Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2012.225323611261e-158
Kwal_26.86732762376801e-89
YOR223W2922686342e-82
ACR110W2522296016e-78
CAGL0J04092g3012795971e-76
KLLA0D07095g2462395772e-74
Scas_640.24*2892735794e-74
YGR097W (ASK10)114650760.14
CAGL0E02739g34376633.7
CAGL0J02376g334132616.5
Kwal_14.167144341618.5
CAGL0H07139g35852608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2012.2
         (253 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2012.2 YOR223W, Contig c2012 1288-2049                           438   e-158
Kwal_26.8673                                                          266   1e-89
YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...   248   2e-82
ACR110W [1157] [Homologous to ScYOR223W - SH] complement(548056....   236   6e-78
CAGL0J04092g complement(382821..383726) similar to tr|Q12015 Sac...   234   1e-76
KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyce...   226   2e-74
Scas_640.24*                                                          227   4e-74
YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcrip...    34   0.14 
CAGL0E02739g complement(258786..259817) similar to tr|Q12118 Sac...    29   3.7  
CAGL0J02376g complement(229986..230990) similar to sp|P40546 Sac...    28   6.5  
Kwal_14.1671                                                           28   8.5  
CAGL0H07139g complement(703350..704426) some similarities with t...    28   8.8  

>Sklu_2012.2 YOR223W, Contig c2012 1288-2049
          Length = 253

 Score =  438 bits (1126), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/236 (91%), Positives = 217/236 (91%)

Query: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77
           VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN
Sbjct: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77

Query: 78  FASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLR 137
           FASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLR
Sbjct: 78  FASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLR 137

Query: 138 SVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDEDQFNSVPIA 197
           SVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDEDQFNSVPIA
Sbjct: 138 SVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDEDQFNSVPIA 197

Query: 198 DYKRNRDXXXXXXXXXXXXXXXXXXXKQEGLFSKRQKMAVVAGLLVNLFFGLIRQF 253
           DYKRNRD                   KQEGLFSKRQKMAVVAGLLVNLFFGLIRQF
Sbjct: 198 DYKRNRDLLIGLIIGCLLGIFSLLLLKQEGLFSKRQKMAVVAGLLVNLFFGLIRQF 253

>Kwal_26.8673
          Length = 276

 Score =  266 bits (680), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 172/237 (72%), Gaps = 5/237 (2%)

Query: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77
           VVRFSD  + DL L++SN+P + INT WLRRMCRQLR   T NKRL+FIR+GR L+ N++
Sbjct: 41  VVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGRFLDINSD 100

Query: 78  FASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLR 137
              +LQQ+F+    N K+YVHCIVGQ+LT EEL NEDVLD+   + EGTT QA+GFDRLR
Sbjct: 101 L--QLQQYFE--GSNDKFYVHCIVGQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLR 156

Query: 138 SVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDE-DQFNSVPI 196
           SVGFS+EEIELLR++FRSTYGDLE + + +   RDIRQLEEQWME+G ++E DQ  SV I
Sbjct: 157 SVGFSEEEIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGANEENDQLGSVGI 216

Query: 197 ADYKRNRDXXXXXXXXXXXXXXXXXXXKQEGLFSKRQKMAVVAGLLVNLFFGLIRQF 253
           A+YK N D                   KQ+GLF+KRQKMA+V GLL+NL FGL   F
Sbjct: 217 ANYKHNTDLLVGLVVGCVLGVFSLLLMKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF 273

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score =  248 bits (634), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 176/268 (65%), Gaps = 34/268 (12%)

Query: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77
           V+RFSDV++ DL L+ISN+P+ +INT+WLRRMCR+LR + T  +RLKFIR+G  LN+++ 
Sbjct: 27  VIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGSILNTHSK 86

Query: 78  FASELQQFFQQDTENTK--------------YYVHCIVG-QDLTEEELANEDVLDDIGPS 122
            A EL  +F  DT N                YY+HCI+G ++LT+ ELANED+ DD  PS
Sbjct: 87  IAEELTHYF--DTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANEDLKDDATPS 144

Query: 123 NEGTTTQAVGFDRLRSVGFSDEEIELLREQFRSTYGDLEN----VVQESQ---GGRDIRQ 175
           N+  TTQA+GFDRLRSVGF+++EIELLR+QFR+TYGDLE     + Q       G DIRQ
Sbjct: 145 NDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEGHDIRQ 204

Query: 176 LEEQWMESG----------VSDEDQFNSVPIADYKRNRDXXXXXXXXXXXXXXXXXXXKQ 225
           LEEQWMESG            +ED+FNSVPIA+ K N+D                   K 
Sbjct: 205 LEEQWMESGSGTAQGNGAGGGNEDRFNSVPIANIKHNKDLLLGICVGFFFGVFGILLMKF 264

Query: 226 EGLFSKRQKMAVVAGLLVNLFFGLIRQF 253
           +GLF++RQKMA+ AG++VN+ F L+R F
Sbjct: 265 DGLFNRRQKMAIFAGVIVNVMFCLVRGF 292

>ACR110W [1157] [Homologous to ScYOR223W - SH]
           complement(548056..548814) [759 bp, 252 aa]
          Length = 252

 Score =  236 bits (601), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 156/229 (68%), Gaps = 3/229 (1%)

Query: 22  SDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTNFASE 81
           SD  + DLTL++S++P+  + T WLR M RQ+R   T   RLKFIR+G+PLN+ +N    
Sbjct: 23  SDPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNL--R 80

Query: 82  LQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLRSVGF 141
           L+QFF+   EN KYY+HCIVG +LT E+L +ED LD++G   +GTT + +GFDRLRSVGF
Sbjct: 81  LEQFFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGF 140

Query: 142 SDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDED-QFNSVPIADYK 200
           SDEEIELLR+QFR+TYGDL+   Q      D+RQLEEQW+E+G +++  Q +S+P A+Y+
Sbjct: 141 SDEEIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYR 200

Query: 201 RNRDXXXXXXXXXXXXXXXXXXXKQEGLFSKRQKMAVVAGLLVNLFFGL 249
            N D                   KQ  LF+KRQKMAV AG++ N+ FG+
Sbjct: 201 YNMDLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFGM 249

>CAGL0J04092g complement(382821..383726) similar to tr|Q12015
           Saccharomyces cerevisiae YOR223w, hypothetical start
          Length = 301

 Score =  234 bits (597), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 175/279 (62%), Gaps = 45/279 (16%)

Query: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77
           VVRF+D  I DL L+I+++  D+INT WLRR+CR+LR E T  +RL+FIR+G  LNS  N
Sbjct: 25  VVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRAN 84

Query: 78  FASELQQFFQQ-DTENTK-------YYVHCIVG-QDLTEEELANEDVLDDIGPSNEGTTT 128
             SE+ Q+F++   ENT+       +YVHCI+G +DLT+E+LA+EDV+D +GPS +  TT
Sbjct: 85  LGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVTT 144

Query: 129 QAVGFDRLRSVGFSDEEIELLREQFRSTYGDLE-------------NVVQESQGG---RD 172
           QA+GFDRL SVGFS+EEIELLR+QFRSTYGD E             N+   S+GG   RD
Sbjct: 145 QAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNI--GSRGGNARRD 202

Query: 173 IRQLEEQWMESG------VSD------------EDQFNSVPIADYKRNRDXXXXXXXXXX 214
           IRQLEE WMESG        D            ED+FNS+P+ D + N+D          
Sbjct: 203 IRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGFC 262

Query: 215 XXXXXXXXXKQEGLFSKRQKMAVVAGLLVNLFFGLIRQF 253
                    K EGLF+KRQ+M+++ G+  N+ F L+R F
Sbjct: 263 LGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCLVRGF 301

>KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyces
           cerevisiae YOR223w hypothetical protein, start by
           similarity
          Length = 246

 Score =  226 bits (577), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 163/239 (68%), Gaps = 9/239 (3%)

Query: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77
           V+RF++  I DL LDI+N+    + T+WLRRMCRQL+   T  KRL+FI++GRPLNS+++
Sbjct: 14  VIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLNSHSD 73

Query: 78  FASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDD-IGPSNEGTTTQAVGFDRL 136
              E    F+ +   T+ Y+H I+G  LT EEL NED LDD    +NE  TTQA+GFDRL
Sbjct: 74  LGIE---SFKDNPNITEMYIHGIIGAGLTAEELINEDNLDDDFSNTNENGTTQAIGFDRL 130

Query: 137 RSVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDE--DQFNSV 194
           RSVGFS++EI+LLR+QF +TYGDLE +  + Q  RDIRQLEEQWME+GV+D    QFNS+
Sbjct: 131 RSVGFSEQEIDLLRQQFLATYGDLETMPNQQQ--RDIRQLEEQWMETGVNDPQGQQFNSI 188

Query: 195 PIADYKRNRDXXXXXXXXXXXXXXXXXXXKQEGLFSKRQKMAVVAGLLVNLFFGLIRQF 253
            IA++K N D                   KQ+GLFS+RQKM++VAGL+ N+ +  IR F
Sbjct: 189 GIANWKSNMDLLIGLSIGSLLGVFSLLLLKQQGLFSQRQKMSIVAGLIFNIAW-WIRSF 246

>Scas_640.24*
          Length = 289

 Score =  227 bits (579), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 168/273 (61%), Gaps = 37/273 (13%)

Query: 18  VVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTN 77
           V+RFSDV I DL ++I+ +P  +INT+WLR+MCR LR   T + RLKFIRSG  LNS ++
Sbjct: 17  VIRFSDVTIADLQINITQVPISNINTHWLRQMCRDLRPRETQSHRLKFIRSGALLNSRSS 76

Query: 78  FASELQQFFQQDTEN------------TKYYVHCIVGQDL-TEEELANEDVLDDIGPSNE 124
            A ++Q +F+    +             K+Y+HCI+G DL +E+ELA ED +DD+GP+ E
Sbjct: 77  LALQIQDYFRTSASDHTPQQEEEEEEANKFYIHCIIGSDLLSEDELAREDAMDDLGPNEE 136

Query: 125 GTTTQAVGFDRLRSVGFSDEEIELLREQFRSTYGDLENVVQ-----ESQGGR----DIRQ 175
           G TTQA+GFDRLR+VGFS+ EIELLR+QFRSTYGDLE  +Q     E +G      DIRQ
Sbjct: 137 GRTTQAIGFDRLRAVGFSEREIELLRQQFRSTYGDLEERLQGNDEFEEEGNNNSTTDIRQ 196

Query: 176 LEEQWMESGVS---------------DEDQFNSVPIADYKRNRDXXXXXXXXXXXXXXXX 220
           LEEQWM    +               D+D+FNS+PI + K N+D                
Sbjct: 197 LEEQWMGKWWTWTHEMKMGWLIIMSFDDDRFNSIPITNLKHNKDLLIGIFIGFCFGIFAF 256

Query: 221 XXXKQEGLFSKRQKMAVVAGLLVNLFFGLIRQF 253
                +GL +KRQ+M++ AG++VN+ F L R F
Sbjct: 257 ILMNIDGLLNKRQRMSMFAGIIVNILFCLFRGF 289

>YGR097W (ASK10) [2057] chr7 (678697..682137) Potential
           transcription factor involved in Skn7p-mediated
           two-component regulatory system [3441 bp, 1146 aa]
          Length = 1146

 Score = 33.9 bits (76), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 64  KFIRSGRPLNSNTNFASELQQFF---QQDTENTKYYVHCIVGQDLTEEEL 110
           KF++  +P N NT  +SEL QF+   Q+++ N   +   IV  + +EEEL
Sbjct: 657 KFLKGSKPKNKNTK-SSELDQFYAAAQKESNNYVTWTFKIVSPEPSEEEL 705

>CAGL0E02739g complement(258786..259817) similar to tr|Q12118
           Saccharomyces cerevisiae YOR007c, start by similarity
          Length = 343

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 124 EGTTTQ-AVGFDRLRSVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWME 182
           EG   + AVG D L SV  +   I+ + E F    GD+++V+++S   + + +  E    
Sbjct: 14  EGVVAEKAVGEDYLDSVNVA---IDCIAESFEVERGDVDSVLKQSGISKGLEECLECMKG 70

Query: 183 SGVSDEDQFNSVPIAD 198
             V  ED   ++P  D
Sbjct: 71  GAVKSEDVKVNIPAED 86

>CAGL0J02376g complement(229986..230990) similar to sp|P40546
           Saccharomyces cerevisiae YIL019w, hypothetical start
          Length = 334

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 60/132 (45%), Gaps = 19/132 (14%)

Query: 59  TNKRLKFIRSGRPLNSNTNFASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDD 118
           + K  K +RSG+ LN N             ++E T+       G+D+  E L N+  L  
Sbjct: 110 SKKEQKLLRSGKTLNKNRKLL---------ESEGTETKPGDDEGEDMEMENLQNDIELQR 160

Query: 119 -------IGPSNEGTTTQAVGFDRLR--SVGFSDEEIELLREQFRSTYGDLENVVQESQG 169
                  +   N  T+  ++  D L+  +V + D+E+ + + + R+    L+N+ + +  
Sbjct: 161 FLKESHLLSAFNSATSGASLTLDGLKDTTVSYQDDEV-MGKARARTLEMRLQNISKVNGD 219

Query: 170 GRDIRQLEEQWM 181
           GR I +LE+  M
Sbjct: 220 GRKISKLEKVPM 231

>Kwal_14.1671
          Length = 443

 Score = 28.1 bits (61), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 156 TYGDLENVVQESQGGRDIRQLEEQWMESGVSDEDQFNSVPI 196
            YG  EN+V+  Q   D +++E+ W    VS++     VPI
Sbjct: 197 AYGGEENLVKICQFSSDYKKIEQVWEAKNVSNDRLDLKVPI 237

>CAGL0H07139g complement(703350..704426) some similarities with
           tr|Q06675 Saccharomyces cerevisiae YDR318w MCM21,
           hypothetical start
          Length = 358

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 152 QFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDEDQFNSVPIADYKRNR 203
           +F   +GD  ++ +++ G RD+  L    ++   +D D  N +P+   K++R
Sbjct: 42  KFDKAFGDFNDIFEKNPGLRDL--LLGYEIDKSATDVDDTNIIPVTPQKKSR 91

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,498,498
Number of extensions: 328561
Number of successful extensions: 1209
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1181
Number of HSP's successfully gapped: 33
Length of query: 253
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 154
Effective length of database: 13,168,927
Effective search space: 2028014758
Effective search space used: 2028014758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)