Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1979.384784743860.0
Kwal_55.2156687385625680.0
ACR088W85086225440.0
YOR038C (HIR2)87588822220.0
KLLA0E21945g84786221660.0
Scas_699.4288591220300.0
CAGL0I00968g99743913641e-174
Kwal_47.174658003722511e-21
AGR168W8253072492e-21
Scas_702.168163192456e-21
KLLA0A04928g8614012439e-21
CAGL0E02805g8403672374e-20
YBL008W (HIR1)8403312313e-19
KLLA0E11143g493901105e-05
Kwal_27.103855361141016e-04
Scas_512.3534102980.001
YML102W (CAC2)468114920.008
AER280C510124840.076
Scas_657.1341163770.38
Sklu_2406.1142664770.48
CAGL0J07854g432139760.61
CAGL0L04950g805115741.3
Scas_670.1563296731.4
CAGL0B00748g81283731.4
ABR101C827108731.5
Kwal_56.22982598119731.6
YBR195C (MSI1)422102721.7
CAGL0J06512g545124721.7
Scas_581.1244242712.0
Scas_658.1442103712.1
KLLA0F26653g791114703.1
AFL022W37137693.2
Scas_721.2941496684.7
AER073C105378677.7
Sklu_2167.5303112668.6
YLR222C (UTP13)817138669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1979.3
         (847 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1979.3 YOR038C, Contig c1979 4836-7379                          1694   0.0  
Kwal_55.21566                                                         993   0.0  
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...   984   0.0  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...   860   0.0  
KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...   838   0.0  
Scas_699.42                                                           786   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...   530   e-174
Kwal_47.17465                                                         101   1e-21
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...   100   2e-21
Scas_702.16                                                            99   6e-21
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    98   9e-21
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    96   4e-20
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    94   3e-19
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    47   5e-05
Kwal_27.10385                                                          44   6e-04
Scas_512.3                                                             42   0.001
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    40   0.008
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    37   0.076
Scas_657.13                                                            34   0.38 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      34   0.48 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    34   0.61 
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    33   1.3  
Scas_670.15                                                            33   1.4  
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    33   1.4  
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    33   1.5  
Kwal_56.22982                                                          33   1.6  
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    32   1.7  
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    32   1.7  
Scas_581.12                                                            32   2.0  
Scas_658.1                                                             32   2.1  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    32   3.1  
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    31   3.2  
Scas_721.29                                                            31   4.7  
AER073C [2578] [Homologous to ScYDL073W - SH] (770590..773751) [...    30   7.7  
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            30   8.6  
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    30   9.0  

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score = 1694 bits (4386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 821/847 (96%), Positives = 821/847 (96%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60
           MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60

Query: 61  KGNFNNEKLCYVFATDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITDIKYD 120
           KGNFNNEKLCYVFATDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITDIKYD
Sbjct: 61  KGNFNNEKLCYVFATDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITDIKYD 120

Query: 121 PLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGAARSI 180
           PLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGAARSI
Sbjct: 121 PLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGAARSI 180

Query: 181 SIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDRNNE 240
           SIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDRNNE
Sbjct: 181 SIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDRNNE 240

Query: 241 FKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLF 300
           FKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLF
Sbjct: 241 FKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLF 300

Query: 301 NAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQASIKKL 360
           NAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQASIKKL
Sbjct: 301 NAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQASIKKL 360

Query: 361 EPLPTEELKPSHDIKPKTSGGSSVNLSLNPXXXXXXXXXXXXXXXIQSTSMEFNPPSYSV 420
           EPLPTEELKPSHDIKPKTSGGSSVNLSLNP               IQSTSMEFNPPSYSV
Sbjct: 361 EPLPTEELKPSHDIKPKTSGGSSVNLSLNPTTVTKSGKKKVVPTTIQSTSMEFNPPSYSV 420

Query: 421 PKDLKRKPKDEETMVNGKKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPV 480
           PKDLKRKPKDEETMVNGKKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPV
Sbjct: 421 PKDLKRKPKDEETMVNGKKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPV 480

Query: 481 HNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLSSAGESFWACCTED 540
           HNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLSSAGESFWACCTED
Sbjct: 481 HNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLSSAGESFWACCTED 540

Query: 541 GTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVY 600
           GTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVY
Sbjct: 541 GTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVY 600

Query: 601 PLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLISDSWWAY 660
           PLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLISDSWWAY
Sbjct: 601 PLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLISDSWWAY 660

Query: 661 GSQYWDMXXXXXXXXXXXSDKDDKKNRYWNPEAENLVSNVRSNKSSIVNYLESKTNDELS 720
           GSQYWDM           SDKDDKKNRYWNPEAENLVSNVRSNKSSIVNYLESKTNDELS
Sbjct: 661 GSQYWDMTNTNGVVVTTGSDKDDKKNRYWNPEAENLVSNVRSNKSSIVNYLESKTNDELS 720

Query: 721 RKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTRLLIVYCIRL 780
           RKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTRLLIVYCIRL
Sbjct: 721 RKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTRLLIVYCIRL 780

Query: 781 GEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACADIRQVQRVTVSYATVL 840
           GEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACADIRQVQRVTVSYATVL
Sbjct: 781 GEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACADIRQVQRVTVSYATVL 840

Query: 841 GLIDESL 847
           GLIDESL
Sbjct: 841 GLIDESL 847

>Kwal_55.21566
          Length = 873

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/856 (55%), Positives = 631/856 (73%), Gaps = 16/856 (1%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60
           MKLLKYP+ LH G +  CA I D LVT G + V VW   QL+  AMG  SA E+ E F  
Sbjct: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVWSCSQLVGAAMGNISAKEVREKFEI 84

Query: 61  KG-NFNNEKLCYVFATDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITDIKY 119
           K      E L  V  +D  L+VGTD  + YADS LE  EK  F ++Y VE P+ +TD+K+
Sbjct: 85  KVLEARLEPLRLVVGSDACLYVGTDRTVLYADSLLEKGEKTSFQTLYHVEAPACVTDVKF 144

Query: 120 DPLNNILFILVSLTSKKN-VAILYEGRTCTRLAEILL-PTKPMTGIIDPMGQIFTIVGAA 177
           D     +F+LV+  ++ N VA+L       ++ +I L  +KP+TG++DP GQIFT++ A 
Sbjct: 145 DFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLGASKPITGVVDPAGQIFTVICAD 204

Query: 178 RSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDR 237
           R++S++QY + GS+KL+H+L  Y+Q+DP+ Y+++MSP ADT+P++NS+  STP+++LLDR
Sbjct: 205 RNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGSTPAILLLDR 264

Query: 238 NNEFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGT-TRYNLLASSGNENGSVAVWNTKRA 296
            + FK+  TLVG+  KC+I +FSP+LYEK  K+GT   YNL A+SG + GSV +WNTKR 
Sbjct: 265 KSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVIWNTKRL 324

Query: 297 RPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQAS 356
           +PL N      +F+ DL W+DDG  LFAV+++G +++FAF+++ELG+ LP+    KL++ 
Sbjct: 325 KPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVDKLRSD 384

Query: 357 IKKLEPLPTEELKP-SHDIKPK--TSGGSSVNLSLNPXXXXXXXXXXXXXXXIQSTSMEF 413
              L PLP  E+   +  IKP+    G S V   +N                I+S SMEF
Sbjct: 385 CATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVN-------GKNKVAPTTIRSLSMEF 437

Query: 414 NPPSYSVPKDLKRKPKDEETMVNGKKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRV 473
             PSYSVPKDLKR+PKD       KKQK D++PMDFLDT++LMP +SFSK+RLA PK+R+
Sbjct: 438 IAPSYSVPKDLKRRPKDPLQATTNKKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPKVRL 497

Query: 474 SFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLSSAGESF 533
           SF Y P  + +L   VKNG+GNEQ PT I+L LKE  Q++ IF+DF+PK +T+ ++G++F
Sbjct: 498 SFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIFEDFLPKLITICTSGDNF 557

Query: 534 WACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLK 593
           W+CC++DGT+YVYSD+G++LLPPMIMGVPCSFLEACG +LLCVTS+GQ+YCW++D  RL 
Sbjct: 558 WSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDASRLL 617

Query: 594 FPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLI 653
           FP  ++YPLL+P LR+SDD+LTRAENITMCT+T +GVP++TLSNGDGYM+D  ME W+LI
Sbjct: 618 FPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVWMLI 677

Query: 654 SDSWWAYGSQYWDMXXXXXXXXXXX--SDKDDKKNRYWNPEAENLVSNVRSNKSSIVNYL 711
           +DSWWAYGSQYWD              +DK DKKN+ WN EA+ L  +++ NKSSI+NYL
Sbjct: 678 NDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSILNYL 737

Query: 712 ESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTR 771
           ES+TNDEL+RKGR+RNLQKFAKTILMKEG+ENLE++VTLSHLEN++LVSL+L E +EFT+
Sbjct: 738 ESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEEFTK 797

Query: 772 LLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACADIRQVQR 831
           LL +YCIRL EMGYKNRL+DVLQWLY++GNYK + +AG   EELL++ILVACADIR VQR
Sbjct: 798 LLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEELLRKILVACADIRHVQR 857

Query: 832 VTVSYATVLGLIDESL 847
           VT SYAT +GLIDE L
Sbjct: 858 VTTSYATAIGLIDECL 873

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/862 (57%), Positives = 618/862 (71%), Gaps = 27/862 (3%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60
           MKLLKYP+QLHDG L A   +   LV VG +R+S +D  +L   A G+ +  E+S     
Sbjct: 1   MKLLKYPRQLHDGQLLAGCVVGGLLVVVGRDRISAYDCGKLQAAARGELAVREVSAEVEL 60

Query: 61  KGNFNNEKLCYVFATDKKLFVGTDHALFYADS-WLETREKMVFHSIYRVEPPSTITDIKY 119
           +     + L YV   + +L V  D  ++ A + W        F ++ ++   + +TD+K 
Sbjct: 61  QVEVGEDALRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVKA 120

Query: 120 DPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGAARS 179
           D       + VS++ K  V  LY      R+  + L  KP+T ++DP+G++ T+V   RS
Sbjct: 121 DGAG---LVFVSVSGKDEV-WLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVVLQNRS 176

Query: 180 ISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDRNN 239
           +++YQYN +G+ ++  QLPQYVQ +P+ Y++TMSP  D +P++NS++N  PS  LLDR  
Sbjct: 177 VAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTA 236

Query: 240 EFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGT-TRYNLLASSGNENGSVAVWNTKRARP 298
            F V +TLVGY  KCKIL+FSP LYEK NK    T+YNLLASSGNE+GSV VWNTKR +P
Sbjct: 237 GFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKP 296

Query: 299 LFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQASIK 358
           L NAA +  TFIND+ W+ DG GLFA+S+DGY+++FAF E ELG++L   E  KL+ S+ 
Sbjct: 297 LLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSVP 356

Query: 359 KLEPLP--------TEELKPSHDIKPKTSGGSSVNLSLNPXXXXXXXXXXXXXXXIQSTS 410
           +LEPLP          E KP  D KP     SS N                    I STS
Sbjct: 357 RLEPLPPPTPKSLAKSEAKPQQDTKPDAK--SSAN-----SVSAKTGKKKIAPTVITSTS 409

Query: 411 MEFNPPSYSVPKDLKRKPKDEETMVNG---KKQKKDVDPMDFLDTNILMPNISFSKLRLA 467
           MEFN PSY+VPKDLKR+PK +ET   G   K+ K+DV+PMDFLDTN+L+PNISFSK RLA
Sbjct: 410 MEFNEPSYTVPKDLKRRPK-QETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLA 468

Query: 468 TPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLS 527
           TPK+R++FQY     +NL+ +VKNGTG+EQKPTSI+L LK+ E+D ++FQDF P+FVT+ 
Sbjct: 469 TPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTIC 528

Query: 528 SAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDI 587
           + G SFWACCTE+G +YVYS+TGK+LLPPMIMGVP SFLE CG YLLCVTSMGQL+CW++
Sbjct: 529 TCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNV 588

Query: 588 DCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDM 647
              +LKFPVNT+YPLLNP +RYSDD+LTRAENITMCT T+NG+PL+TLSNGDGYMFD DM
Sbjct: 589 KEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDM 648

Query: 648 ETWLLISDSWWAYGSQYWDMXXXXXXXXXXXS--DKDDKKNRYWNPEAENLVSNVRSNKS 705
           E WLLI+DSWWAYGSQYWD            +  DK+DKKN+YWN +AE L+  V+ NK 
Sbjct: 649 EIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEVKKNKK 708

Query: 706 SIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGE 765
           S+VNYLESKTNDE++RKG IRNLQ+FAKTILMKEGFENLEDIVTLSHLENR+LV+LKL E
Sbjct: 709 SVVNYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNE 768

Query: 766 DQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACAD 825
             EFT+LL VYCI L EMG+KNRL+DVL WLYN+G YK+  IA   REELLKQILVACAD
Sbjct: 769 TNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACAD 828

Query: 826 IRQVQRVTVSYATVLGLIDESL 847
           IRQVQRVT SYA+ LGL+D SL
Sbjct: 829 IRQVQRVTTSYASALGLLDVSL 850

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/888 (49%), Positives = 609/888 (68%), Gaps = 59/888 (6%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSE-RVSVWDTKQLLDTAMGKSSANELSELFS 59
           M+LLKYP  +H+  + A AA+   ++  GS   V  W  +QL+DTA  +    +L    S
Sbjct: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60

Query: 60  SKGNFNNEKLCYVFATD-KKLFVGTDHALFYADSWL-------ETREKMVFHSIYRVEPP 111
            + + +     +    D + L++G++H L+    WL        + EKM    ++  + P
Sbjct: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP 120

Query: 112 STITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILL--PTKPMTGIIDPMGQ 169
           STITD+KYD    ILF+L+S    +N  +L+  +T  +L+EI +   +KP+TGIIDP GQ
Sbjct: 121 STITDVKYDINLGILFVLLS---NENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQ 177

Query: 170 IFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLR--- 226
            FT++ + RSI +YQ N  G++KL+++L Q+VQ+ P+HY ++MSP AD +P+INS++   
Sbjct: 178 TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVP 237

Query: 227 -NSTPSVVLLDRNNEFKVSTTLVGYDSK-CKILKFSPNLYEKTN-KTGT-TRYNLLASSG 282
            N+T    LLDRNN +KV+ TLV   S  C++L +SP  YEK N K GT TRYNL+A+SG
Sbjct: 238 NNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSG 297

Query: 283 NENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELG 342
           + +G++ VWNTKR +PLFNA  ++ T IND+ W+ DG  LFA+S+D  +Y FAFQEK+LG
Sbjct: 298 STDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLG 357

Query: 343 QVLPQEETVKLQASIKKL----EPLPTE---------ELKPSHDIKPKTSGGSSVNLSLN 389
             LPQ E   LQ   KKL    EPL  +         +L+ S    P  +      +   
Sbjct: 358 VALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKK 417

Query: 390 PXXXXXXXXXXXXXXXIQSTSMEFNPPSYSVPKDLKRKPKDEETMVN----GKKQKKDVD 445
           P               IQSTSMEFN PSY+VP+DLKRKPK E T  N     KKQKK++ 
Sbjct: 418 PTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPK-EATPSNIAPGSKKQKKELQ 476

Query: 446 PMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLL 505
           P+DFLDT +L+PN SFS++RLATPKIR +F+YSP++N NLI DVKNG+GNEQ+PT + L 
Sbjct: 477 PIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLT 536

Query: 506 LKEPEQDRMIFQDFIPKFVTLSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSF 565
            K  +QD+++FQDFIPK +T+ +AG++FW+ C+EDG++Y+YSD+G++L+ P+++GV  SF
Sbjct: 537 SKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISF 596

Query: 566 LEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTI 625
           LEACG YLLC+TS+G+LYCW+I+ K+L FP NT+YPLLNP LRYSDDILTRAENIT+C+I
Sbjct: 597 LEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSI 656

Query: 626 TKNGVPLLTLSNGDGYMFDCDMETWLLISDSWWAYGSQYWDMXXXXXXXXXXXSDKDDKK 685
           TK GVPL+TLSNGDGY+FD +METWLL+SD WWAYGSQYWD            S      
Sbjct: 657 TKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWD-----TTNTTGLSSSKANT 711

Query: 686 NRYWNPEA--ENLVSNVRSNKSSIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFEN 743
           + +   E+    +VS+++++  SI+N+LE KTNDEL+RKGRI+NLQ+FA+TILMKEGFEN
Sbjct: 712 DSFNGSESNINEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFEN 771

Query: 744 LEDIVTLSHLENRVLVSLKLGEDQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYK 803
           +E+IVTLSHLEN++L+S++L E +EF++L++VYCIRL E+GY +RLNDV QWLY++    
Sbjct: 772 MEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDD---- 827

Query: 804 MEKIAGTT--------REELLKQILVACADIRQVQRVTVSYATVLGLI 843
              I+GT         +  LLK+IL+AC DIRQVQRVT  YA  + +I
Sbjct: 828 -LPISGTGSAFADKDFKRNLLKKILIACGDIRQVQRVTTRYAKEMNII 874

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/862 (49%), Positives = 582/862 (67%), Gaps = 30/862 (3%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60
           MKLLK P +LHDG L  C    ++L  +G + +S+WD++ LL+ A GK+   E+ EL   
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60

Query: 61  KGNF---NNEKLCYVFATD-KKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITD 116
             +    N E   ++   D ++L  G+DH L   D   ++  +     I   +    ITD
Sbjct: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD 120

Query: 117 IKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGA 176
           +KYD +N +LF  VSL SK N   + + +T    + I L +KP++ I DP+GQ+ T++  
Sbjct: 121 LKYDKVNGLLF--VSL-SKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVILQ 177

Query: 177 ARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLD 236
            RS+ IYQY+S G+ KL   + Q+VQ +P+ Y +TMSP  D IP+INSL N+ P+ VLLD
Sbjct: 178 NRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVLLD 237

Query: 237 RNNEFKVSTTLVGYDSKCKILKFSPNLYEKT---NKTGTTRYNLLASSGNENGSVAVWNT 293
           R  +FK+  +LVGY + CKILKFSP +Y KT       T  +NLLASSGNE+G+V VWNT
Sbjct: 238 RIQKFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNT 297

Query: 294 KRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKL 353
            R +PLF+A+ +  ++I DL W++ G+GLFA+S DG + +FAFQE ELG V+P E   + 
Sbjct: 298 NRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEA 357

Query: 354 QASIKKLEPLP--TEELKPSHDIKP-KTSGGSSVNLSLNPXXXXXXXXXXXXXXXIQSTS 410
              IK L+PLP   +  +P   + P KT+  ++ N    P               I ST+
Sbjct: 358 AKEIKLLDPLPFKPKAEEPDTKLPPNKTAQQTTTNSKKQPKAAEITT--------ISSTN 409

Query: 411 MEFNPPSYSVPKDLKRKPKDEETMV-----NGKKQKKDVDPMDFLDTNILMPNISFSKLR 465
           MEF  PSY VPKDLKRKP  E+ ++       KK KK++D +DFLDTN+ +P++SFSK+R
Sbjct: 410 MEFIQPSYMVPKDLKRKPVTEDPLLAQNKPANKKAKKELDQIDFLDTNLFLPSVSFSKVR 469

Query: 466 LATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVT 525
           LA PKIR SFQYS     N + D+KNG GN+QKPTSI+L  K+ E  + +FQ F+PKFVT
Sbjct: 470 LAHPKIRASFQYS--SQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVT 527

Query: 526 LSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCW 585
           L SAG SFWA  T+ G +YV S +G+ L PPM++GVP SFLE  G YLLC+TS+GQ+YCW
Sbjct: 528 LCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCW 587

Query: 586 DIDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDC 645
           +++  ++ FP+N VY LLNP+LRYSDD+L+RAENITMC +T  G+P++TLSNGDGYMFD 
Sbjct: 588 NVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDS 647

Query: 646 DMETWLLISDSWWAYGSQYWDMXXXXXXXXXXXSDKDDKKNRYWNPEAENLVSNVRSNKS 705
            ME W+LI+DSWW YGSQYW+            S+ D+KK++YWN EA+ L   V++NK+
Sbjct: 648 AMEAWMLINDSWWPYGSQYWNF--MSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKN 705

Query: 706 SIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGE 765
           SI+NYLE+KTNDEL+RKGR+++LQ+FAK +LMKEGFENLE+++TL+HLEN++LVS +L E
Sbjct: 706 SIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKE 765

Query: 766 DQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACAD 825
            +E  RLL +YCIR+ EMGY +R +  L WLY+  N K   +    R  L+K I+++CA+
Sbjct: 766 VEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCAN 825

Query: 826 IRQVQRVTVSYATVLGLIDESL 847
           IRQVQRVT SYA  LG+I +SL
Sbjct: 826 IRQVQRVTTSYANELGVISDSL 847

>Scas_699.42
          Length = 885

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/912 (46%), Positives = 585/912 (64%), Gaps = 93/912 (10%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGS-ERVSVWDTKQLLDTAMGKSSANELSELFS 59
           M+LLKYP  L D ++ A  AI   L+ V +   V VW  + L++TA  K    +L E  S
Sbjct: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60

Query: 60  SKGNFNNEKLCY-VFA---TDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPS--T 113
            + +  N KL   VFA   T+  L + T++ +  + +WL   +   F  +++    S   
Sbjct: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120

Query: 114 ITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEIL-------LPTKPMTGIIDP 166
           ITD+K D LN I  +LVS+ S   + +L+   T  +L  ++       L  +P+T IIDP
Sbjct: 121 ITDMKIDQLNKI--VLVSMVSPDQI-LLFNLETL-KLINVIDQEFKPSLNRRPITLIIDP 176

Query: 167 MGQIFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLR 226
            G  FT++ + RS+ +YQ N  G++KL++  PQYVQ+ P+HY +TM P  DT+P+INS++
Sbjct: 177 CGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIK 236

Query: 227 NSTP----SVVLLDRNNEFKVSTTLVG-YDSKCKILKFSPNLYEKTNKTGTTR--YNLLA 279
            ST     + VLLD N+ +K+ +T+V    S  K+LK+SP +YEKTN+   T+  YNLLA
Sbjct: 237 GSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLA 296

Query: 280 SSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEK 339
           +SG E+G++ +WNTKR +PLFNA   +   IND+VW+ DG+ LFA+SDD  +Y FAFQ+ 
Sbjct: 297 TSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDN 356

Query: 340 ELGQVLPQEETVKLQASIKKL-------------------------EPLPTEELKPSHDI 374
           +LG  L  E+   L+   KKL                         E   T+  K     
Sbjct: 357 DLGDQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTK 416

Query: 375 KPKTSGGSSVNLSLNPXXXXXXXXXXXXXXXIQSTSMEFNPPSYSVPKDLKRKP---KDE 431
           KP +   +S+  +L                  QST+MEFNPPSY+VPKDLKRK    K+ 
Sbjct: 417 KPSSKRRTSLKQNL------PAQSQDSMVKITQSTNMEFNPPSYNVPKDLKRKKPKVKES 470

Query: 432 ETMVNG-------KKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPVHNKN 484
            T +NG       KK K+D++P+ FLDT +L+PN+SFS++RLATPKIR+ F Y+P  + N
Sbjct: 471 STPLNGEQNPSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPN 530

Query: 485 LIFDVKNGTGNEQKPTSISLLLK------EPEQDRMIFQDFIPKFVTLSSAGESFWACCT 538
           L   +KNG+G+EQ P+ +SL  K      +  Q ++IFQDFIPK+V    AGESFW CCT
Sbjct: 531 LYMTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCT 590

Query: 539 EDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNT 598
            DGTLY Y+D+G+RLLPPM +GVP +FL+AC +YLLCVTS+G+LYCWD+  K+L FP+ T
Sbjct: 591 SDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTT 650

Query: 599 VYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLISDSWW 658
           VYPLL P +RYSDD+LTR ENITMCT+T  GVPL TLSNGDGY+FD DME+WLL+SD WW
Sbjct: 651 VYPLLKPSIRYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWW 710

Query: 659 AYGSQYWDMXXXXXXXXXXXSDKDDKKNRYWNPEAENLVSNVRS--NKSSIVNYLESKTN 716
           AYGSQYWD            S  +D KN        N +  +++  NK S++N +E KTN
Sbjct: 711 AYGSQYWD------------SLNNDYKN------DSNTLEELKNAENKKSLINMMERKTN 752

Query: 717 DELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTRLLIVY 776
           +EL RKGRI++LQ+FAKT+LMKEGFEN+E+IVTLSHLENR+LVSLKL E  EF  L+I Y
Sbjct: 753 EELDRKGRIKHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAY 812

Query: 777 CIRLGEMGYKNRLNDVLQWLYNNGNY-KMEKIAGTTREELLKQILVACADIRQVQRVTVS 835
             RLGE+GY  RLND+LQW+YN+G   K + + G +RE +LK IL+ACAD+R VQRVT +
Sbjct: 813 SSRLGELGYIERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTKA 872

Query: 836 YATVLGLIDESL 847
           YA+ +G++  S+
Sbjct: 873 YASAIGMLASSI 884

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score =  530 bits (1364), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/439 (54%), Positives = 336/439 (76%), Gaps = 15/439 (3%)

Query: 407 QSTSMEFNPPSYSVPKDLKRKPKDEETMVNG--KKQKKDVDPMDFLDTNILMPNISFSKL 464
           +ST+ +F  PSY VPKDLKRKPK E+ + N   K+ KKD++P+DFLDT +L+PN++FS++
Sbjct: 556 KSTTPDFKNPSYQVPKDLKRKPK-EDALGNAVTKRAKKDLEPVDFLDTGLLLPNVAFSRV 614

Query: 465 RLATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFV 524
           RL+TP IR++   +  ++  ++ +++NG+GNEQKPT + LL K    +R +FQDFIPKFV
Sbjct: 615 RLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFV 674

Query: 525 TLSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYC 584
           +L+++G+ FWAC +EDGTLY+++D G++++PP+ +GVP SFLEACGKYLLCV+S+G+LYC
Sbjct: 675 SLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYC 734

Query: 585 WDIDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFD 644
           W+I   +L+FPV T++PLL+P +RYSDDILTRAENITMC++T NG P+ TLSNGDGYM+D
Sbjct: 735 WNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYD 794

Query: 645 CDMETWLLISDSWWAYGSQYWDMXXXXXXXXXXXSDKDDKKNRYWNPEAENLVSNVRSNK 704
            +METWLL+SD WWAYGSQYWD            +   + +            S+   +K
Sbjct: 795 KNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQ------------SSTEISK 842

Query: 705 SSIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLG 764
           +SIV  LE KTN+EL+RKGRI+NL++FA+TILMKEGFEN+E+IVTLSHLEN++LV+L+L 
Sbjct: 843 ASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLE 902

Query: 765 EDQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACA 824
           E  EF +L+ +Y ++LGE+GY +RL D+  W+ ++ N   + I G  R+EL+K +L ACA
Sbjct: 903 EQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTACA 962

Query: 825 DIRQVQRVTVSYATVLGLI 843
           D+R VQRVT+ YA +LG +
Sbjct: 963 DLRSVQRVTIDYADMLGYL 981

 Score =  253 bits (646), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 226/385 (58%), Gaps = 24/385 (6%)

Query: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSER--VSVWDTKQLLDTAMGKSSANELSELF 58
           M+LLKYP +   GN+ +   I    V V   R  + VW  +QLLDTA  + +   L   +
Sbjct: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60

Query: 59  SSKGNFNNEKLCYVFATDKK--LFVGTDHALFYADSWLETREK----MVFHSIYRVEPPS 112
           S      +++   VFA   +  L++GT+H+++    WL+  E     +    IY     S
Sbjct: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVSQS 120

Query: 113 TITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTR--LAEILLP--TKPMTGIIDPMG 168
            ITD+K+D L +ILF+L     K +   L++ R+  +  +  I L   +KP+TG++DP G
Sbjct: 121 IITDVKWDSLLDILFVLTDRPCKIH---LFDTRSANKKEITSIALDKNSKPLTGVVDPSG 177

Query: 169 Q-IFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRN 227
              FT++ + RSI +Y  N  G YK V +L Q+V + P+HY +TM P AD +PIINSL+ 
Sbjct: 178 AGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKG 237

Query: 228 ST-----PSVVLLDRNNEFKVSTTLV-GYDSKCKILKFSPNLYEKTN-KTGT-TRYNLLA 279
           S+      + VLL+RN  +KV +TLV    S  K+L  SP +YEK N K GT +RYNL+A
Sbjct: 238 SSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVA 297

Query: 280 SSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEK 339
           +S N +GS+ +WNTKR +PLF    I+ + IND++W+ +G+ LFAVS+D  +Y FAF + 
Sbjct: 298 TSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQD 357

Query: 340 ELGQVLPQEETVKLQASIKKLEPLP 364
           +LG+ +P EE   ++ S    EPLP
Sbjct: 358 DLGKTVPMEEIENIRQSNIIKEPLP 382

>Kwal_47.17465
          Length = 800

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/372 (25%), Positives = 168/372 (45%), Gaps = 73/372 (19%)

Query: 37  DTKQLLDTAMGKSSANELSELFSSKGNF----NNEKLCYVFATDKKLFVGTDHALFYADS 92
           D+K+ L  +M + + +     FS  GNF    +++++  ++  D+         +F A++
Sbjct: 10  DSKRPL-ASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDED----QKQPIFGAEN 64

Query: 93  WLE---TREKMVFHSIYRVEPPSTITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTR 149
             E    R ++V H        + I DI + P ++IL   V++   ++V I++ G T  +
Sbjct: 65  DKEHWNVRRRLVAHD-------NDIQDICWAPDSSIL---VTVGLDRSV-IVWNGSTFEK 113

Query: 150 LAEILLPTKPMTGII-DPMGQIFTIVGAARSISIYQYNSKG--SYKLVHQLPQYVQIDPV 206
           +    +    + G+I DP  + F      R++ I++Y+  G  S+ + H + +  +  P+
Sbjct: 114 IKRFDVHQSLVKGVIFDPANKYFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPI 173

Query: 207 ---HYTVTMSPPADTIPIINSLRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNL 263
                 ++ SP    I   N+      SV ++ R + +  S TL+G+DS  ++++F+P L
Sbjct: 174 TTYFRRLSWSPDGQHIAAPNATNGPVSSVSIIARGS-WDTSVTLIGHDSPTEVVRFNPRL 232

Query: 264 YE----KTNKTGTTRYNLLASSGNENG--------------------------------- 286
           ++    KT K      + L S   +NG                                 
Sbjct: 233 FQVLEKKTEKNKPEVESPLVSPETQNGVKDSQDEAGQRKDGQEEQEQEESVEEKVDSVIA 292

Query: 287 ------SVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKE 340
                 ++ VW+T +ARP+F A  IA   I D+VWN +G  LF  S DG +  F F EKE
Sbjct: 293 TAGQDKTLVVWSTGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFGEKE 352

Query: 341 LGQVLPQEETVK 352
           LG+ +P E  V+
Sbjct: 353 LGEAIPLERNVE 364

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 534 WACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDID---CK 590
           W   T DG +Y+Y+  G++ +P + +G     + A  KY++ +T  G LY W+I+   C 
Sbjct: 680 WVLATADGCIYIYTKYGQQKMPKIALGHKVVKMVAVDKYVVILTETGLLYAWNIEAEICI 739

Query: 591 RLKFPV 596
             K P+
Sbjct: 740 HKKVPI 745

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 144/307 (46%), Gaps = 49/307 (15%)

Query: 82  GTDHALFYADSWLE---TREKMVFHSIYRVEPPSTITDIKYDPLNNILFILVSLTSKKNV 138
           G    LF  ++ LE    R ++V H        + I DI + P ++IL   V++   +++
Sbjct: 109 GAVQPLFDMENDLEHWNVRRRLVAHD-------NDIQDICWAPDSSIL---VTVGLDRSI 158

Query: 139 AILYEGRTCTRLAEILLPTKPMTGII-DPMGQIFTIVGAARSISIYQYNSKG---SYKLV 194
            I++ G T  ++    +    + G++ DP  + F      R++ +++Y+ KG   S+ + 
Sbjct: 159 -IVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATASDDRTVKVFRYH-KGTDLSFTIE 216

Query: 195 HQLPQYVQIDPV---HYTVTMSPPADTIPIINSLRNSTPSVVLLDRNNEFKVSTTLVGYD 251
           H + +  Q  P+      ++ SP    I + N+      +V ++ R N +  S +LVG+D
Sbjct: 217 HIITEPFQGSPLTTYFRRLSWSPDGQHIAVPNATNGPVSTVAIISRGN-WDTSVSLVGHD 275

Query: 252 SKCKILKFSPNLYEKTNK-------TGTTRYNLLAS-------------------SGNEN 285
              ++  F+P L+E  +         G ++ N  AS                   +  ++
Sbjct: 276 QPTEVACFNPRLFEHNDNHERGEEVDGASKDNSAASESSGKRRLKDDDRVDSVIATAGQD 335

Query: 286 GSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVL 345
            ++AVW+T RARP+F A  +    + D+ W  DG  LF  S DG + V  F+E ELG+ +
Sbjct: 336 KTLAVWSTSRARPIFVAYDLTSKSVTDIAWTCDGTALFLTSLDGRIIVITFEEGELGKAI 395

Query: 346 PQEETVK 352
           P E+ V+
Sbjct: 396 PLEQNVE 402

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 60/143 (41%), Gaps = 2/143 (1%)

Query: 510 EQDRMIFQDFIPKFVT--LSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLE 567
            Q     + F+P+ V   + S     WA  T  G+LY+Y + G+ L+P + +G     L 
Sbjct: 671 HQGERTLEAFLPEVVISCVGSKACQCWALATASGSLYIYGNHGQLLVPKISIGHKVIKLI 730

Query: 568 ACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITK 627
           A   +++  T     + WDI   +L     +V P+L       + +      +    +  
Sbjct: 731 AWQHFVIAFTETCLFWIWDIRAMKLVEKEISVLPVLVQDQPQCNRVRISRRILDFRMLAD 790

Query: 628 NGVPLLTLSNGDGYMFDCDMETW 650
           +   L+ +S+G  Y++   +  W
Sbjct: 791 SHELLVEMSDGASYVWKKALGCW 813

>Scas_702.16
          Length = 816

 Score = 99.0 bits (245), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 159/319 (49%), Gaps = 40/319 (12%)

Query: 58  FSSKGNF----NNEKLCYVFATDKKLFVGTDHALFYADSWLE---TREKMVFHSIYRVEP 110
           FS  G +    +++++  ++  D++  +     +F  +S  E    R+++V H       
Sbjct: 87  FSPNGKYLASGSDDRILLIWTLDEERPI---QPIFGGESEKERWAVRKRLVAHD------ 137

Query: 111 PSTITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGII-DPMGQ 169
            + I DI + P +++L   VS+   + V I++ G T  +L    +    + G+I DP  +
Sbjct: 138 -NDIQDICWAPDSSLL---VSVGLDRAV-IIWNGITFEKLKRFDVHQSHVKGVIFDPANK 192

Query: 170 IFTIVGAARSISIYQYNSKG--SYKLVHQLPQYVQIDPV---HYTVTMSPPADTIPIINS 224
            F      R++ I++Y+  G  S+ + H + +  +  P+      ++ SP    I   N+
Sbjct: 193 YFATASDDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHIAAPNA 252

Query: 225 LRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRY--------- 275
                 SV +++R   +  + +L+G+D+  ++++F+P L+E  +     +          
Sbjct: 253 TNGPVSSVAIINRGT-WDSNISLIGHDAPTEVVRFNPRLFEVNDGMTPAKRKQDSGPNDS 311

Query: 276 --NLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYV 333
             +++A++G ++ +V VW+T RARP+F A  IA   I D+ W  DG  LF  S D  + +
Sbjct: 312 MESIIATAG-QDKTVVVWSTTRARPIFIAFDIANKSITDMQWTPDGTMLFLTSLDSSITI 370

Query: 334 FAFQEKELGQVLPQEETVK 352
             F++ ELG+++P E+ ++
Sbjct: 371 LVFEDNELGKIIPLEKNIE 389

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 511 QDRMIFQDFIPKFVTLSSAGESF---WACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLE 567
           Q ++    F+P+ V +++ G S    W   T +G+LY+    G+   P + +G     + 
Sbjct: 667 QGKICLTAFLPE-VVITAVGSSHCQCWCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMI 725

Query: 568 ACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVYPLLNPV 606
              +YL+ +T  G  Y WDI+  +L      + P+LN +
Sbjct: 726 NRERYLIALTERGLFYIWDIEDLKLVSKNIPILPILNNI 764

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 98.2 bits (243), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 178/401 (44%), Gaps = 62/401 (15%)

Query: 1   MKLLKYP----KQLHDG-NLGACAAIHD--RLVTVGSE-RVSVWDTKQLLDTAMGKSSAN 52
           MKLLK P    ++ H    +  C    D  RL T G + ++ +W    +L  A   +++ 
Sbjct: 1   MKLLKLPWLQHREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNAST 60

Query: 53  E-------LSELFSSKGNFNNEKLC-----YVFATDKKLFV------GTDHALFYADS-- 92
           +       LS +    G+    K           +D ++ +      GT   +F A+S  
Sbjct: 61  DKDILMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTD 120

Query: 93  ---WLETREKMVFHSIYRVEPPSTITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTR 149
              W   R ++V H        + I DI + P ++I+   VS+   + + I++ G T  +
Sbjct: 121 IEHW-NVRRRLVAHD-------NDIQDICWAPDSSIM---VSVGLDRAI-IIWNGSTFEK 168

Query: 150 LAEILLPTKPMTGII-DPMGQIFTIVGAARSISIYQYNSKG--SYKLVHQLPQYVQIDPV 206
           +    +    + G++ DP  + F      R+I +++Y+  G  S+ + H + +  +  P+
Sbjct: 169 VKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTGETSFSVEHVITEPFKGSPL 228

Query: 207 ---HYTVTMSPPADTIPIINSLRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNL 263
                 ++ SP    I   N++     +V +++R   ++   +LVG+D   ++  F+P +
Sbjct: 229 TTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIERGT-WESPVSLVGHDQPTEVASFNPRI 287

Query: 264 YEKTNKTGTT------------RYNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFIN 311
           +++     TT              + + +S  ++ ++AVW+T +ARPL  A  I    I 
Sbjct: 288 FKRQKDDSTTDTIDGKKTGISDEVDCIVASSGQDKTLAVWSTSKARPLIVAQDICGKSIT 347

Query: 312 DLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVK 352
           D+ W  DG  LF  S D  + V  F++ E G+ +P E+ ++
Sbjct: 348 DMSWTPDGKILFITSLDSSIVVLTFEDNEFGEAIPLEQNIE 388

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 171/367 (46%), Gaps = 56/367 (15%)

Query: 24  RLVTVGSE-RVSVWDTKQLLDTAMGKSSANE-----LSEL-----------FSSKGNF-- 64
           R+ T G + ++ +W    L+  A G+S  +      L+ +           FS  GN+  
Sbjct: 31  RVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPDGNYLA 90

Query: 65  --NNEKLCYVFATDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITDIKYDPL 122
             +++++  ++A D++   G+  +    + W   R+++V H        + I DI + P 
Sbjct: 91  SGSDDRILLIWAMDEENHGGSFGSEGEKEHWT-VRKRLVAHD-------NDIQDICWAPD 142

Query: 123 NNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGII-DPMGQIFTIVGAARSIS 181
           ++IL   V++   ++V I++ G    RL    +    + G+I DP  + F      R++ 
Sbjct: 143 SSIL---VTVGLDRSV-IVWNGLNFERLKRFDVHQSLVKGVIFDPANKYFATASDDRTMR 198

Query: 182 IYQYNSKG--SYKLVHQLPQYVQIDPV---HYTVTMSPPADTIPIINSLRNSTPSVVLLD 236
           +++Y+  G  S+ +   + +     P+      ++ SP    I + N+      SV +++
Sbjct: 199 VFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDGQHIAVPNATNGPVSSVAIIN 258

Query: 237 RNNEFKVSTTLVGYDSKCKILKFSPNLYE---------------KTNKTGTTRYNLLASS 281
           R   +  S +L+G+D+  ++ +F+P L++               K  K      +++A++
Sbjct: 259 RGT-WDSSISLIGHDAPTEVARFNPRLFKSDVEKKAKNAKDELSKDTKNNKKLESIIATA 317

Query: 282 GNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKEL 341
           G ++ S+A+W T R RP+F A  IA+  I D+ WN +G  LF  S D  + +  F   EL
Sbjct: 318 G-QDKSLALWITSRPRPIFVAYDIAQKSITDMAWNPNGNILFVTSLDSSIVMLMFDANEL 376

Query: 342 GQVLPQE 348
           G  +P E
Sbjct: 377 GMPIPIE 383

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 505 LLKEPEQDRMIFQDFIPKFVTLSSAGE---SFWACCTEDGTLYVYSDTGKRLLPPMIMGV 561
           +L   E  R I + FIP  V +S  G     +W+  T DG +Y+ S  G+ L+P + +G 
Sbjct: 664 ILGYHEGQRTI-EAFIPN-VIISGVGSPVSKYWSLATADGFIYIISYNGQLLIPKINLGQ 721

Query: 562 PCSFLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVYPLLN 604
                  C  YLL +T  G  Y WDI  KR      ++ P++N
Sbjct: 722 KVVKQVVCSNYLLVLTERGLFYAWDISAKRSVIKNVSILPIIN 764

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 158/331 (47%), Gaps = 52/331 (15%)

Query: 58  FSSKGNF----NNEKLCYVFATDKKL----FVGTDHALFYADSWLETREKMVFHSIYRVE 109
           FS  G +    +++++  ++A D++       G++H     + W   R+++V H      
Sbjct: 87  FSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHE---REHWT-VRKRLVAHD----- 137

Query: 110 PPSTITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGII-DPMG 168
             + I DI + P ++IL   V++   ++V I++ G T  +L    +    + G++ DP  
Sbjct: 138 --NDIQDICWAPDSSIL---VTVGLDRSV-IVWNGSTFEKLKRFDVHQSLVKGVVFDPAN 191

Query: 169 QIFTIVGAARSISIYQYNSKG--SYKLVHQLPQYVQIDPV---HYTVTMSPPADTIPIIN 223
           + F      R++ I++Y+  G  S+ + H + +  +  P+       + SP    I + N
Sbjct: 192 KYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVPN 251

Query: 224 SLRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNLYEKT---------------- 267
           +      S+ +++R   +  + +L+G+D+  ++ +F+P L+E+                 
Sbjct: 252 ATNGPVSSMAIVNRGT-WDTNVSLIGHDAPTEVARFNPRLFERNAGVKQKKDDDPENALV 310

Query: 268 ----NKTGTTRYNL--LASSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMG 321
               +K      N+  + ++  ++ S+AVW+T R RP+  A  IA   I D+ WN DG  
Sbjct: 311 GQNDDKVHHFDKNIDSVVATAGQDKSLAVWSTSRPRPILVAFDIANKSITDMSWNPDGSL 370

Query: 322 LFAVSDDGYMYVFAFQEKELGQVLPQEETVK 352
           LF  S D  + +F F+  ELG+ +P E+ ++
Sbjct: 371 LFVASLDSSITLFKFENNELGKPIPLEKNME 401

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 513 RMIFQDFIPKFV--TLSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACG 570
           +   + FIP+ +   + S     W   + +G++Y+ S  G++ +P + +G     +    
Sbjct: 696 KRTIETFIPEVIICAIGSKDCKCWCLASANGSIYILSYNGQQRIPKICLGHKVIKMVTSS 755

Query: 571 KYLLCVTSMGQLYCWDIDCKRLKFPVNTVYPLLN 604
           KYLL +T  G  + WD+   +L      + P+LN
Sbjct: 756 KYLLVLTERGLFFAWDLLDLKLVLRNVPILPILN 789

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 1/90 (1%)

Query: 256 ILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVW 315
           ++KF+P +YE  ++     Y L+ +    N  V V++T+   P+  A  +  T I DL W
Sbjct: 324 VVKFNPIMYETASEWVKAPYTLVFAVATTN-EVLVYDTQNTSPIAIAGNLHYTPITDLAW 382

Query: 316 NDDGMGLFAVSDDGYMYVFAFQEKELGQVL 345
           + DG  L   S DG+     F + + G  L
Sbjct: 383 SQDGTLLMISSTDGFCSYIHFTDNDFGTPL 412

>Kwal_27.10385
          Length = 536

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 5/114 (4%)

Query: 254 CKILKFSPNLYEKTNKTG---TTRYNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFI 310
           C ++ F+P  Y+   KT       Y L+ +    +  V V++++   P+     +  T I
Sbjct: 325 CLVISFNPLYYKLATKTQPYINLPYKLVFAVATSD-EVLVFDSETTSPICVIGNLHYTPI 383

Query: 311 NDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQASIKKLEPLP 364
            DL W+ DG+ L   S DG+    +F+E  LG  +  E  VK    +K  E  P
Sbjct: 384 TDLSWSQDGLMLMVSSTDGFCSYISFKEGTLGSQI-GESVVKTANDVKAPEVPP 436

>Scas_512.3
          Length = 534

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 256 ILKFSPNLYEKTN--KTGTTR------YNLLASSGNENGSVAVWNTKRARPLFNAAGIAK 307
           ++ F+PN Y+ T+  + GT +      Y L+ +    N  V +++T   +P+     +  
Sbjct: 339 VVSFNPNFYKLTHEEQEGTKKPYLKLPYRLIYAVATSN-EVLIYDTVNVKPISIIGNLHY 397

Query: 308 TFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEE 349
           T + DL W+ DG  L   S DG+      +E   G+ L  EE
Sbjct: 398 TALTDLSWSQDGNMLMVSSTDGFCSYITIEENLFGEKLTIEE 439

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 256 ILKFSPNLYEKTNKTGTT-RYNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLV 314
           +  FSP  YE   K+     Y L+ +    N  V V++T    PL     I  + I DL 
Sbjct: 322 MAAFSPVFYETCQKSVLKLPYKLVFAIATTN-EVLVYDTDVLEPLCVVGNIHYSPITDLA 380

Query: 315 WNDDGMGLFAVSDDGYM-YVFAFQEKELGQVLPQEETVKLQASIKKLEPLPTEE 367
           W++DG  L   S DG+  YV    E + G         +++      EPL T+E
Sbjct: 381 WSEDGSTLLISSTDGFCSYVSIDTETQFGS--------RIEPPAMHAEPLDTDE 426

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 21/124 (16%)

Query: 225 LRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTR-----YNLLA 279
           LRNSTP V L      F     LV        ++FSP LY+   +TG        Y L+ 
Sbjct: 306 LRNSTPIVAL-----PFLRKPALV--------VRFSPILYKI--ETGVEPWIQLPYKLVF 350

Query: 280 SSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEK 339
           +       V +++T   +P+     +  T + DL W+D G  L   S DG+    + ++ 
Sbjct: 351 AVATST-EVVIYDTVTTKPIAVVGNLHYTPLTDLSWSDSGHLLVVSSTDGFCSYISMEDS 409

Query: 340 ELGQ 343
             G+
Sbjct: 410 LFGE 413

>Scas_657.13
          Length = 411

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 281 SGNENGSVAVWNTKRAR--PLFNAAGIAKTFINDLVWNDDGMGLF-AVSDDGYMYVFAFQ 337
           SG+++G++A+WN   +   P++  + +    +ND  W++  + +F +VS+D  + +   +
Sbjct: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249

Query: 338 EKE 340
           EK+
Sbjct: 250 EKD 252

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 271 GTTRYNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGY 330
           GTT Y+ + +SG  +G V +W+T+    + N   ++ + I+ + +  DG  +   SDDG 
Sbjct: 230 GTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFF-VSDSDISTVRFFSDGNSIITGSDDGI 288

Query: 331 MYVF 334
             +F
Sbjct: 289 ARLF 292

>CAGL0J07854g complement(765463..766761) similar to sp|P53851
           Saccharomyces cerevisiae YNL253w, hypothetical start
          Length = 432

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 23/139 (16%)

Query: 157 TKPMTGIIDPMGQIFTIVGAARSISIYQYNSKGSYKLVH--QLPQYVQIDPVHYTVTMSP 214
           TK    + DP G+   I+   +S SIY +++K  Y+L+H  +L   +  D + Y+VT   
Sbjct: 163 TKLNNALFDPTGEY--ILAITKSDSIYLFSAKDDYRLLHTIKLKSIMSSDTL-YSVTWDS 219

Query: 215 PADTIPIINSLRNSTPSVVLLDRNNE-FKV-STTLVGYDSKCKILKFSPNLYEKTNKTGT 272
               I  + +   S  ++ +   NNE FKV   T   +   C  LK  P           
Sbjct: 220 SGSNI-FLGTKNGSIIAMSINKENNEMFKVLEVTAHRFSVTC--LKIDP----------L 266

Query: 273 TRYNLLASSGNENGSVAVW 291
            RY     SG+++GS ++W
Sbjct: 267 GRYLF---SGSKDGSCSIW 282

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 24/115 (20%)

Query: 241 FKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLF 300
            + ST   G++ K + L   P        TG     +  ++G+++GSV +W     R ++
Sbjct: 426 IRCSTIYSGHEGKIRTLSIDP--------TG-----IWLATGSDDGSVRIWEILTGREVY 472

Query: 301 NAAGIAKT-----FINDLVWNDDG-MGLFAVSDDGYMY-----VFAFQEKELGQV 344
               + K       I+ + WN DG +G+ AV+    ++     +F +  +  G+V
Sbjct: 473 RVQLVNKEDNPEDNIHSVEWNPDGSVGILAVAVGNNIFLIVPPIFGYDIENAGKV 527

>Scas_670.15
          Length = 632

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 10/96 (10%)

Query: 166 PMGQIFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSL 225
           P  + F ++      +I  ++ KG+  +VH LPQ  +      T+  SP    I +I   
Sbjct: 297 PTSRQFGVISGFMPATIAFFDLKGN--VVHSLPQQAK-----NTMLFSPTGRYI-LIGGF 348

Query: 226 RNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSP 261
            N   SV +LDR+++FK  T     ++   + K+SP
Sbjct: 349 GNLQGSVEILDRHDKFKCITKFNATNT--SVCKWSP 382

>CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces
           cerevisiae YCL039w, hypothetical start
          Length = 812

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 28/83 (33%)

Query: 276 NLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFIND----------------------- 312
           N L +SG+E+G V +W+  R     N  G+ K  +ND                       
Sbjct: 729 NKLVASGSEDGKVYIWDRVRG----NILGVLKAHVNDKPAQSNGNINSNNNKKNGKNCNT 784

Query: 313 LVWNDDGMGLFAV-SDDGYMYVF 334
           +VWN     +FA   DDG++ V+
Sbjct: 785 VVWNPADHNMFASGGDDGFIKVW 807

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 24/108 (22%)

Query: 241 FKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLF 300
            + ST   G+  K + L   P+              L  ++G+++G+V VW     R ++
Sbjct: 453 IRCSTVYAGHKGKIRTLSIDPS-------------GLWLATGSDDGTVRVWEILTGREVY 499

Query: 301 NAAGI-----AKTFINDLVWN-DDGMGLFAVSDDGYMY-----VFAFQ 337
            A  +         I  + WN D  +GL AV+    +Y     +F F+
Sbjct: 500 KATIVDIKNNQDDHIETVEWNPDKTVGLLAVAAGENIYLLVPPIFGFE 547

>Kwal_56.22982
          Length = 598

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 49/119 (41%), Gaps = 13/119 (10%)

Query: 465 RLATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQD--FIPK 522
           R+  P  R S +   +H + L+ DVKNGT  E+      L L   E DR+ F+D  F  K
Sbjct: 338 RIRVPTFRQSLRK--MHARGLLEDVKNGTIKEED----LLKLARKENDRLDFRDARFFEK 391

Query: 523 FVTLSSAGESFWACCTEDGTLY-VYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMG 580
               S + +S  +   ED   Y V  D    LL   +      F E   K L    S G
Sbjct: 392 EAETSDSSKSLKS-QEEDSQFYSVKFDKFSHLL---MYDTGKEFFEKRSKSLRKARSTG 446

>YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin
           assembly complex, subunit 3, involved in both nucleosome
           assembly linked with DNA replication and negative
           regulation of the RAS pathway, has WD (WD-40) repeats
           [1269 bp, 422 aa]
          Length = 422

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 13/102 (12%)

Query: 234 LLDRNNEFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNT 293
           L D  N  K     + + +    L++SPN              +LA++G E+G V +W+T
Sbjct: 323 LWDIRNMNKSPIATMEHGTSVSTLEWSPNFD-----------TVLATAGQEDGLVKLWDT 371

Query: 294 KRARPLFNAAGIAKTFINDLVWN-DDGMGLFAVSDDGYMYVF 334
                +F   G     +ND+ W+  D   + +V++D  ++++
Sbjct: 372 SCEETIFTHGG-HMLGVNDISWDAHDPWLMCSVANDNSVHIW 412

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 7/124 (5%)

Query: 257 LKFSPNLYEKTNKTGTTR--YNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLV 314
           + FSP  YE+T+        Y L+ +    N  V  ++T+   P+   + +  T + DL 
Sbjct: 371 VAFSPIFYERTSNKPYVDLPYKLVFAIATIN-QVIFYDTENIEPISIVSNLHYTPLTDLT 429

Query: 315 WNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQ----EETVKLQASIKKLEPLPTEELKP 370
           W+  G  +   S DG+    +      G+   +       VK + S+ + +    ++ K 
Sbjct: 430 WSPRGDMVMVSSTDGFCSAISINTAVFGRRTKKPSFTNTIVKEEISLNREDASEVKQPKR 489

Query: 371 SHDI 374
           SHDI
Sbjct: 490 SHDI 493

>Scas_581.12
          Length = 442

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 254 CKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKR 295
           C ++ F P L+ KTNK GT    +LA  GN    +  W   R
Sbjct: 164 CYVVSFIPLLFNKTNKEGTKE-KILAVGGNSGNIIYDWFIGR 204

>Scas_658.1
          Length = 442

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 15/103 (14%)

Query: 242 KVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLFN 301
           K+   + G+ +    L F PN             NLL S GN+N  V VW+    R L  
Sbjct: 140 KIKYAMDGHTNGTTSLTFLPN-----------SGNLLLSGGNDN-IVKVWDFYHKRNLLR 187

Query: 302 AAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQV 344
                   IN L +NDDG    + S D  + ++   + E G+V
Sbjct: 188 DYKGHSKAINSLDFNDDGTNFISSSFDHTIKIW---DTEQGKV 227

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 49/114 (42%), Gaps = 24/114 (21%)

Query: 241 FKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLF 300
            + ST  VG+  K + +   P        TG     L  ++G+++G+V VW     R ++
Sbjct: 416 IRCSTVYVGHKGKIRTMSIDP--------TG-----LWLATGSDDGTVRVWEILTGREVY 462

Query: 301 -----NAAGIAKTFINDLVWNDDG-MGLFAVSDDGYMY-----VFAFQEKELGQ 343
                NA       I+ + WN D   G+ AV+    ++     +F F+ +  G+
Sbjct: 463 QVTILNAEENNDDHIDVVEWNPDSTTGILAVTAGENIFLLVPPIFGFEIENTGK 516

>AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH]
           complement(397359..398474) [1116 bp, 371 aa]
          Length = 371

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 307 KTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQ 343
           K+ IN L W+++G+ L A   DGY+ VF+   K L Q
Sbjct: 145 KSTINALSWHENGVLLAAGGTDGYLRVFSGYIKGLDQ 181

>Scas_721.29
          Length = 414

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 13/96 (13%)

Query: 250 YDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPLFNAAGIAKTF 309
           + S    L+++PNL             ++AS+G ++G V +W+      +F   G     
Sbjct: 331 HGSSISTLEWNPNLE-----------TIVASAGQDDGLVKLWDVSTDELVFTHGG-HMLG 378

Query: 310 INDLVWN-DDGMGLFAVSDDGYMYVFAFQEKELGQV 344
           +ND+ WN  D   + +VS+D  + V+      + QV
Sbjct: 379 VNDISWNLHDTWLMCSVSNDNSVQVWKPAHNLVEQV 414

>AER073C [2578] [Homologous to ScYDL073W - SH] (770590..773751)
           [3162 bp, 1053 aa]
          Length = 1053

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 214 PPADTIPIINSLRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNLYEKTN--KTG 271
           PP  + P++++L N  PSVVLL     F V   +V   S+  ++     + EK N  K G
Sbjct: 597 PP--SFPMVSTLSNVRPSVVLLKGKYPFDVFDEMV---SRAALILAVKKVREKMNEEKQG 651

Query: 272 TTRYNLLASSGNENGSVA 289
            +R +   S+ + N  VA
Sbjct: 652 VSRRSSWHSNDDNNEHVA 669

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 18/112 (16%)

Query: 240 EFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASSGNENGSVAVWNTKRARPL 299
           EF+   TL G     +IL   PN     + +     N L ++G  +GSV V   +  RP+
Sbjct: 74  EFQPHLTLQG-----EILSSEPNFATSVDVSS----NGLIATGFSDGSVVVAQLRTLRPI 124

Query: 300 FNAAGIA-------KTFINDLVWNDDGMGLFAVSDDGYMY-VFAFQEKELGQ 343
           +N  G          + + D+ ++  G GL AV++D   Y      E E G+
Sbjct: 125 YNFEGFGIQGIEENSSTVRDVKFSPLG-GLLAVANDSGSYGCVTLYETEYGE 175

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 57/138 (41%), Gaps = 29/138 (21%)

Query: 166 PMGQIFTIVGAARSISIYQYNSKGSYKLVHQL----PQYVQIDPVHYTVTMSPPADTIPI 221
           P GQ  T V  A+ + I+   +    K+V  +    P Y+              AD+   
Sbjct: 71  PDGQYLTYVSQAQLLKIFHLKTG---KVVRSMKISSPSYIL------------DADSTST 115

Query: 222 INSLRNSTPSVVLLDRNNEFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGTTRYNLLASS 281
           + ++  +  S++++D  N + ++ +  G+      LKF   L  K           L +S
Sbjct: 116 LLAVGGTDGSIIVVDIENGY-ITHSFKGHGGTISSLKFYGQLNSKI---------WLLAS 165

Query: 282 GNENGSVAVWNTKRARPL 299
           G+ NG V VW+  + + L
Sbjct: 166 GDTNGMVKVWDLVKRKCL 183

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,725,120
Number of extensions: 1311768
Number of successful extensions: 4261
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4314
Number of HSP's successfully gapped: 56
Length of query: 847
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 737
Effective length of database: 12,788,129
Effective search space: 9424851073
Effective search space used: 9424851073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)