search space: 6724401895
Effective search space used: 6724401895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)