Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1979.227327314690.0
ACR087C25726111331e-158
CAGL0I00946g25925810921e-152
Kwal_55.2157024125210811e-150
YOR039W (CKB2)25824510531e-146
Scas_699.4325623510431e-144
KLLA0E21967g26025810381e-144
KLLA0A04818g2772474873e-60
Kwal_47.174492502374506e-55
CAGL0A00275g2662294517e-55
Sklu_1768.43292364453e-53
AGR163W2752674326e-52
Scas_638.72702324301e-51
YGL019W (CKB1)2782354266e-51
YJL102W (MEF2)81925635.6
CAGL0K10076g100836626.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1979.2
         (273 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        570   0.0  
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   441   e-158
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   425   e-152
Kwal_55.21570                                                         421   e-150
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   410   e-146
Scas_699.43                                                           406   e-144
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   404   e-144
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   192   3e-60
Kwal_47.17449                                                         177   6e-55
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   178   7e-55
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        176   3e-53
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   171   6e-52
Scas_638.7                                                            170   1e-51
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   168   6e-51
YJL102W (MEF2) [2813] chr10 (231218..233677) Putative mitochondr...    29   5.6  
CAGL0K10076g complement(983446..986472) similar to sp|P38959 Sac...    28   6.9  

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/273 (100%), Positives = 273/273 (100%)

Query: 1   MAGRTGETSIIRKEEARKEEDVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGR 60
           MAGRTGETSIIRKEEARKEEDVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGR
Sbjct: 1   MAGRTGETSIIRKEEARKEEDVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGR 60

Query: 61  KGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESD 120
           KGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESD
Sbjct: 61  KGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESD 120

Query: 121 ARKLYGLIHARYIITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKL 180
           ARKLYGLIHARYIITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKL
Sbjct: 121 ARKLYGLIHARYIITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKL 180

Query: 181 YCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQ 240
           YCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQ
Sbjct: 181 YCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQ 240

Query: 241 AQLARWQELQRLKLESQLDKEGVELSKNGGYKN 273
           AQLARWQELQRLKLESQLDKEGVELSKNGGYKN
Sbjct: 241 AQLARWQELQRLKLESQLDKEGVELSKNGGYKN 273

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  441 bits (1133), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 230/261 (88%), Gaps = 8/261 (3%)

Query: 15  EARKEE--DVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTD 72
           E R EE    E  DVE        D    ++T SS+YVE WIDLFLG+KGHEYFCDVDT+
Sbjct: 3   ERRLEEHGTAETADVE------MADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTE 56

Query: 73  YITDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARY 132
           YITDRFNLINLQKTVS+FTQVIQY+VDELDDT LE MSR++L QLE+DARKLYGLIHARY
Sbjct: 57  YITDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARY 116

Query: 133 IITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPK 192
           IIT+KGLQKMLQKYRDADF RCPRV+CNFQ LLPVGLHDVPGIDCVKLYCPSCEDLYIPK
Sbjct: 117 IITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPK 176

Query: 193 SSRHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRL 252
           SSRHSSIDGAYFGTSFPGMFLQAFPE+VPKHP KRYVP++FGF+LHKQAQLARWQELQRL
Sbjct: 177 SSRHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRL 236

Query: 253 KLESQLDKEGVELSKNGGYKN 273
           KLE +L K+GV+L+KNGGYK 
Sbjct: 237 KLERELIKKGVDLTKNGGYKK 257

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  425 bits (1092), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 200/258 (77%), Positives = 223/258 (86%), Gaps = 4/258 (1%)

Query: 19  EEDVEMVDVEHQGQGTRV---DEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYIT 75
           E D++M D       +RV   DE   D TDSSEY + WIDLFLGRKGHEYFCDVD +YIT
Sbjct: 3   ERDIQMAD-RMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYIT 61

Query: 76  DRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIIT 135
           DRFNLINLQKTVS+F+QV+QYIVDELDD+ +E MS++RLEQLE+DARK YGLIHARYIIT
Sbjct: 62  DRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIIT 121

Query: 136 VKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSR 195
           VKGLQKML KY+DADFGRC RVYCNFQ LLPVGLHDVPGID VKLYCPSCEDLY PKSSR
Sbjct: 122 VKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSR 181

Query: 196 HSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLE 255
           HSSIDGAYFGTSFPGMFLQAFP+MVPKHP  RYVP+IFGFELHKQAQL RWQELQRLKL 
Sbjct: 182 HSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLV 241

Query: 256 SQLDKEGVELSKNGGYKN 273
            +L  + V+LSK+GG+++
Sbjct: 242 KRLQAKEVDLSKSGGFRD 259

>Kwal_55.21570
          Length = 241

 Score =  421 bits (1081), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 201/252 (79%), Positives = 223/252 (88%), Gaps = 13/252 (5%)

Query: 21  DVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNL 80
           DVEMV+        R D A  + +DSSEY EFWIDLFLGRKGHEYFCD+DT+YITDRFNL
Sbjct: 3   DVEMVE-------ARPDTA--EGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNL 53

Query: 81  INLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQ 140
           INLQK+V++FTQVIQY+VDELDD  LEQMS +RLEQLE DARKLYGLIHARY+IT+KGLQ
Sbjct: 54  INLQKSVNKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQ 113

Query: 141 KMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSID 200
           KMLQKY++ADFGRCPRVYCNFQ LLPVGLHDVPG DCVKLYC  CEDLYIPKSSRHS+ID
Sbjct: 114 KMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAID 173

Query: 201 GAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDK 260
           GAYFGTSFPGMFLQAFPEMVPKHPVKRYVP+IFGFELHKQAQ+ARWQELQR+KLE  L +
Sbjct: 174 GAYFGTSFPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLRE 233

Query: 261 EGVELSKNGGYK 272
           +G+    +GGYK
Sbjct: 234 QGI----DGGYK 241

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  410 bits (1053), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 190/245 (77%), Positives = 219/245 (89%), Gaps = 3/245 (1%)

Query: 32  QGTRVDEANHDTTDSS---EYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVS 88
           +G+RV++ +    D S   EYV+ WIDLFLGRKGHEYFCDVD +YITDRFNL+NLQKTVS
Sbjct: 14  EGSRVEQDDVLMDDDSDSSEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVS 73

Query: 89  RFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQKMLQKYRD 148
           +F+ V+QYIVD+LDD+ LE M+ +RLEQLESD+RKLYGLIHARYIIT+KGLQKM  KY++
Sbjct: 74  KFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKE 133

Query: 149 ADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 208
           ADFGRCPRVYCN Q LLPVGLHD+PGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF
Sbjct: 134 ADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 193

Query: 209 PGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDKEGVELSKN 268
           PGMFLQAFP+MVPKHP KRYVP+IFGFELHKQAQL RWQELQRLKL  +L+ + V+L+K+
Sbjct: 194 PGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLTKS 253

Query: 269 GGYKN 273
           GG+K 
Sbjct: 254 GGFKT 258

>Scas_699.43
          Length = 256

 Score =  406 bits (1043), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 190/235 (80%), Positives = 213/235 (90%)

Query: 37  DEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQY 96
           D++  + TDSSEYV+ WIDLFLG+KGHEYFCD+D DYITDRFNLINLQKTVS+F+QV+QY
Sbjct: 20  DDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQY 79

Query: 97  IVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQKMLQKYRDADFGRCPR 156
           IVDELD++ LE MS +RLEQLE+DARK YGLIHARYIITVKGLQKML K++DADFGRCPR
Sbjct: 80  IVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPR 139

Query: 157 VYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAF 216
           VYCN+Q LLPVGLHD PG+DCVKLYC SCEDLYIPKS RHS IDGA+FGTSFPGMFLQAF
Sbjct: 140 VYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAF 199

Query: 217 PEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDKEGVELSKNGGY 271
           PEMVPKHP K+YVP+IFGFELHKQAQLARWQE QRLKLE +L    V+L+KNGGY
Sbjct: 200 PEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRLKLEKKLKTLDVDLTKNGGY 254

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  404 bits (1038), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 187/258 (72%), Positives = 216/258 (83%), Gaps = 7/258 (2%)

Query: 15  EARKEEDVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYI 74
           E  ++ DV M D         V     D +DS EYVE+WIDLFLG+KGHEYFCD+DT+YI
Sbjct: 9   ETTEQPDVVMADA-------LVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYI 61

Query: 75  TDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYII 134
           TDRFNLINLQKTVS+FT V+QY+VD+L++  +E MS +RLEQLE+D RKLYGLIHARYII
Sbjct: 62  TDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYII 121

Query: 135 TVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSS 194
           T KGLQKMLQKY+ ADFGRCPR +CN Q LLPVGLHD+PGIDCVKLYCPSCEDLY PKSS
Sbjct: 122 TAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSS 181

Query: 195 RHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKL 254
           RHS+IDGAYFGTSFPGMFLQ FPEM PKHP KRYVP++FGF+LHKQAQL RWQELQRLKL
Sbjct: 182 RHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWQELQRLKL 241

Query: 255 ESQLDKEGVELSKNGGYK 272
           E  L  +G+ L+++GGY+
Sbjct: 242 EKLLITKGINLNESGGYQ 259

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  192 bits (487), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/247 (42%), Positives = 147/247 (59%), Gaps = 21/247 (8%)

Query: 38  EANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYI 97
           E ++D++DS  Y E WI  F  R GHEYFC V TD+I D FNL  L + V+ + + +  I
Sbjct: 5   EPSNDSSDSGNYEE-WIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTI 63

Query: 98  VDELDDTALEQMSRSRLEQ--------------LESDARKLYGLIHARYIITVKGLQKML 143
           +D L+ T+ E+  ++                  +E  A +LYGLIHAR+I+T  GLQ M 
Sbjct: 64  LD-LESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMA 122

Query: 144 QKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAY 203
           +K+   +FG CPR +C    LLP GL D  G   V+LYCPSC+DLYIP+SSRH S++GAY
Sbjct: 123 EKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAY 182

Query: 204 FGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDK 260
           +GTSFPG+FL+ F E+   V K   + Y  +IFGF + K+A       +Q L+   + D+
Sbjct: 183 WGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEAICG--PRMQWLRQYPKTDE 240

Query: 261 EGVELSK 267
           E  E  K
Sbjct: 241 EWEEFKK 247

>Kwal_47.17449
          Length = 250

 Score =  177 bits (450), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 137/237 (57%), Gaps = 23/237 (9%)

Query: 37  DEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQY 96
           D +   ++D S   + WI  F  R GHEYFC V T++I D FN+  L + V  + + +  
Sbjct: 7   DNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHYRKALDL 66

Query: 97  IVD------ELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQKMLQKYRDAD 150
           ++D      E    + E +SRS +E     A +LYGL+HARYI+T  GLQ M +K+   +
Sbjct: 67  VLDLEAMSDEEGQDSEEPVSRSIVEHA---AEQLYGLVHARYILTKPGLQAMAEKFDHKE 123

Query: 151 FGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPG 210
           FG CPR YC    +LP GL D  G   V+LYCPSC+DLY+P+SSRH  ++GA++GTSFPG
Sbjct: 124 FGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEGAFWGTSFPG 183

Query: 211 MFLQAFPEM---VPKHPVKRYVPRIFGFELHKQAQLA---RW--------QELQRLK 253
           +FL+ F E+   V +     Y  R+FGF +  +A      RW        QEL+ L+
Sbjct: 184 VFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARMRWLRQHPKTPQELRELQ 240

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  178 bits (451), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 131/229 (57%), Gaps = 26/229 (11%)

Query: 38  EANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYI 97
           E N  + DS  Y E WI  F  R GHEYFC V TD+I D FN+ +L + V  + + +  I
Sbjct: 6   EDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDLI 64

Query: 98  VD--------ELDDTALEQMSRSRLEQ--------------LESDARKLYGLIHARYIIT 135
           +D        ++D+      S S                  +   A +LYGLIHARYI+T
Sbjct: 65  LDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHARYILT 124

Query: 136 VKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSR 195
             GLQ M +K+   DFG CPR +C+   LLP GL D  G   V+LYCPSC+DLY+P+SSR
Sbjct: 125 KPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSSR 184

Query: 196 HSSIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQA 241
           H  ++GAY+GTSFPG+FL+ F E+   V +   + Y  ++FGF ++ QA
Sbjct: 185 HLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  176 bits (445), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 133/236 (56%), Gaps = 36/236 (15%)

Query: 53  WIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIVD------------- 99
           WI  F  R GHEYFC V T++I D FN+  L + +  + + +  I+D             
Sbjct: 92  WIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKALDLILDLEAMSDEDDEDDN 151

Query: 100 ---ELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQKMLQKYRDADFGRCPR 156
                +D + E ++RS +E     A +LYGLIHARYI+T  GLQ M +K+   +FG CPR
Sbjct: 152 DGAAEEDGSGEPVNRSIMEHA---AEQLYGLIHARYILTKPGLQSMAEKFDHKEFGTCPR 208

Query: 157 VYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAF 216
            YC    +LP GL D  G   V+LYCPSC+DLY+P+SSRH  +DGA++GTSFPG+FL+ F
Sbjct: 209 YYCGGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGVFLKHF 268

Query: 217 PEM---VPKHPVKRYVPRIFGFELHKQ--------------AQLARWQELQRLKLE 255
            E+   V +     Y  ++FGF+++ +              A  A W+E ++ + E
Sbjct: 269 KELEDYVERKSKDVYELKVFGFKINGEAVSGPRMKWLRQYPATEAEWEEFEKCEFE 324

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  171 bits (432), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 140/267 (52%), Gaps = 52/267 (19%)

Query: 42  DTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIVD-- 99
           D ++SS Y E WI  F  R GHE+FC V T++I D FNL  L   V  + + +  I+D  
Sbjct: 9   DVSESSNYDE-WITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLILDLE 67

Query: 100 ----------------------ELDDTALEQMSRSRLEQLESD-----ARKLYGLIHARY 132
                                   + T++ Q + +  + +        A +LYGLIHARY
Sbjct: 68  SLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLIHARY 127

Query: 133 IITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPK 192
           I+T +GLQ M +K+   +FG CPR YC    LLP GL D  G + V+LYC SC+DLY+P 
Sbjct: 128 ILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDLYLPH 187

Query: 193 SSRHSSIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQ--------- 240
           SSRH  ++GA++GTSFPG+FL+ F E+   V +     Y  RIFGF + K+         
Sbjct: 188 SSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKESISGPRMEW 247

Query: 241 -----AQLARWQELQR-----LKLESQ 257
                +  A WQE ++     LKLE Q
Sbjct: 248 LRQYPSTEAEWQEFEKCEYEILKLEDQ 274

>Scas_638.7
          Length = 270

 Score =  170 bits (430), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 94/232 (40%), Positives = 132/232 (56%), Gaps = 34/232 (14%)

Query: 45  DSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIVD----- 99
           DS  Y E WI  F  R GHEYFC+V T++I D FNL +L + V  + + +  I+D     
Sbjct: 18  DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKALDLILDLEAIS 76

Query: 100 -------------------ELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQ 140
                              EL     + ++RS +E     A +LYGLIHARYI+T  GLQ
Sbjct: 77  EEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHA---AEQLYGLIHARYILTKPGLQ 133

Query: 141 KMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSID 200
            M +K+   +FG CPR +C    LLP GL D  G   V+LYCPSC+DLY+P+SSR   ++
Sbjct: 134 AMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLE 193

Query: 201 GAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQA---QLARW 246
           GA++GTSFPG+FL+ F E+   V +     Y  ++FGF+++ +A   Q  +W
Sbjct: 194 GAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  168 bits (426), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 131/235 (55%), Gaps = 33/235 (14%)

Query: 39  ANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYIV 98
            + D  DS  Y E WI  F  R GHEYFC V T++I D FN+ +L + V  + + +  I+
Sbjct: 13  GSSDDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLIL 71

Query: 99  D------------------------ELDDTALEQMSRSRL-----EQLESDARKLYGLIH 129
           D                        + +D   E   R++        +E  A +LYGLIH
Sbjct: 72  DLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIH 131

Query: 130 ARYIITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLY 189
           AR+I+T  GLQ M +K+   +FG CPR YCN   LLP GL D  G   V+LYCPSC+DLY
Sbjct: 132 ARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLY 191

Query: 190 IPKSSRHSSIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQA 241
           +P+SSR   ++GA++GTSFPG+FL+ F E+   V +   + Y  ++FGF ++ +A
Sbjct: 192 LPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246

>YJL102W (MEF2) [2813] chr10 (231218..233677) Putative mitochondrial
           translation elongation factor G, which promotes
           GTP-dependent translocation of nascent chain from A-site
           to P-site of ribosome [2460 bp, 819 aa]
          Length = 819

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 95  QYIVDELDDTALEQMSRSRLEQLES 119
           + IVDELD T+LEQ +R R   +E+
Sbjct: 233 EIIVDELDGTSLEQCNRCRESMIET 257

>CAGL0K10076g complement(983446..986472) similar to sp|P38959
           Saccharomyces cerevisiae YDR080w VPS41 required for the
           vacuolar assembly, hypothetical start
          Length = 1008

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 79  NLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRL 114
           +L++L     RF++VI Y+++  DD   E + R++L
Sbjct: 711 SLVSLNLEAKRFSKVIPYMIENKDDRIFEILVRNKL 746

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,118,195
Number of extensions: 399955
Number of successful extensions: 1297
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1289
Number of HSP's successfully gapped: 20
Length of query: 273
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 173
Effective length of database: 13,134,309
Effective search space: 2272235457
Effective search space used: 2272235457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)