Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2012.31441447641e-106
Kwal_26.86781441455943e-80
ACR111C1441445892e-79
KLLA0D07139g1451455752e-77
Scas_640.231471495623e-75
YOR224C (RPB8)1461485562e-74
CAGL0J04070g1501525492e-73
KLLA0C10032g70451631.5
YNL172W (APC1)174858622.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2012.3
         (144 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement        298   e-106
Kwal_26.8678                                                          233   3e-80
ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH] (548897..54...   231   2e-79
KLLA0D07139g complement(611102..611539) similar to sp|P20436 Sac...   226   2e-77
Scas_640.23                                                           221   3e-75
YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared su...   218   2e-74
CAGL0J04070g 382116..382568 highly similar to sp|P20436 Saccharo...   216   2e-73
KLLA0C10032g complement(864922..867036) similar to sgd|S0006085 ...    29   1.5  
YNL172W (APC1) [4426] chr14 (310636..315882) Component of the an...    28   2.6  

>Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement
          Length = 144

 Score =  298 bits (764), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS
Sbjct: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60

Query: 61  STLNLDGHEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGLL 120
           STLNLDGHEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGLL
Sbjct: 61  STLNLDGHEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGLL 120

Query: 121 MRLEGNYRNLSNLKQENAYLLVRR 144
           MRLEGNYRNLSNLKQENAYLLVRR
Sbjct: 121 MRLEGNYRNLSNLKQENAYLLVRR 144

>Kwal_26.8678
          Length = 144

 Score =  233 bits (594), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 128/145 (88%), Gaps = 2/145 (1%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MSTTLFDD+FQV EVD GRYNKVSRIEA STS E  +LT+DINT+LFPV VNDNLTVMLS
Sbjct: 1   MSTTLFDDVFQVTEVDLGRYNKVSRIEAHSTSQE-FQLTVDINTELFPVRVNDNLTVMLS 59

Query: 61  STLNLDGHEE-SSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGL 119
           S+L+LD  E   + SWRAPQPG+RSLADDYDYVMYGTAYRFE+V   KD+IAVYYSFGGL
Sbjct: 60  SSLSLDETETVQNGSWRAPQPGERSLADDYDYVMYGTAYRFEEVAGKKDLIAVYYSFGGL 119

Query: 120 LMRLEGNYRNLSNLKQENAYLLVRR 144
           LMRLEGNYR LSNLKQENAYLLVRR
Sbjct: 120 LMRLEGNYRGLSNLKQENAYLLVRR 144

>ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH]
           (548897..549331) [435 bp, 144 aa]
          Length = 144

 Score =  231 bits (589), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 122/144 (84%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MS+TLFDDIF +QEVDQGRYNKVSRIEA STS + CKLTLD+NT+LFP+     LTVML+
Sbjct: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60

Query: 61  STLNLDGHEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGLL 120
           +TLNLDG E+S  SWR P PG RSLADD+DYV YGTAY+FE+ N NKD++AVYYSFGGLL
Sbjct: 61  TTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLL 120

Query: 121 MRLEGNYRNLSNLKQENAYLLVRR 144
           MRLEGNYR LSN KQEN YLL RR
Sbjct: 121 MRLEGNYRLLSNFKQENVYLLCRR 144

>KLLA0D07139g complement(611102..611539) similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8 DNA-directed RNA
           polymerase I, II, III 16 KD subunit singleton, start by
           similarity
          Length = 145

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 1/145 (0%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MS+ LFDD+F VQEVD GRYNKVSRIEA STS E CKLTLDIN++LFP+   D L VM++
Sbjct: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60

Query: 61  STLNLDGHEES-SVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGL 119
           ++L LDG EE    SWRAP  G RSLADDYDYVMYGTAY+FE+V  NKD++AVYYSFGGL
Sbjct: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120

Query: 120 LMRLEGNYRNLSNLKQENAYLLVRR 144
           LMRLEGNYR L+NLKQENAYLL R+
Sbjct: 121 LMRLEGNYRLLNNLKQENAYLLCRK 145

>Scas_640.23
          Length = 147

 Score =  221 bits (562), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 7/149 (4%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MS TLFDDIF V EVD GRYNKV RIEATST+ EQCKLTLDINT+LFPV  ND LT+ ++
Sbjct: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60

Query: 61  STLNLDG-----HEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYS 115
           S+L+++       + +  SWR PQP +RS+ADDYDYVMYGTAY+FE+V  NKD+IAVYYS
Sbjct: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118

Query: 116 FGGLLMRLEGNYRNLSNLKQENAYLLVRR 144
           FGGLLMRLEGNYRNL+ LKQENAYLL+RR
Sbjct: 119 FGGLLMRLEGNYRNLNTLKQENAYLLIRR 147

>YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared
           subunit of RNA polymerases I, II, and III (ABC14.5) [441
           bp, 146 aa]
          Length = 146

 Score =  218 bits (556), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 123/148 (83%), Gaps = 6/148 (4%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MS TLFDDIFQV EVD GRYNKV RIEA ST+ +QCKLTLDIN +LFPV   D+LTV ++
Sbjct: 1   MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA 60

Query: 61  STLNLD----GHEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSF 116
           S+LNL+        ++ SWR PQ G RSLADDYDYVMYGTAY+FE+V  +KD+IAVYYSF
Sbjct: 61  SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEV--SKDLIAVYYSF 118

Query: 117 GGLLMRLEGNYRNLSNLKQENAYLLVRR 144
           GGLLMRLEGNYRNL+NLKQENAYLL+RR
Sbjct: 119 GGLLMRLEGNYRNLNNLKQENAYLLIRR 146

>CAGL0J04070g 382116..382568 highly similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8, start by
           similarity
          Length = 150

 Score =  216 bits (549), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (82%), Gaps = 10/152 (6%)

Query: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60
           MSTTLFDDIF + EVD GRYN V RIEA ST+ EQCKLTLDINT+LFPV VN+ LTV ++
Sbjct: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLTVTVA 60

Query: 61  STLNLDGHEESSV--------SWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAV 112
           S+L++D  +++ V        SWR PQPG RSLADDYDYVM+GTAY+FE+V  +KDVIAV
Sbjct: 61  SSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEV--SKDVIAV 118

Query: 113 YYSFGGLLMRLEGNYRNLSNLKQENAYLLVRR 144
           YYSFGGLLMRLEGNYRNL+NLKQE AYLL+RR
Sbjct: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLLIRR 150

>KLLA0C10032g complement(864922..867036) similar to sgd|S0006085
          Saccharomyces cerevisiae YPL164c MLH3 insertion and
          deletion mismatch repair protein, start by similarity
          Length = 704

 Score = 28.9 bits (63), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 23 VSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLSSTLN-LDGHEESS 72
          V  +   S   +  K+ +DINT+ F + V DN   +  S LN L GH  +S
Sbjct: 27 VRELVQNSVDADATKIKVDINTERFIIEVQDNGFGITPSDLNLLGGHNITS 77

>YNL172W (APC1) [4426] chr14 (310636..315882) Component of the
            anaphase-promoting complex (APC), required for Clb2p
            degradation and for the metaphase-anaphase transition
            [5247 bp, 1748 aa]
          Length = 1748

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 85   LADDYDYVM--YGTAYRFEDVNNNKDVIAVYYSFGGLLMRLEGNYRNLSNLKQENAYL 140
            + DD  ++M       +F ++N   D++ +YY+  G ++ +   + +  NLK  N  L
Sbjct: 1301 IGDDLSFIMKDVDIGVKFSELNT--DLLPIYYTMAGRILAMGIRFASTGNLKIRNILL 1356

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,818,014
Number of extensions: 200311
Number of successful extensions: 561
Number of sequences better than 10.0: 19
Number of HSP's gapped: 552
Number of HSP's successfully gapped: 19
Length of query: 144
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 52
Effective length of database: 13,411,253
Effective search space: 697385156
Effective search space used: 697385156
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)