Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1938.41641648581e-120
KLLA0E09438g1631595959e-80
YLR008C (PAM18)1681585481e-72
ADR345C1581655462e-72
Kwal_33.152981711685143e-67
Scas_590.71581594976e-65
CAGL0J00935g1531304932e-64
Scas_716.46144821786e-17
YNL328C (MDJ2)146661742e-16
AGR393W142651733e-16
CAGL0D02552g143661725e-16
Sklu_2034.5142681716e-16
KLLA0E02024g146701631e-14
Kwal_55.22136145641612e-14
KLLA0F13860g13951710.11
KLLA0C02981g16258650.66
CAGL0I08019g128540670.71
Scas_555.9*353154650.97
YHR120W (MSH1)95952641.5
YNL064C (YDJ1)40935622.5
CAGL0G02783g49076613.6
KLLA0B02420g50350605.4
CAGL0L13002g94940605.7
KLLA0E07876g49529596.6
YMR161W (HLJ1)22461586.7
KLLA0F24156g94026597.5
Scas_613.747633588.9
Kwal_33.1386057826589.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1938.4
         (164 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        335   e-120
KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   233   9e-80
YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   215   1e-72
ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   214   2e-72
Kwal_33.15298                                                         202   3e-67
Scas_590.7                                                            196   6e-65
CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   194   2e-64
Scas_716.46                                                            73   6e-17
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    72   2e-16
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    71   3e-16
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    71   5e-16
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         70   6e-16
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    67   1e-14
Kwal_55.22136                                                          67   2e-14
KLLA0F13860g 1284278..1284697 similar to sp|P42949 Saccharomyces...    32   0.11 
KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces c...    30   0.66 
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    30   0.71 
Scas_555.9*                                                            30   0.97 
YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in ...    29   1.5  
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    28   2.5  
CAGL0G02783g 256580..258052 similar to sp|P40486 Saccharomyces c...    28   3.6  
KLLA0B02420g 213115..214626 similar to sp|P43636 Saccharomyces c...    28   5.4  
CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces...    28   5.7  
KLLA0E07876g complement(709306..710793) weakly similar to sp|P53...    27   6.6  
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    27   6.7  
KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces...    27   7.5  
Scas_613.7                                                             27   8.9  
Kwal_33.13860                                                          27   9.6  

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  335 bits (858), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/164 (100%), Positives = 164/164 (100%)

Query: 1   MAPPTQFDVPQLPIPGADNSRLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQH 60
           MAPPTQFDVPQLPIPGADNSRLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQH
Sbjct: 1   MAPPTQFDVPQLPIPGADNSRLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQH 60

Query: 61  PVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTL 120
           PVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTL
Sbjct: 61  PVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTL 120

Query: 121 TKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164
           TKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK
Sbjct: 121 TKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  233 bits (595), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 116/159 (72%), Positives = 130/159 (81%), Gaps = 2/159 (1%)

Query: 7   FDVPQLPIPGADNS-RLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQHPVLTG 65
            +VPQLPIPG DNS R+ E V + +       P P Q SGMDLYFDQALD MG HPVLTG
Sbjct: 6   IEVPQLPIPGEDNSNRVPEQVVIGHPA-AGVPPIPQQKSGMDLYFDQALDYMGDHPVLTG 64

Query: 66  IGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTLTKKKL 125
           +GGFF LYF AGAY+SVS +LGG++   K+LKGGFDPKMNA EAL ILNLNE+ L+KKKL
Sbjct: 65  VGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLSKKKL 124

Query: 126 KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164
           KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEK+ +RK
Sbjct: 125 KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVVRK 163

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  215 bits (548), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 118/158 (74%)

Query: 7   FDVPQLPIPGADNSRLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQHPVLTGI 66
            + PQLPIPG  N      V  +       N +  Q +GMDLYFDQAL+ MG+HPV+TG 
Sbjct: 11  IEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEHPVITGF 70

Query: 67  GGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTLTKKKLK 126
           G F TLYF AGAY+S+S  L G      FLKGGFDPKMN+ EALQILNL E+TLTKKKLK
Sbjct: 71  GAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLTENTLTKKKLK 130

Query: 127 EVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164
           EVHR+IMLANHPDKGGSP+LATKINEAKDFLEKRGI K
Sbjct: 131 EVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK 168

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  214 bits (546), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 125/165 (75%), Gaps = 8/165 (4%)

Query: 1   MAPPTQFDVPQLPIPGADNS-RLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQ 59
           MAPPT  ++PQLPIPG DNS    + + L  A        P Q  GMDLYFD+ +D +G+
Sbjct: 1   MAPPT-IEIPQLPIPGEDNSAHPAQQIRLEQAA------VPQQKRGMDLYFDKVVDFVGE 53

Query: 60  HPVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNEST 119
           HPV+ GIGGF  LY  AG +R+VS ++ G   A KFLKGGFDPKMN  EAL ILNL EST
Sbjct: 54  HPVVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTEST 113

Query: 120 LTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164
           LTKK++K+VHR+IMLANHPDKGGSPYLATKINEAKDFLEKRGIRK
Sbjct: 114 LTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 158

>Kwal_33.15298
          Length = 171

 Score =  202 bits (514), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 104/168 (61%), Positives = 118/168 (70%), Gaps = 10/168 (5%)

Query: 7   FDVPQLPIPGA----DNSRLQEPV------ALSNATPITTNPAPSQPSGMDLYFDQALDV 56
            + PQLPIPG      N+  QEPV      A           A ++  GMD  FD AL  
Sbjct: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSGAGGAEGAEMVGKIANASNEKGGMDQAFDDALAF 63

Query: 57  MGQHPVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLN 116
           MGQHPVL+G GGF  LYF AGA++SVS  LGG     ++ KGGFDPKMN  EA+QILNLN
Sbjct: 64  MGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123

Query: 117 ESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164
           E++L +KKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRG+RK
Sbjct: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGVRK 171

>Scas_590.7
          Length = 158

 Score =  196 bits (497), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 114/159 (71%), Gaps = 12/159 (7%)

Query: 7   FDVPQLPIPGADNSRLQEPVALSNATPITTNPAP-SQPSGMDLYFDQALDVMGQHPVLTG 65
            +VPQL IPG            ++ +P  T   P S  +GMDLYFD+A+  MG+HPV+TG
Sbjct: 11  LEVPQLAIPGE-----------ASGSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTG 59

Query: 66  IGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTLTKKKL 125
           +  F TLY  AG Y+S+STKL G    A FLKGGFD KMN  EALQILNL E+ L  KKL
Sbjct: 60  VAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKL 119

Query: 126 KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK 164
           KEVHR+IMLANHPDKGGSPYLATKINEAKDFLEK+ ++K
Sbjct: 120 KEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSVKK 158

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  194 bits (493), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 93/130 (71%), Positives = 101/130 (77%)

Query: 33  PITTNPAPSQPSGMDLYFDQALDVMGQHPVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGA 92
           P     AP    GMDLYFD AL  MG+HPVL G+GGF  LY  AG Y+ V T+L G   A
Sbjct: 21  PAGATQAPGSKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAA 80

Query: 93  AKFLKGGFDPKMNAGEALQILNLNESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINE 152
            +FLKGGFDPKMNA EALQILNL E+ LT KKLKEVHR+IMLANHPDKGGSPYLATKINE
Sbjct: 81  TQFLKGGFDPKMNAKEALQILNLKENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINE 140

Query: 153 AKDFLEKRGI 162
           AKDFLEK+GI
Sbjct: 141 AKDFLEKKGI 150

>Scas_716.46
          Length = 144

 Score = 73.2 bits (178), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (64%), Gaps = 6/82 (7%)

Query: 83  STKLGGN--TGAAKFLKGGFDPKMNAGEALQILNLNESTLTK---KKLKEVHRRIMLANH 137
           STKL     T   +F +GGF P M   EA+ IL+++   + K   K LK  HR  M+ NH
Sbjct: 57  STKLSNELKTKLDQF-QGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNH 115

Query: 138 PDKGGSPYLATKINEAKDFLEK 159
           PDKGGSPYLATKINEA++ LE+
Sbjct: 116 PDKGGSPYLATKINEAREVLER 137

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 71.6 bits (174), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 97  KGGFDPKMNAGEALQILNLNE---STLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEA 153
           +GGF P+M   EAL IL+++    + L +K LK+ HR+ M+ NHPD+GGSPY+A KINEA
Sbjct: 74  QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEA 133

Query: 154 KDFLEK 159
           K+ LE+
Sbjct: 134 KEVLER 139

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 71.2 bits (173), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 44/65 (67%), Gaps = 3/65 (4%)

Query: 98  GGFDPKMNAGEALQILNL---NESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 154
           GGF  +MN  EA+ IL +       L +  LK+ HRR ML NHPDKGGSPY+A KINEA+
Sbjct: 73  GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYVAMKINEAR 132

Query: 155 DFLEK 159
           D +E+
Sbjct: 133 DVMEQ 137

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 70.9 bits (172), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 97  KGGFDPKMNAGEALQILNLNES---TLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEA 153
           +GGF   M+  EAL ILN+ +    +L    LK+ HR  ML NHPDKGGSPYL+ KINEA
Sbjct: 72  EGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHPDKGGSPYLSAKINEA 131

Query: 154 KDFLEK 159
           K+ LEK
Sbjct: 132 KELLEK 137

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 70.5 bits (171), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 98  GGFDPKMNAGEALQILNLNEST---LTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 154
           GGF  +M   EAL IL ++      L    LK  HRR ML NHPDKGGSPYLA KINEA+
Sbjct: 70  GGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRAMLQNHPDKGGSPYLAMKINEAR 129

Query: 155 DFLEKRGI 162
           + LE RGI
Sbjct: 130 ETLE-RGI 136

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 67.4 bits (163), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 3/70 (4%)

Query: 98  GGFDPKMNAGEALQILNLNE---STLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 154
           GGF  KM+  EAL IL ++      L ++ L++ HRR M+ NHPDKGGSP++A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 155 DFLEKRGIRK 164
           D L    I K
Sbjct: 133 DLLANSVILK 142

>Kwal_55.22136
          Length = 145

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (65%), Gaps = 3/64 (4%)

Query: 98  GGFDPKMNAGEALQILNLNES---TLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 154
           GGF  KM   EAL IL ++ S    L +  LK  HR+ ++ NHPD+GGSPYLA KINEA+
Sbjct: 75  GGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGSPYLALKINEAR 134

Query: 155 DFLE 158
           D L 
Sbjct: 135 DILS 138

>KLLA0F13860g 1284278..1284697 similar to sp|P42949 Saccharomyces
           cerevisiae YJL104w singleton, start by similarity
          Length = 139

 Score = 32.0 bits (71), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 108 EALQILNL-NESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFL 157
           E+ +ILN+ NE  +   K+ E  + +   N  +KGGS YL +KI  A + L
Sbjct: 56  ESSKILNIENEQDMNLDKINERFKYLFEINDKEKGGSFYLQSKIYRAAERL 106

>KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces
           cerevisiae YJR097w singleton, start by similarity
          Length = 162

 Score = 29.6 bits (65), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 117 ESTLTKKKLKEVHRRIMLANHPDKGG----------SPYLATKINEAKDFLEKRGIRK 164
           ES  +  ++K  +R ++L  HPDK G          S +  T I EA   L  + +RK
Sbjct: 12  ESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLIDQDLRK 69

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
            Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 30.4 bits (67), Expect = 0.71,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%)

Query: 50   FDQALDVMGQHPVLTGIGGFFTLYF--LAGAYRSVSTKLG 87
            FD  +  + Q P   G+GG F LYF  L   Y S+S +LG
Sbjct: 1026 FDSLMARIAQVP---GLGGIFALYFAPLKHNYTSISNRLG 1062

>Scas_555.9*
          Length = 353

 Score = 29.6 bits (65), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 59/154 (38%), Gaps = 39/154 (25%)

Query: 50  FDQALDVMGQHPV-------------LTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKF- 95
           F  AL  M  HPV             LT    +  L  +  A     T+LGG TGA +F 
Sbjct: 171 FFNALRHMANHPVDGFTNQGIAWFHDLTQADPYLGLQLITAAVLISFTRLGGETGAQQFS 230

Query: 96  --LKGGFD--------PKMNAGEALQI---LNLNESTLTKKKL--KEVHRRIMLAN---- 136
             +K  F           MN   A+ +   +N + S L    L  K V +++ +A+    
Sbjct: 231 GPMKKFFTILPLVSIPATMNLSAAVVLYFAINGSFSVLQTVVLRNKWVRKKLAIADVAKP 290

Query: 137 ------HPDKGGSPYLATKINEAKDFLEKRGIRK 164
                  P+KG    L   +  AKD  EKR I K
Sbjct: 291 PVGLPKEPEKGIWQSLKDNMANAKDQAEKRRIMK 324

>YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in
           mitochondrial DNA repair, homolog of E. coli MutS [2880
           bp, 959 aa]
          Length = 959

 Score = 29.3 bits (64), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 5/52 (9%)

Query: 23  QEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQHPVLTGIGGFFTLYF 74
           Q+   LS+  P   +  PS     DL     +D+   H VLT +G F+ LYF
Sbjct: 64  QQDDKLSSTEPSKASLPPSLQYVRDL-----MDLYKDHVVLTQMGSFYELYF 110

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
           involved in protein import into mitochondria and ER,
           homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 28.5 bits (62), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 119 TLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEA 153
           T T  ++K+ +R+  L  HPDK  S   A K  EA
Sbjct: 16  TATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEA 50

>CAGL0G02783g 256580..258052 similar to sp|P40486 Saccharomyces
           cerevisiae YIL104c, start by similarity
          Length = 490

 Score = 28.1 bits (61), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 9/76 (11%)

Query: 97  KGGFDPKMNA--------GEALQILNLNESTLTKKKLKEVHRRIMLANHPDKGGSPYLAT 148
           K GFD + N         G  +  LN  E+T    ++KE   +  L   PD   S Y+ +
Sbjct: 164 KYGFDAQYNGLIGVSIPNGNDINELNDPENTTENDRIKERLSKENLKFDPDYYVSEYMVS 223

Query: 149 KINEAKDFLEKRGIRK 164
           K    +D LE  GI+K
Sbjct: 224 KYGSEED-LEVNGIKK 238

>KLLA0B02420g 213115..214626 similar to sp|P43636 Saccharomyces
           cerevisiae YGL065c ALG2 mannosyltransferase singleton,
           start by similarity
          Length = 503

 Score = 27.7 bits (60), Expect = 5.4,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 95  FLKGGFDPKMNAGEALQILNLNESTLTKKKLKEVHRRIMLANHPDKGGSP 144
           F+ GG+D  +N  E +  L   E+  T+ KLK VH      ++P+   SP
Sbjct: 254 FISGGYD--LNNSENIDYLKELETLATELKLKHVH-----LSYPEYSKSP 296

>CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces
          cerevisiae YHR120w MSH1, hypothetical start
          Length = 949

 Score = 27.7 bits (60), Expect = 5.7,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 35 TTNPAPSQPSGMDLYFDQALDVMGQHPVLTGIGGFFTLYF 74
          +TN     PS   LY  + +     H VLT +G FF LYF
Sbjct: 55 STNTKTLPPS--LLYVQKLISQYPDHVVLTQMGSFFELYF 92

>KLLA0E07876g complement(709306..710793) weakly similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 495

 Score = 27.3 bits (59), Expect = 6.6,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 22/29 (75%), Gaps = 1/29 (3%)

Query: 112 ILNLNESTLTKKKLKEVHRRIMLANHPDK 140
           IL +N +T T++++K+ +R+  L +HPDK
Sbjct: 10  ILEVN-TTATEQEIKKAYRKKALKHHPDK 37

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticulum
           membrane protein, member of the DnaJ family of putative
           protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 26.9 bits (58), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 108 EALQILNLNESTLTKKKLKEVHRRIMLANHPDKGGSPYLATK---INEAKDFL---EKRG 161
           E  +IL ++    T  ++K+ +R++ +  HPDK   P        IN A + L   EKR 
Sbjct: 21  EFYEILKVDRKA-TDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRS 79

Query: 162 I 162
           I
Sbjct: 80  I 80

>KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces
           cerevisiae YHR120w MSH1 DNA mismatch repair protein,
           mitochondrial, hypothetical start
          Length = 940

 Score = 27.3 bits (59), Expect = 7.5,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 49  YFDQALDVMGQHPVLTGIGGFFTLYF 74
           Y    +D    H VLT IG F+ LYF
Sbjct: 75  YVRDVMDKYTGHVVLTQIGSFYELYF 100

>Scas_613.7
          Length = 476

 Score = 26.9 bits (58), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 131 RIMLANHPDKGGSPYLATKINEAKDFLEKRGIR 163
           R+ L   PD  G  Y A K N+  +  E RGI+
Sbjct: 209 RVSLVESPDGNGGLYQAIKDNKLLEEFENRGIK 241

>Kwal_33.13860
          Length = 578

 Score = 26.9 bits (58), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 118 STLTKKKLKEVHRRIMLANHPDKGGS 143
           S  T+ ++K+ +R+I +A HPDK  S
Sbjct: 21  SDATEAQIKKAYRKIAMAIHPDKNKS 46

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,534,488
Number of extensions: 233085
Number of successful extensions: 814
Number of sequences better than 10.0: 36
Number of HSP's gapped: 801
Number of HSP's successfully gapped: 46
Length of query: 164
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 70
Effective length of database: 13,342,017
Effective search space: 933941190
Effective search space used: 933941190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)