Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1979.431431416650.0
KLLA0E21923g37829411521e-158
Kwal_55.2156337229911491e-158
YDR268W (MSW1)37929910551e-144
ACR089C38929210271e-139
CAGL0M08624g33726810091e-137
Scas_615.103792929271e-124
KLLA0F18700g77069790.070
Kwal_56.22658422210760.14
Scas_659.23396235750.21
Scas_502.4446237730.37
KLLA0F15389g397241720.52
CAGL0H09372g392242681.6
KLLA0B07733g432241671.9
Sklu_2027.249953662.6
YCR042C (TAF2)140733662.9
Scas_500.356581654.1
KLLA0F05610g49865644.6
YGR185C (TYS1)394244635.2
Sklu_1679.2409235636.5
KLLA0D15983g103536637.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1979.4
         (314 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        645   0.0  
KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   448   e-158
Kwal_55.21563                                                         447   e-158
YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   410   e-144
ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   400   e-139
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   393   e-137
Scas_615.10                                                           361   e-124
KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...    35   0.070
Kwal_56.22658                                                          34   0.14 
Scas_659.23                                                            33   0.21 
Scas_502.4                                                             33   0.37 
KLLA0F15389g complement(1422689..1423882) highly similar to sp|P...    32   0.52 
CAGL0H09372g complement(918777..919955) highly similar to sp|P36...    31   1.6  
KLLA0B07733g 677879..679177 highly similar to sp|Q12109 Saccharo...    30   1.9  
Sklu_2027.2 YMR265C, Contig c2027 3997-5496                            30   2.6  
YCR042C (TAF2) [575] chr3 complement(201169..205392) Component o...    30   2.9  
Scas_500.3                                                             30   4.1  
KLLA0F05610g 548033..549529 weakly similar to sgd|S0002339 Sacch...    29   4.6  
YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tR...    29   5.2  
Sklu_1679.2 YGR185C, Contig c1679 2614-3843                            29   6.5  
KLLA0D15983g 1343315..1346422 similar to sp|P39692 Saccharomyces...    29   7.5  

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/314 (100%), Positives = 314/314 (100%)

Query: 1   MKGLLRSSISKRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDL 60
           MKGLLRSSISKRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDL
Sbjct: 1   MKGLLRSSISKRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDL 60

Query: 61  CDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVH 120
           CDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVH
Sbjct: 61  CDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVH 120

Query: 121 QHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILL 180
           QHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILL
Sbjct: 121 QHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILL 180

Query: 181 YHSTHVPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSK 240
           YHSTHVPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSK
Sbjct: 181 YHSTHVPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSK 240

Query: 241 SDANQNSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIA 300
           SDANQNSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIA
Sbjct: 241 SDANQNSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIA 300

Query: 301 EVEKMYPVSPIPRP 314
           EVEKMYPVSPIPRP
Sbjct: 301 EVEKMYPVSPIPRP 314

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  448 bits (1152), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 246/294 (83%), Gaps = 1/294 (0%)

Query: 11  KRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKL 70
           KRF ++VKTT + L   D+P  +TIFSLIQPTGKFHLGNYLGAVRVWKD+ D   D + L
Sbjct: 17  KRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDDGTTL 76

Query: 71  LFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWILS 130
           LFG ADLHAIT+PKPN+ EFR YR EAIASILSIGIDP+KAI+FHQS+V QH ELHW+LS
Sbjct: 77  LFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLS 136

Query: 131 TIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTHVPVGD 190
           ++A +G LNRMTQWKSKSN+  D SD  ALG +KLGLF+YPVLQAADILLY STHVPVGD
Sbjct: 137 SLASMGSLNRMTQWKSKSNI-NDQSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGD 195

Query: 191 DQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIY 250
           DQSQHLELTR L+  FNK YK  YFP+PTTILAPTKKILSL +P KKMSKSD NQNSVIY
Sbjct: 196 DQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIY 255

Query: 251 LNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVEK 304
           + D+PE I+KKIK+AVTDSIS  F +DP  RPG+SNLIN +SG+QR SI +VEK
Sbjct: 256 ITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIEDVEK 309

>Kwal_55.21563
          Length = 372

 Score =  447 bits (1149), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 213/299 (71%), Positives = 254/299 (84%), Gaps = 2/299 (0%)

Query: 7   SSISKRFLT-TVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDL 65
           S +S R L+ TVKTTDY +++ D+PD + +FS++QPTGKFHLGNYLGAVRVWKDLCD   
Sbjct: 7   SFVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKA 66

Query: 66  DESKLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAEL 125
             ++L+FGVADLHAITIP P+  + RQ R EA+ASILS+G+DP KA++F+QS+VHQH EL
Sbjct: 67  PSTQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTEL 126

Query: 126 HWILSTIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTH 185
           HW+LST+AP+G LNRMTQWKSKSNL+ + SD +ALG VKLGLF+YPVLQAADILLY STH
Sbjct: 127 HWLLSTLAPMGLLNRMTQWKSKSNLK-NMSDEQALGTVKLGLFSYPVLQAADILLYRSTH 185

Query: 186 VPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQ 245
           VPVGDDQ+QHLELTR LAQ FNKLYK+   PLPTTILAPTK+ILSLA    KMSKSD NQ
Sbjct: 186 VPVGDDQAQHLELTRTLAQYFNKLYKRPILPLPTTILAPTKRILSLADIDSKMSKSDQNQ 245

Query: 246 NSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVEK 304
           N+ IYLND+P++I KKI+KAVTDS S  F YDP +RPGVSNLINIVSG+QR+SI +VEK
Sbjct: 246 NATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEK 304

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 245/299 (81%), Gaps = 5/299 (1%)

Query: 9   ISKRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDES 68
           ISKR+++TV+  D+ L+S  +   +T+FS+IQPTG FHLGNYLGA RVW DLC+      
Sbjct: 11  ISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQ 70

Query: 69  KLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWI 128
           +L+FGVADLHAIT+PKP+   FR++R EA+ASIL++G+DP+KA + +QS + QH+ELHW+
Sbjct: 71  ELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWL 130

Query: 129 LSTIAPVGYLNRMTQWKSKSNLRQDAS-----DAEALGNVKLGLFAYPVLQAADILLYHS 183
           LST+A +G LNRMTQWKSKSN++Q  +     +   +G V+LGLF+YPVLQAADILLY S
Sbjct: 131 LSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKS 190

Query: 184 THVPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDA 243
           THVPVGDDQSQHLELTR LA++FNK+YKK++FP P T+LA TKK+LSL++P KKMSKSD 
Sbjct: 191 THVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDP 250

Query: 244 NQNSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEV 302
           N +SVI+LND+P+ I KKI+KA+TDSIS  F YDP  RPGVSNLINIVSGIQR+SI +V
Sbjct: 251 NHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDV 309

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  400 bits (1027), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/292 (64%), Positives = 230/292 (78%), Gaps = 2/292 (0%)

Query: 12  RFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKLL 71
           R  +T++  DY   S  +PD + +FSLIQPTGKFHLGNYLGAVRVW +L +      K +
Sbjct: 31  RKASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCI 90

Query: 72  FGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWILST 131
           FG ADLHAITIPKP+ + FRQ R EAIAS+L++GIDP K+I+FHQSQV +HAEL W LST
Sbjct: 91  FGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLST 150

Query: 132 IAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTHVPVGDD 191
           +  +G LNRMTQWK+K+N++  +S  E +G VKLGLF YPVLQAAD+LLY STH+PVG+D
Sbjct: 151 LTSMGALNRMTQWKTKANIKDTSS--EKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGED 208

Query: 192 QSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYL 251
           Q Q LELTR LAQ FN  YK  YF  PTT+L PT+K+LSL +P KKMSKSDANQNS I +
Sbjct: 209 QVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICV 268

Query: 252 NDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVE 303
            D+P+ I +KI+ AVTDSI HEFKYDPE RPGVSNLINIV+GIQ+++IA VE
Sbjct: 269 TDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVE 320

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 224/268 (83%), Gaps = 1/268 (0%)

Query: 38  LIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTEA 97
           ++QPTGKFHLGNYLGA RVWKDLCD      +L+FGVADLHAITIPKP++++F+Q R EA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 98  IASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDA-SD 156
           IASIL++G+DP +A I +QS +  H++L+W+LST+AP+GYLNRMTQWKSKSNLR+D  + 
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120

Query: 157 AEALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQSQHLELTRFLAQQFNKLYKKSYFP 216
           A+ LG VKLGLF YPVLQAADILLY +THVPVGDDQ QHLELTR LA+ FNKLYKK  FP
Sbjct: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180

Query: 217 LPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIKKAVTDSISHEFKY 276
           LP T+LAPTKKILSL    KKMSKSD NQ+ VIY+ND PETI +KIKKA TDSI+ +F Y
Sbjct: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240

Query: 277 DPENRPGVSNLINIVSGIQRRSIAEVEK 304
           DP +RPG+SNLINIVSGI ++ +  VE+
Sbjct: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQ 268

>Scas_615.10
          Length = 379

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/292 (60%), Positives = 220/292 (75%), Gaps = 11/292 (3%)

Query: 16  TVKTTDYTLH--SHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFG 73
           TV+ TDY L   S  +P  +TIFSLIQPTGKFHLGNYLGA R+WK +  +       +FG
Sbjct: 28  TVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFG 87

Query: 74  VADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIA 133
           VADLHAIT+PKP+  EF Q R EA+ASILS+GIDP+ AI+ +QS+V QH +LHW+LST  
Sbjct: 88  VADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFT 147

Query: 134 PVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQS 193
            +G LNRMTQWK+K+     +        VKLGLF+YPVLQAADILLY +THVPVGDDQ 
Sbjct: 148 SMGVLNRMTQWKAKAKSNHMS--------VKLGLFSYPVLQAADILLYKATHVPVGDDQC 199

Query: 194 QHLELTRFLAQQFNKLY-KKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLN 252
           Q LEL R +AQQFN+ Y  +++FP+P TILAPTKKILSL  P KKMSKSD N++S IY+N
Sbjct: 200 QPLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVN 259

Query: 253 DDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVEK 304
           D  + I KKI+KAVTDS++    +DP NRPGVSNL+N+VSGI +R ++ VE+
Sbjct: 260 DAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQ 311

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 83  PKPNSSEFRQYRTEAIASILSIGIDPK---KAIIFHQSQVHQHAELHWILSTIAPVGYLN 139
           P  +SS   +  +EA+ S+ ++G+D K   KA+I     V+  A + W+ S +   G L 
Sbjct: 623 PHASSSAKNRVDSEALNSMTAMGLDSKLCRKALILKNGDVN--ASVEWVFSHMDDDGELP 680

Query: 140 RMTQWKSKS 148
              +WK +S
Sbjct: 681 EAEEWKDQS 689

>Kwal_56.22658
          Length = 422

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 84/210 (40%), Gaps = 44/210 (20%)

Query: 66  DESKLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAEL 125
           D+ K LF       +TI      + + +  +  + I+S+G DPKK  IF   +       
Sbjct: 137 DDEKFLFK----QKLTI-----KDVKHFARQNASDIISVGFDPKKTFIFSDLEYMGGG-- 185

Query: 126 HWILSTIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAA--------D 177
                T+  V    ++T   +K+      SD        +G F +  +Q A        D
Sbjct: 186 --FYETVVRVS--RQITGSTAKAVFGFTDSDC-------IGKFHFASIQIASAFPSSYPD 234

Query: 178 IL-LYHSTH--VPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASP 234
           +L L   T   +P   DQ  +  + R +A++         F  P+ I   +K   +L   
Sbjct: 235 VLGLPEKTPCLIPCAIDQDPYFRVCRDVAEKLK-------FSKPSLI--HSKFFPALQGS 285

Query: 235 GKKMSKSDANQNSVIYLNDDPETISKKIKK 264
             KMS SD    + I++ D P+ I KKI K
Sbjct: 286 TTKMSASD--DTTAIFMTDTPKQIQKKINK 313

>Scas_659.23
          Length = 396

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 90/235 (38%), Gaps = 35/235 (14%)

Query: 41  PTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTE---- 96
           PTGK H G ++   ++  D      + + LL   ADLHA         E  QYR +    
Sbjct: 44  PTGKPHCGYFVPMTKL-ADFLKAGCEVTVLL---ADLHAFLDNMKAPLEVVQYRAKYYEL 99

Query: 97  ---AIASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQD 153
              AI   +++ I+  K +     Q+     L              RM    S++  ++ 
Sbjct: 100 TIKAILRSINVPIEKLKFVTGSSYQLTSDYTLDIF-----------RMANIVSQNEAKRA 148

Query: 154 ASDA-EALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQSQHLELTRFLAQQFNKLYKK 212
            +D  + + N  L    YP++QA D           G DQ +   L     Q     YKK
Sbjct: 149 GADVVKQVANPLLSGLIYPLMQALDEHFLDCDAQFGGVDQRKIFVLAEENLQSLG--YKK 206

Query: 213 SYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIKKAVT 267
                   ++ P   ++     G KMS SD N  S I L ++P+ + KKI  A  
Sbjct: 207 R-----AHLMNP---MVPGLGQGGKMSASDPN--SKIDLLEEPKIVKKKINSAFC 251

>Scas_502.4
          Length = 446

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 96/237 (40%), Gaps = 51/237 (21%)

Query: 46  HLGNYLGAVRV-W-KDLCDTDL-----DESKLLFGVADLHAITIPKPNSSEFRQYRTEAI 98
           H+G+ +  V   W +D+ D  L     D+ K LF     H ++I     ++ +++  +  
Sbjct: 132 HMGHMIPFVFTKWLQDVFDCPLVIELTDDEKFLFK----HKLSI-----NDVKKFANDNA 182

Query: 99  ASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDASDAE 158
             I+++G +P+   IF   Q            T+  V    ++T   +K+      SD  
Sbjct: 183 KDIIAVGFNPENTFIFSDLQYMGGG----FYETVVRVS--RQITGSTAKAVFGFTDSDC- 235

Query: 159 ALGNVKLGLFAYPVLQAA--------DIL-LYHSTH--VPVGDDQSQHLELTRFLAQQFN 207
                 +G F +  +Q A        D+L L   T   +P   DQ  +  + R +A++  
Sbjct: 236 ------IGKFHFASIQIASAFPNSFPDVLGLPDKTQCLIPCAIDQDPYFRVCRDVAEKLK 289

Query: 208 KLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIKK 264
                  F  P   L  +K   +L     KMS SD    S I++ D P+ I KKI K
Sbjct: 290 -------FAKPA--LLHSKFFPALQGSTTKMSASD--DTSAIFMTDTPKQIQKKINK 335

>KLLA0F15389g complement(1422689..1423882) highly similar to
           sp|P36421 Saccharomyces cerevisiae YGR185c TYS1
           tyrosyl-tRNA synthetase singleton, start by similarity
          Length = 397

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 99/241 (41%), Gaps = 47/241 (19%)

Query: 41  PTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTE---- 96
           PTG+ H G ++   ++  D      + + LL   ADLHA       S E   YR +    
Sbjct: 46  PTGRPHCGYFVPMTKL-ADFLKAGCEVTVLL---ADLHAFLDNMKASLEVVAYRAKYYEL 101

Query: 97  ---AIASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQD 153
              AI   +++ I+  K +I    Q        +I+          +++   S+++ ++ 
Sbjct: 102 VIKAILRSINVPIEKLKFVIGSSYQTSNE----YIMDIF-------KLSNIVSQNDAKRA 150

Query: 154 ASDA-EALGNVKLGLFAYPVLQAADILLYHSTHVPV-----GDDQSQHLELTRFLAQQFN 207
            +D  + + N  L    YP++QA D       H+ V     G DQ +   L     +   
Sbjct: 151 GADVVKQVANPLLSGLIYPLMQALD-----EEHLGVDVQFGGVDQRKIFVLAE---ENLE 202

Query: 208 KL-YKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIKKAV 266
           KL YKK        ++ P   ++     G KMS SD N  S I L ++P+ + KKI  A 
Sbjct: 203 KLGYKKR-----AHLMNP---MVPGLGQGGKMSASDPN--SKIDLLEEPKQVKKKINSAF 252

Query: 267 T 267
            
Sbjct: 253 C 253

>CAGL0H09372g complement(918777..919955) highly similar to sp|P36421
           Saccharomyces cerevisiae YGR185c TYS1, hypothetical
           start
          Length = 392

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 96/242 (39%), Gaps = 53/242 (21%)

Query: 41  PTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTE---- 96
           PTG+ H G Y  A+          ++ + LL   ADLHA         E   YRT+    
Sbjct: 41  PTGRPHCG-YFVAMTKLAHFLKAGVEVTVLL---ADLHAFLDNMKAPLEVVNYRTKYYEY 96

Query: 97  ---AIASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQD 153
              AI   +++ I+  K ++    Q+     L            L +++   S+++ ++ 
Sbjct: 97  TVKAILKSINVPIEKLKFVVGSSYQLGGDYTLD-----------LFKLSNMVSQNDAKRA 145

Query: 154 ASDA-EALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQSQHLELTRFLAQQFNKLYKK 212
            +D  + + N  L    YP++QA D                Q L++      QF  + ++
Sbjct: 146 GADVVKQVANPLLSGLIYPLMQALD---------------EQFLDVDV----QFGGVDQR 186

Query: 213 SYFPLPTTILAPT--KKILSLASP-------GKKMSKSDANQNSVIYLNDDPETISKKIK 263
             F L    L     KK   L +P       G KMS SD N  S I L ++P+ + KKI 
Sbjct: 187 KIFVLAEENLPRIGYKKRAHLMNPMVPGLTQGGKMSASDPN--SKIDLLEEPKKVGKKIN 244

Query: 264 KA 265
            A
Sbjct: 245 SA 246

>KLLA0B07733g 677879..679177 highly similar to sp|Q12109
           Saccharomyces cerevisiae YOL097c WRS1 tryptophan--tRNA
           ligase singleton, start by similarity
          Length = 432

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 90/241 (37%), Gaps = 59/241 (24%)

Query: 46  HLGNYLGAVRV-W-KDLCDTDL-----DESKLLFGVADLHAITIPKPNSSEFRQYRTEAI 98
           HLG+ +  +   W +D+ D  L     D+ K LF          PK    + +++  +  
Sbjct: 114 HLGHMIPFIFTKWLQDVFDCPLVIELTDDEKFLFK---------PKLTIKDVKKFTKDNA 164

Query: 99  ASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQDASDAE 158
             I+++G +P+K  IF   +            T+  +    ++T   +K+      SD  
Sbjct: 165 KDIVAVGFNPEKTFIFSDLEYMGGG----FYETVVRIS--RQITGSTAKAVFGFTDSDC- 217

Query: 159 ALGNVKLGLFAYPVLQAA--------DILLYHS---THVPVGDDQSQHLELTRFLAQQFN 207
                 +G F +  +Q A        D+L         +P   DQ  +  + R +A +  
Sbjct: 218 ------IGKFHFASIQIASAFPSSFPDVLGLPDKTPCLIPCAIDQDPYFRVCRDVADKLK 271

Query: 208 ----KLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIK 263
                L    +FP             +L     KMS SD    S I++ D P+ I KKI 
Sbjct: 272 YSKPSLLHSRFFP-------------ALQGSSTKMSASD--DTSAIFMTDTPKQIQKKIN 316

Query: 264 K 264
           K
Sbjct: 317 K 317

>Sklu_2027.2 YMR265C, Contig c2027 3997-5496
          Length = 499

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 71  LFGVADL--HAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQ 121
           +FG ADL  HA+ + KPN     +Y+T  I  +L    D  + I  +  ++ Q
Sbjct: 180 VFGYADLQFHAVFLKKPNYETTMKYKTSCITELLD-HYDQVEEITLYDDRIRQ 231

>YCR042C (TAF2) [575] chr3 complement(201169..205392) Component of
           TAF(II) complex (TBP-associated protein complex),
           required for activated transcription by RNA polymerase
           II [4224 bp, 1407 aa]
          Length = 1407

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 25  HSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVW 57
           H  D+  K  IF +I P    H+G  +GA   W
Sbjct: 358 HPIDLTKKKCIFQIINPVAPHHIGWAIGAFNSW 390

>Scas_500.3
          Length = 565

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 160 LGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQSQHLELTRFLAQQFNKL---YKKSYFP 216
           L +   G F+Y  L+  +++ +HS +V + +     +++ +F+ Q+ N+    Y K+Y P
Sbjct: 289 LSDFNTGSFSYG-LKTKNVVEFHSDYVKIRNASFPGVQM-KFVLQKLNRQLPPYTKNYKP 346

Query: 217 LPTTILAPTKKILSLASPGKK 237
           +P      + K ++ ++P K+
Sbjct: 347 VPVPTKTASNKNVAASTPMKQ 367

>KLLA0F05610g 548033..549529 weakly similar to sgd|S0002339
           Saccharomyces cerevisiae YDL180w hypothetical protein,
           hypothetical start
          Length = 498

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 177 DILLYHSTHVPVG----DDQSQHLELTRFLAQQFNKLYKKSYF-PLPTTILAPTKKILSL 231
           +ILLYHS H P       D  + L L+R +   +  L  KS+  P+  T+ + T  +L +
Sbjct: 431 NILLYHSIHPPADTQFQTDDGRLLRLSRTIVTYWQSLASKSWLIPIGLTVWSVTVFVLGI 490

Query: 232 ASPGK 236
            +  K
Sbjct: 491 MATIK 495

>YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tRNA
           synthetase, cytoplasmic, charges its cognate tRNAs with
           tyrosine during protein synthesis [1185 bp, 394 aa]
          Length = 394

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 95/244 (38%), Gaps = 53/244 (21%)

Query: 41  PTGKFHLGNYLGAVRVWKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTE---- 96
           PTG+ H G ++   ++  D      + + LL   ADLHA         E   YR +    
Sbjct: 48  PTGRPHCGYFVPMTKL-ADFLKAGCEVTVLL---ADLHAFLDNMKAPLEVVNYRAKYYEL 103

Query: 97  ---AIASILSIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQD 153
              AI   +++ I+  K ++    Q+     +              R++   S+++ ++ 
Sbjct: 104 TIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIF-----------RLSNIVSQNDAKRA 152

Query: 154 ASDA-EALGNVKLGLFAYPVLQAADILLYHSTHVPVGDDQSQHLELTRFLAQQFNKLYKK 212
            +D  + + N  L    YP++QA D                Q L++      QF  + ++
Sbjct: 153 GADVVKQVANPLLSGLIYPLMQALD---------------EQFLDVDC----QFGGVDQR 193

Query: 213 SYFPLPTTILAPT--KKILSLASP-------GKKMSKSDANQNSVIYLNDDPETISKKIK 263
             F L    L     KK   L +P       G KMS SD N  S I L ++P+ + KKI 
Sbjct: 194 KIFVLAEENLPSLGYKKRAHLMNPMVPGLAQGGKMSASDPN--SKIDLLEEPKQVKKKIN 251

Query: 264 KAVT 267
            A  
Sbjct: 252 SAFC 255

>Sklu_1679.2 YGR185C, Contig c1679 2614-3843
          Length = 409

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 99/235 (42%), Gaps = 39/235 (16%)

Query: 41  PTGKFHLGNYLGAVRV---WKDLCDTDLDESKLLFGVADLHAITIPKPNSSEFRQYRTE- 96
           PTG+ H G ++   ++    K  C+  +    LL   ADLHA         E   YR + 
Sbjct: 50  PTGRPHCGYFVPMTKLAHFLKAGCEVTV----LL---ADLHAFLDNMKAPLEVVNYRAKY 102

Query: 97  ---AIASIL-SIGIDPKKAIIFHQSQVHQHAELHWILSTIAPVGYLNRMTQWKSKSNLRQ 152
               + SIL SI + P + + F     +Q  E  + +        L R++   S+++ ++
Sbjct: 103 YEFVVKSILKSINV-PIEKLKFVVGSSYQ-LEAKYTMD-------LFRLSNIVSQNDAKR 153

Query: 153 DASDA-EALGNVKLGLFAYPVLQAADILLYHSTHVPVGD-DQSQHLELTRFLAQQFNKLY 210
             +D  + + N  L    YP++QA D   Y +  V  G  DQ +   L     Q     Y
Sbjct: 154 AGADVVKQVSNPLLSGLIYPLMQALD-EEYLAVDVQFGGVDQRKIFVLAEENMQALG--Y 210

Query: 211 KKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYLNDDPETISKKIKKA 265
           KK    +   +   T+        G KMS SD N  S I + ++P+ + KKI  A
Sbjct: 211 KKRAHLMNPMVPGLTQ--------GGKMSASDPN--SKIDVLEEPKQVKKKINSA 255

>KLLA0D15983g 1343315..1346422 similar to sp|P39692 Saccharomyces
           cerevisiae YFR030w MET10 sulfite reductase
           flavin-binding subunit, start by similarity
          Length = 1035

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 274 FKYDPENRPGVSNLINIVSGIQRR--SIAEVEKMYP 307
           F+  P  RP V +L+ I++ ++RR  SIA  ++++P
Sbjct: 794 FELFPSARPSVEDLVKIIAPLKRREYSIASSQRIHP 829

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,404,510
Number of extensions: 450476
Number of successful extensions: 1516
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1507
Number of HSP's successfully gapped: 34
Length of query: 314
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 213
Effective length of database: 13,099,691
Effective search space: 2790234183
Effective search space used: 2790234183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)