Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1938.51961967851e-107
Scas_533.41961967252e-98
CAGL0J00957g1971977052e-95
KLLA0E09416g1981987052e-95
YLR009W (RLP24)1991997033e-95
ADR346W1971976625e-89
Kwal_33.152991961966611e-88
YGR148C (RPL24B)155571563e-13
YGL031C (RPL24A)155571536e-13
Sklu_1642.2149911529e-13
Kwal_14.2299155911511e-12
CAGL0A01562g155911493e-12
KLLA0E10857g155571432e-11
AFR477C155911432e-11
Scas_648.9155901397e-11
Scas_4.166521293e-10
CAGL0L12584g294116606.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1938.5
         (196 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1938.5 YLR009W, Contig c1938 7059-7649                           306   e-107
Scas_533.4                                                            283   2e-98
CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomy...   276   2e-95
KLLA0E09416g complement(836948..837544) similar to sgd|S0003999 ...   276   2e-95
YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal...   275   3e-95
ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH] complement...   259   5e-89
Kwal_33.15299                                                         259   1e-88
YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosoma...    65   3e-13
YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosoma...    64   6e-13
Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement         63   9e-13
Kwal_14.2299                                                           63   1e-12
CAGL0A01562g 152953..153420 highly similar to sp|P24000 Saccharo...    62   3e-12
KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA Kluyv...    60   2e-11
AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C...    60   2e-11
Scas_648.9                                                             58   7e-11
Scas_4.1                                                               54   3e-10
CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080 S...    28   6.3  

>Sklu_1938.5 YLR009W, Contig c1938 7059-7649
          Length = 196

 Score =  306 bits (785), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 157/196 (80%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMS           AFYKNRMRGNKEREF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDKSLVESNPELLKVREVEIANKLASKEA                            KQ
Sbjct: 121 LRDKSLVESNPELLKVREVEIANKLASKEAEEQDEEMDVDSEEEIDVESEEESEEEQEKQ 180

Query: 181 KVLLKNKRKNSKKIAF 196
           KVLLKNKRKNSKKIAF
Sbjct: 181 KVLLKNKRKNSKKIAF 196

>Scas_533.4
          Length = 196

 Score =  283 bits (725), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 141/196 (71%), Positives = 152/196 (77%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSPVYP HGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAMS           AFYKNRMRGNKER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDK LVE+NPELL++REVEIANKLA ++                             KQ
Sbjct: 121 LRDKKLVEANPELLRMREVEIANKLAREQERAEMVSEEEEEEEEMDIDSEEEEEEQLEKQ 180

Query: 181 KVLLKNKRKNSKKIAF 196
           K+LLKNK++NSKKIAF
Sbjct: 181 KILLKNKKRNSKKIAF 196

>CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomyces
           cerevisiae YLR009w, start by similarity
          Length = 197

 Score =  276 bits (705), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 151/197 (76%), Gaps = 1/197 (0%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSPVYP HGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMS           AFYKNRM+GN ER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAXXXXXXXXXXXXXXXXXXXXXXXXXXX-XK 179
           LRDK LVE+NPELL++REVEIAN+LA ++A                             K
Sbjct: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAAEEVSEEESEEEEDMEVDSEEEEEEKLQK 180

Query: 180 QKVLLKNKRKNSKKIAF 196
           QK+LLKNK++N+KK+AF
Sbjct: 181 QKILLKNKKRNAKKLAF 197

>KLLA0E09416g complement(836948..837544) similar to sgd|S0003999
           Saccharomyces cerevisiae YLR009w, start by similarity
          Length = 198

 Score =  276 bits (705), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 138/198 (69%), Positives = 151/198 (76%), Gaps = 2/198 (1%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y+CHFCSSP YP HGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMS           AFYKNRM+GN ER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMKGNNERDF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAXXXXXXXXXX--XXXXXXXXXXXXXXXXXX 178
           LRDK+LVESNPELL++REVE+A + A +EA                              
Sbjct: 121 LRDKALVESNPELLRLREVELARQAAKEEAIEQASDEEMDIESEAESEVESESEAEEQLQ 180

Query: 179 KQKVLLKNKRKNSKKIAF 196
           KQK+LLKNKRKNSK+IAF
Sbjct: 181 KQKILLKNKRKNSKRIAF 198

>YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal
           protein with similarity to ribosomal protein L24 [600
           bp, 199 aa]
          Length = 199

 Score =  275 bits (703), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 139/199 (69%), Positives = 150/199 (75%), Gaps = 3/199 (1%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSP YP HGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAM+           AFYKNRMRGNKE++F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAXX---XXXXXXXXXXXXXXXXXXXXXXXXX 177
           LRDK LVESNPELL++REVEIA KLA ++                               
Sbjct: 121 LRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQL 180

Query: 178 XKQKVLLKNKRKNSKKIAF 196
            KQK+LLKN+R+N+KKIAF
Sbjct: 181 EKQKILLKNRRRNTKKIAF 199

>ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH]
           complement(1316666..1317259) [594 bp, 197 aa]
          Length = 197

 Score =  259 bits (662), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 146/197 (74%), Gaps = 1/197 (0%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIYSCHFCSSPVYP HGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTLTFAQRRNVPVRYNRELV TTLKAM+           AFYKNRM+GN E++F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVETTLKAMTRIEEIRQKRERAFYKNRMKGNTEKDF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAX-XXXXXXXXXXXXXXXXXXXXXXXXXXXK 179
           LRDK LVESNPELLK+REVE+  +     A                             +
Sbjct: 121 LRDKKLVESNPELLKMREVELQRQAERAAAGVDEDAEMGDSDEEMEDASEEESEEEEQQQ 180

Query: 180 QKVLLKNKRKNSKKIAF 196
           QK++LKNK++++KKIAF
Sbjct: 181 QKIVLKNKKRSAKKIAF 197

>Kwal_33.15299
          Length = 196

 Score =  259 bits (661), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 141/196 (71%)

Query: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MR+YSCHFCSSP YP HGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSXXXXXXXXXXXAFYKNRMRGNKEREF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AM+           AFYKNRMRGNKEREF
Sbjct: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKSLVESNPELLKVREVEIANKLASKEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDK LVE NPELLKVR+VE+    A   A                            KQ
Sbjct: 121 LRDKQLVERNPELLKVRDVELDRAEARAAAREAESEEEMDVDSEAESESEQESEAEREKQ 180

Query: 181 KVLLKNKRKNSKKIAF 196
            V+L  KRKN+KK+AF
Sbjct: 181 AVVLTTKRKNTKKLAF 196

>YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosomal
          protein L24B (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Ap [468 bp, 155 aa]
          Length = 155

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YP  G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosomal
          protein L24A (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Bp [468 bp, 155 aa]
          Length = 155

 Score = 63.5 bits (153), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YP  G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement
          Length = 149

 Score = 63.2 bits (152), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YP  G +FVR D+K FRF  SK    FKQR+NPRK+ WT  +R+   
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRKIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAIVGASL 87

>Kwal_14.2299
          Length = 155

 Score = 62.8 bits (151), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YP  G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSSSLFKQRKNPRRIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKSQRAIVGASL 87

>CAGL0A01562g 152953..153420 highly similar to sp|P24000
          Saccharomyces cerevisiae YGR148c RPL30B or sp|P04449
          Saccharomyces cerevisiae YGL031c RPL30A, start by
          similarity
          Length = 155

 Score = 62.0 bits (149), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YP  G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAIVGASL 87

>KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA
          Kluyveromyces lactis 60S RIBOSOMAL PROTEIN L24 (L30),
          start by similarity
          Length = 155

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YP  G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRR 57

>AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C
          (RPL24B) - SH] (1296295..1296762) [468 bp, 155 aa]
          Length = 155

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YP  G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAVVGASL 87

>Scas_648.9
          Length = 155

 Score = 58.2 bits (139), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  + +YP  G +F+R D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRNVPVRYNRELVATTL 90
          K +  + +    +R    V+  R +V  +L
Sbjct: 61 KGITEEVS---KKRTRKAVKAQRPIVGASL 87

>Scas_4.1
          Length = 66

 Score = 54.3 bits (129), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 1  MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWT 52
          M++    F  + +YP  G +F+R D+K FRF  SK    F QR+NPR++ WT
Sbjct: 3  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWT 54

>CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080
           Saccharomyces cerevisiae YPL039w, hypothetical start
          Length = 294

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 48/116 (41%), Gaps = 27/116 (23%)

Query: 2   RIYSCHF------------CSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKL 49
           +IY+C+             C S   P    + +R   ++++  R K  K  ++ R+PR +
Sbjct: 127 KIYTCYSNVTGLKEEEIINCCSITRP----ILIRRSREQYKAIRYKQMKDARRERDPRII 182

Query: 50  KWTKAFRK--AAGKELA---------VDSTLTFAQRRNVPVRYNRELVATTLKAMS 94
           + T    +  A   +LA         + ST TF +R N+       L A+ +  MS
Sbjct: 183 QLTNDMNEDTATMSDLALHNFLEPFDITSTFTFTKRNNIGTSAPASLGASMMLNMS 238

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,587,551
Number of extensions: 138244
Number of successful extensions: 309
Number of sequences better than 10.0: 18
Number of HSP's gapped: 303
Number of HSP's successfully gapped: 19
Length of query: 196
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 100
Effective length of database: 13,272,781
Effective search space: 1327278100
Effective search space used: 1327278100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)