Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1927.134534518460.0
Kwal_55.199263123129081e-122
AEL226W3243138111e-107
KLLA0A07106g3103087112e-92
Scas_617.63303196462e-82
YOR026W (BUB3)3413356116e-77
CAGL0H08217g3253205629e-70
KLLA0E20779g3712932491e-23
Scas_510.53622952463e-23
Kwal_27.107853672992402e-22
CAGL0G03399g3692902393e-22
Sklu_2332.73672942341e-21
AGL301C3612922287e-21
YER107C (GLE2)3652852234e-20
Scas_721.115*318193974e-04
YMR116C (ASC1)319199948e-04
CAGL0M06193g316251910.002
Scas_592.4*318193900.003
Scas_589.131311138880.008
Scas_512.353444870.009
Kwal_55.220761286130870.009
KLLA0D04840g303137850.013
ACR017W423186840.017
AAL009C303136830.022
YBR246W387138830.026
Sklu_2442.2303136810.034
Kwal_26.7736507197820.036
Scas_671.321468109820.042
Kwal_56.23035424172810.043
KLLA0E07942g390105810.047
YNL006W (LST8)303170800.049
AGR168W825115790.086
KLLA0E11143g49347770.15
KLLA0D08514g411204760.18
AFL014C557165760.19
CAGL0K11836g522107760.19
CAGL0E01485g1336133760.21
KLLA0D16390g936299750.26
ADL186C1361174750.26
Scas_721.29414168750.26
Kwal_27.12586509109740.29
AEL314W715105740.33
KLLA0D00814g408176740.35
ABL044C518173740.38
CAGL0H03729g303162730.38
ABR189W40984730.44
YPR178W (PRP4)465206720.56
AGL234W62931720.57
Scas_630.662131720.58
Scas_705.392493720.62
Kwal_23.642975031720.68
Scas_660.7*603238710.71
Scas_685.11384101701.0
Scas_695.15327149691.0
AFR199C334192691.1
YJL112W (MDV1)714141701.1
KLLA0F10263g68231691.3
KLLA0F05159g123166691.5
YKL021C (MAK11)46866681.6
CAGL0M02277g427138681.8
YBL008W (HIR1)84064681.9
CAGL0K07920g47544681.9
Kwal_56.2234539638672.0
CAGL0D02090g27761662.2
CAGL0C03608g64331672.5
Kwal_47.1746580032672.6
Kwal_56.24478129672672.6
Scas_721.732593662.9
CAGL0G04345g711105663.3
CAGL0J03476g517119663.4
Kwal_55.2155935149653.4
CAGL0M05335g80629663.6
Scas_629.1267131663.6
KLLA0B11077g567121653.7
YCR084C (TUP1)71331654.3
Scas_646.14755121654.5
CAGL0B03575g41929645.1
KLLA0E12287g326159645.2
CAGL0G09845g50028645.2
Scas_544.4524142645.2
Scas_711.1169580645.3
YLR450W (HMG2)104565645.4
Scas_720.95515110645.7
KLLA0B01958g89063646.1
KLLA0C08547g515119636.4
Kwal_55.20583190350646.4
AER255C46788636.5
AGL196C93540646.7
Sklu_2071.440645636.7
Scas_700.4435134637.0
Sklu_2371.4478153637.3
YPR135W (CTF4)92747638.1
Kwal_23.386941419628.6
AGR207C32043628.6
YCR072C515110628.9
CAGL0J01265g517134629.0
YJL109C (UTP10)176978639.0
CAGL0I03718g1201158639.0
Kwal_55.21144570119629.0
Kwal_55.2113390659629.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1927.1
         (345 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement          715   0.0  
Kwal_55.19926                                                         354   e-122
AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH] complement(...   317   e-107
KLLA0A07106g complement(640536..641468) similar to sp|P26449 Sac...   278   2e-92
Scas_617.6                                                            253   2e-82
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...   239   6e-77
CAGL0H08217g complement(806660..807637) similar to sp|P26449 Sac...   221   9e-70
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...   100   1e-23
Scas_510.5                                                             99   3e-23
Kwal_27.10785                                                          97   2e-22
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    97   3e-22
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       95   1e-21
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    92   7e-21
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    91   4e-20
Scas_721.115*                                                          42   4e-04
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    41   8e-04
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    40   0.002
Scas_592.4*                                                            39   0.003
Scas_589.13                                                            39   0.008
Scas_512.3                                                             38   0.009
Kwal_55.22076                                                          38   0.009
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    37   0.013
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    37   0.017
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    37   0.022
YBR246W (YBR246W) [425] chr2 (711548..712711) Protein of unknown...    37   0.026
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            36   0.034
Kwal_26.7736                                                           36   0.036
Scas_671.32                                                            36   0.042
Kwal_56.23035                                                          36   0.043
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    36   0.047
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    35   0.049
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    35   0.086
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    34   0.15 
KLLA0D08514g complement(726710..727945) weakly similar to sp|P53...    34   0.18 
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    34   0.19 
CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021 S...    34   0.19 
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    34   0.21 
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    33   0.26 
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    33   0.26 
Scas_721.29                                                            33   0.26 
Kwal_27.12586                                                          33   0.29 
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    33   0.33 
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    33   0.35 
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    33   0.38 
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    33   0.38 
ABR189W [782] [Homologous to ScYPL100W - SH] complement(764140.....    33   0.44 
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    32   0.56 
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    32   0.57 
Scas_630.6                                                             32   0.58 
Scas_705.3                                                             32   0.62 
Kwal_23.6429                                                           32   0.68 
Scas_660.7*                                                            32   0.71 
Scas_685.11                                                            32   1.0  
Scas_695.15                                                            31   1.0  
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    31   1.1  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    32   1.1  
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    31   1.3  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    31   1.5  
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    31   1.6  
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    31   1.8  
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    31   1.9  
CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06...    31   1.9  
Kwal_56.22345                                                          30   2.0  
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    30   2.2  
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    30   2.5  
Kwal_47.17465                                                          30   2.6  
Kwal_56.24478                                                          30   2.6  
Scas_721.7                                                             30   2.9  
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    30   3.3  
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    30   3.4  
Kwal_55.21559                                                          30   3.4  
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    30   3.6  
Scas_629.12                                                            30   3.6  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    30   3.7  
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    30   4.3  
Scas_646.14                                                            30   4.5  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    29   5.1  
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    29   5.2  
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    29   5.2  
Scas_544.4                                                             29   5.2  
Scas_711.11                                                            29   5.3  
YLR450W (HMG2) [3824] chr12 (1032623..1035760) 3-Hydroxy-3-methy...    29   5.4  
Scas_720.95                                                            29   5.7  
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    29   6.1  
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    29   6.4  
Kwal_55.20583                                                          29   6.4  
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    29   6.5  
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    29   6.7  
Sklu_2071.4 YPL100W, Contig c2071 4876-6096                            29   6.7  
Scas_700.4                                                             29   7.0  
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         29   7.3  
YPR135W (CTF4) [5554] chr16 (799228..802011) Protein required fo...    29   8.1  
Kwal_23.3869                                                           28   8.6  
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    28   8.6  
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    28   8.9  
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    28   9.0  
YJL109C (UTP10) [2806] chr10 complement(211917..217226) Componen...    29   9.0  
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    29   9.0  
Kwal_55.21144                                                          28   9.0  
Kwal_55.21133                                                          28   9.8  

>Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement
          Length = 345

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/345 (100%), Positives = 345/345 (100%)

Query: 1   MLSLSVAVFVWFFQHLNNRSISKRGRTIQARARRATMPFHKLQDVTKDYISDLVLLESYS 60
           MLSLSVAVFVWFFQHLNNRSISKRGRTIQARARRATMPFHKLQDVTKDYISDLVLLESYS
Sbjct: 1   MLSLSVAVFVWFFQHLNNRSISKRGRTIQARARRATMPFHKLQDVTKDYISDLVLLESYS 60

Query: 61  HIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLESEK 120
           HIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLESEK
Sbjct: 61  HIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLESEK 120

Query: 121 FGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENK 180
           FGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENK
Sbjct: 121 FGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENK 180

Query: 181 LCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQ 240
           LCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQ
Sbjct: 181 LCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQ 240

Query: 241 EEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPK 300
           EEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPK
Sbjct: 241 EEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPK 300

Query: 301 LDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQPSDIYIKRL 345
           LDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQPSDIYIKRL
Sbjct: 301 LDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQPSDIYIKRL 345

>Kwal_55.19926
          Length = 312

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 221/312 (70%), Gaps = 3/312 (0%)

Query: 37  MPFHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGV 96
           MPF        DYIS LV+     H+  T+WDG++S+Y+Y+  + +  +R+   L S   
Sbjct: 1   MPFECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAY 60

Query: 97  VHNG-KIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVD 155
              G KI+VGSV GE+LEVD ESE+F  +SE AELGIS++C    ++IAGSWDGSL+IVD
Sbjct: 61  SEVGSKIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVD 120

Query: 156 SRNNDTQFETALGH-KVLSMDCHEN-KLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQAR 213
           SR+ D  F   L + K+L MDC +N KL +SLT G+V I+DLR +  P  R++GLKFQ R
Sbjct: 121 SRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTR 180

Query: 214 DIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSS 273
           DIK+MP+  GYVQSSLDGRVAVEYFDQE  +FAFRCHRM+L D QFVFPVN++CF  +  
Sbjct: 181 DIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDG 240

Query: 274 TLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATVEDL 333
           TL+TGGSDGR+Y WNLSTRKKS E PK + S+VK+A  + V+  AT DDSFKT  TVE  
Sbjct: 241 TLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGA 300

Query: 334 PLQPSDIYIKRL 345
            +QP  +Y  +L
Sbjct: 301 EIQPGKVYFTKL 312

>AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH]
           complement(204812..205786) [975 bp, 324 aa]
          Length = 324

 Score =  317 bits (811), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 220/313 (70%), Gaps = 5/313 (1%)

Query: 35  ATMPFHKLQDVTKDYISDLVLL-ESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLS 93
           + M + +L+DV+KDY+S + L+ E  S ++ +SWDG+ S+YD++   R+  L H++PL S
Sbjct: 11  SAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTS 70

Query: 94  TGVVHNGK-IYVGSVQGEMLEVDLESEKFGTVSE-SAELGISSICIQDASVIAGSWDGSL 151
             V    +  YVGS QGE+LE+D ESE+   +      LGIS++      V+ GSWDGSL
Sbjct: 71  VAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGSL 130

Query: 152 RIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKL-GAPVSRKAGLKF 210
            +VD+R N  +    L  K+LS+DC   ++ + +T   V +F    +  AP  R++GLK+
Sbjct: 131 AVVDTRRNTVRHIRRLTGKILSLDCGAARV-VCMTTDGVYVFRTSDIDAAPERRESGLKY 189

Query: 211 QARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKP 270
           Q+R ++++P  EGYVQSS+DGRVAVEYF  E +KFAFRCHRM+L+D Q VFPVN +CF P
Sbjct: 190 QSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHP 249

Query: 271 HSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATV 330
            ++ L+TGGSDGR++AWNL+TRKK++ELPK++ SVVK+ CN R +V A SDDSFKTSA V
Sbjct: 250 KTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDDSFKTSAVV 309

Query: 331 EDLPLQPSDIYIK 343
           ED+ LQ S +Y+K
Sbjct: 310 EDIALQRSRVYVK 322

>KLLA0A07106g complement(640536..641468) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3 cell cycle arrest
           protein, start by similarity
          Length = 310

 Score =  278 bits (711), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 198/308 (64%), Gaps = 2/308 (0%)

Query: 39  FHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVH 98
           + KLQ V KDYISD+ ++ S + +V + WDGS+S++D      L  L+H +PL S  V  
Sbjct: 4   YAKLQGVPKDYISDIRIISSDNRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHVSK 63

Query: 99  NGKIYVGSVQGEMLEVDLESEKF-GTVSESAELGISSICIQDASVIAGSWDGSLRIVDSR 157
           +G+I+ GSVQGE+LE D ESE+     + S  LG+S I   D  +IA SWDGSL ++D  
Sbjct: 64  DGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYL 123

Query: 158 NNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKI 217
            N    +     K+  +   E ++  SL++G+VK+            ++GLK+Q R   +
Sbjct: 124 RNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDI-TETESGLKYQCRSCTL 182

Query: 218 MPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFT 277
           +P+  G+VQ S+DGRV+VE+FD +  KFAFRCHRM+L+D Q VFPV  + F+P+S  LFT
Sbjct: 183 IPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFT 242

Query: 278 GGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQP 337
           GG+DG+I +WNL TRKK +E  KLD +++K+ C +  +V A SDDSFKT A  +D+ L P
Sbjct: 243 GGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIELHP 302

Query: 338 SDIYIKRL 345
           S IYIK L
Sbjct: 303 SAIYIKHL 310

>Scas_617.6
          Length = 330

 Score =  253 bits (646), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 204/319 (63%), Gaps = 17/319 (5%)

Query: 41  KLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYD----SMNRLTSLRHKFPLLSTG- 95
           ++Q+   +YISD+VL++  S  + T+WDGS+S ++Y+     +  +  + H++ LL    
Sbjct: 8   EVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNLKKVKLIKKVVHEYALLCCCY 67

Query: 96  --VVHNGKIYVGSVQGEMLEVDLESEKFGTV-SESAELGISSIC-IQDASVIAGSWDGSL 151
             V+   ++YVG+VQGE+  VD E+  F  V   S +LG+S +  + + + IA SWDG L
Sbjct: 68  AFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGIL 127

Query: 152 RIVDSRNNDTQFETALGH--KVLSMDCHENKLCISLTAGEVKIFDL----RKLGAPVSRK 205
           + +D ++N     T L +  KVL+MDC  N L ++LT  +++  +L       G     +
Sbjct: 128 QEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVE 187

Query: 206 AGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNT 265
            GLK+Q RDIK+    +GYV SS+DGRVAVEYF+ + + FAFRCHRM+L D QFVFPVN+
Sbjct: 188 TGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNS 247

Query: 266 ICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKL-DSSVVKVACNDRVVVAATSDDSF 324
           + F P S  LFTGGSDG +  WNL T KK  + PK  ++SVVK+ACN+ ++V  TSDDSF
Sbjct: 248 LAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSF 307

Query: 325 KTSATV-EDLPLQPSDIYI 342
           KT+A V E L LQ S +Y+
Sbjct: 308 KTNAVVAEPLELQSSRLYV 326

>YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein
           required for cell cycle arrest in response to loss of
           microtubule function [1026 bp, 341 aa]
          Length = 341

 Score =  239 bits (611), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 204/335 (60%), Gaps = 29/335 (8%)

Query: 37  MPFHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYD----SMNRLTSLRHKFPLL 92
           M   +++   KDYISD+ ++ S S ++ TSWDGS+++Y +D    +++ L SLR+K PLL
Sbjct: 1   MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL 60

Query: 93  STGVVHNG--KIYVGSVQGEMLEVDL-ESEKFGTVSES-AELGISSIC-IQDASVIAGSW 147
               + N   +IYVG+VQGE+L+VDL  S  F  ++ + A LGI  IC   D  +IA SW
Sbjct: 61  CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW 120

Query: 148 DGSLRIVDSRN---------NDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLR-- 196
           DG + ++D RN         N     T + +K+ +MD + ++L + +   +V+ F L   
Sbjct: 121 DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC 180

Query: 197 KLGAPVSRKAGLKFQARDIKIMP-SYEGYVQSSLDGRVAVEYFDQE------EKKFAFRC 249
           +       ++GLK+Q RD+ ++P   EGY  SS+DGRVAVE+FD +       K+FAFRC
Sbjct: 181 EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC 240

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDS-SVVKV 308
           HR++L+D    +PVN+I F P    L+T GSDG I  WNL TRKK     K +  SVVK+
Sbjct: 241 HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI 300

Query: 309 ACNDRVVVAATSDDSFKTSATVED-LPLQPSDIYI 342
           AC+D ++  ATSDD+FKT+A ++  + L  S IYI
Sbjct: 301 ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYI 335

>CAGL0H08217g complement(806660..807637) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3, hypothetical
           start
          Length = 325

 Score =  221 bits (562), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 124/320 (38%), Positives = 194/320 (60%), Gaps = 15/320 (4%)

Query: 41  KLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYD----SMNRLTSLRHKFPLLSTGV 96
           +++DV ++YIS + ++   + I+  S+DG++S+Y  D     +N    L+++  L S   
Sbjct: 4   EIKDVPREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQ 63

Query: 97  VH-NGK--IYVGSVQGEMLEVDLESEKFGTVSE-SAELGISSICIQDASVIAGSWDGSLR 152
           ++  G+  IY GSV G++L VDLE+  F  V +  +  GIS I +    VIAGSWDGS+ 
Sbjct: 64  LNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIY 123

Query: 153 IVDSRNNDTQFETALG---HKVLSMDCHENKLCISLTAGEVKIFDL--RKLGAPVSRKAG 207
           +V+ ++N  +F   L     K   +    +KL IS    ++ IF L       P    +G
Sbjct: 124 VVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSG 183

Query: 208 LKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTIC 267
             FQ RD ++ P  +G+V + +DGRV+VEYFD   K+FAFRCH+  L D    +P+N I 
Sbjct: 184 QIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIR 243

Query: 268 FKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKL-DSSVVKVACNDRVVVAATSDDSFKT 326
           F P++S  +TGGSDG + AW+L  + K  +LPK  ++SVV++ACN+ ++  ATSDDSFKT
Sbjct: 244 FIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDSFKT 303

Query: 327 SATVE-DLPLQPSDIYIKRL 345
           +A ++ +L L+PS IY++ L
Sbjct: 304 NAVIDSNLELEPSRIYVEIL 323

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score =  100 bits (249), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 130/293 (44%), Gaps = 35/293 (11%)

Query: 42  LQDVTKDYISDLVL-LESYSHIVCTSWDGSISMYDYDSMNRLTSLR--HKFPLLSTGVVH 98
           L +  +D ISD+    +S      +SWD  + ++D  S +     +  H+ P+L+T    
Sbjct: 30  LNNAAEDSISDIAFSPQSDFMFSVSSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSI 89

Query: 99  NG-KIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQ-----------DASVIAGS 146
           +G K+  G     +   D+      T  ++ ++G  +  +Q              +  GS
Sbjct: 90  DGTKVASGGCDNVLKVFDV------TTGQAQQIGQHNSAVQSLRFVSCGPTNQECIATGS 143

Query: 147 WDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRK- 205
           WD +++  D R+        +  +V  MD  +  + + +    + + DL   G       
Sbjct: 144 WDKTVKYWDLRSPQPIMTLQMPERVYCMDASQKLMVVGMAERHIAVIDLNNPGQIFKTSL 203

Query: 206 AGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKK---FAFRCHRMSLQDAQF--- 259
           + LK+Q R I       G+   S++GR AV+Y D++E++   F+F+CHR  +Q+      
Sbjct: 204 SPLKWQTRSISCYNEGNGFAIGSIEGRCAVQYIDEQEQRKDGFSFKCHRQQVQNNGAAGG 263

Query: 260 -------VFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSV 305
                  V+PVN+I F P   T  T G DG  + W+ + R +    PKL+ S+
Sbjct: 264 RTSTEVQVYPVNSIVFHPIHGTFATAGGDGSFHFWDKNHRHRLKGFPKLNYSI 316

>Scas_510.5
          Length = 362

 Score = 99.4 bits (246), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 127/295 (43%), Gaps = 31/295 (10%)

Query: 42  LQDVTKDYISDLVLLESYSHIV-CTSWDGSISMYDYDS--MNRLTSLRHKFPLLSTGVVH 98
           L +  +D ISD+        I   +SWDG + ++D         +   H  P+LST   +
Sbjct: 29  LNNPAEDSISDIAFSPQQDFIFSVSSWDGKVRIWDVQGGVAQGRSQYEHAGPVLSTRWSN 88

Query: 99  NG-KIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQ-----------DASVIAGS 146
           +G K+  G     +   D+ S       +S ++G+    ++              ++ GS
Sbjct: 89  DGSKVASGGCDNIVKLFDVAS------GQSQQIGMHDAPVKAVRFVNCGPSNTECLVTGS 142

Query: 147 WDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRK- 205
           WD S++  D R         +  +V +MD  +  L +      + I +L   G+      
Sbjct: 143 WDKSIKYWDMRQPQAISTVIMPDRVYTMDSKQQLLVVGTAERHIAIINLNNPGSIFKTTL 202

Query: 206 AGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKK---FAFRCHRMSLQD------ 256
           + LK+Q R +      +GY   S++GR A+ Y D E +K   F+F+CHR +  +      
Sbjct: 203 SPLKWQTRVVSCYNEGDGYAIGSIEGRCAIRYVDDEMQKKSGFSFKCHRQNNPNRTAGSQ 262

Query: 257 AQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACN 311
              V+PVN+I F P   T  T G DG  + W+ + R +    P L SS+  V  N
Sbjct: 263 QSLVYPVNSIAFHPIYGTFATAGGDGCFHFWDKNHRHRLKAFPSLRSSIPVVNFN 317

>Kwal_27.10785
          Length = 367

 Score = 97.1 bits (240), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 129/299 (43%), Gaps = 37/299 (12%)

Query: 42  LQDVTKDYISDLVLLESYSHIV-CTSWDGSISMYDYDSMNRL--TSLRHKFPLLSTGVVH 98
           + +  +D ISD+        +   +SWD  + ++D +          +H+ P+L+T    
Sbjct: 30  INNPAEDSISDIAFSPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWST 89

Query: 99  NG-KIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQD-----------ASVIAGS 146
           +G KI  G     ++  D+ S       +S ++G     ++              ++ GS
Sbjct: 90  DGTKIASGGCDNAVMVFDVSS------GQSQQVGAHDAAVKSLRFVQCGPSNTECLVTGS 143

Query: 147 WDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPV-SRK 205
           WD +++  D R        A+  +V +MD  +  L +      + + DL    A   +  
Sbjct: 144 WDKTIKYWDLRQPQPVSTLAMPERVYTMDSKQKLLVVGTAERHIVVIDLNNPAAIFKTTT 203

Query: 206 AGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKK---FAFRCHRMSLQDAQF--- 259
           + LK+Q R +       GY   S++GR A++Y D +E++   F+F+CHR+  Q       
Sbjct: 204 SPLKWQTRSVSCYIEGNGYAVGSIEGRCAIQYVDDQEQRKSGFSFKCHRVQQQSTGAAGG 263

Query: 260 -------VFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACN 311
                  V+PVN+I F P   T  T G DG  + W+ + R +    P L +++    CN
Sbjct: 264 RSSTESQVYPVNSIVFHPIYGTFATAGGDGSFHFWDKNLRHRLKGFPSLKATI--PVCN 320

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 96.7 bits (239), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 129/290 (44%), Gaps = 22/290 (7%)

Query: 42  LQDVTKDYISDLVLLESYSHIV-CTSWDGSISMYDYDS--MNRLTSLRHKFPLLSTGVVH 98
           + +   D ISD+     +  +   +SWDG + ++D  +          H  P+L T    
Sbjct: 30  INNPADDSISDIAFSPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSL 89

Query: 99  NG-KIYVGSVQGEMLEVDL---ESEKFGTVSESAELGISSIC--IQDASVIAGSWDGSLR 152
           +G +I  G     +   D+   +S++ G+ +++ +      C       ++ GSWD +++
Sbjct: 90  DGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIK 149

Query: 153 IVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPV-SRKAGLKFQ 211
             D+R        A+  +V +MD  +  L +      + I +L        S ++ LK+Q
Sbjct: 150 FWDTRQPQPITTIAMPERVYTMDNKQQLLVVGTAERHIAIINLANPTTIFKSSQSPLKWQ 209

Query: 212 ARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKK---FAFRCHRMSLQD-------AQFVF 261
            R +      +GY   S++GR A++Y D E +K   F+F+CHR +  +          V+
Sbjct: 210 TRVVACYNEGDGYAIGSVEGRCAIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSSQSLVY 269

Query: 262 PVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACN 311
           PVN+I F P   T  T G DG  + W+ + R +    P +  S+    CN
Sbjct: 270 PVNSIAFHPIYGTFVTAGGDGSFHFWDKNQRHRLKGFPSMQGSI--PVCN 317

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 94.7 bits (234), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 131/294 (44%), Gaps = 27/294 (9%)

Query: 42  LQDVTKDYISDLVLLESYSHIV-CTSWDGSISMYDYDS--MNRLTSLRHKFPLLSTGVVH 98
           + +  +D ISD+        +   +SWD  + ++D +           H+ P+L+T   +
Sbjct: 30  INNPAEDSISDIAFSSQQDFLFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSN 89

Query: 99  NG-KIYVGSVQGEMLEVDLESEKFGTVS--ESAELGISSI-C--IQDASVIAGSWDGSLR 152
           +G K+  G     +   D++S +   V   +SA   +  I C       ++ GSWD +++
Sbjct: 90  DGTKVASGGCDNVVKLFDVQSGQAQQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIK 149

Query: 153 IVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKA--GLKF 210
             D R         +  +V +MD  +  L ++     + I DL    A + + A   LK+
Sbjct: 150 YWDMRQPQPVSTLMMPDRVYAMDSKQKLLVVATAERHIAIIDLNNP-ATIFKTATSPLKW 208

Query: 211 QARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKK---FAFRCHRMSLQDA---------- 257
           Q R +       GY   S++GR A++Y D++E++   F+F+CHR   Q            
Sbjct: 209 QTRSVSCYIEGNGYAIGSIEGRCAIQYVDEQEQRKSGFSFKCHRQQQQSTGTAGGRSNTE 268

Query: 258 QFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACN 311
             V+PVN+I F P   T  T G DG  + W+ + R +    P + +S+    CN
Sbjct: 269 SHVYPVNSIVFHPVYGTFATAGGDGSFHFWDKNQRHRLKGFPSMKASI--PVCN 320

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 92.4 bits (228), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 131/292 (44%), Gaps = 27/292 (9%)

Query: 42  LQDVTKDYISDLVLLESYSHIV-CTSWDGSISMYDYDSMNRLTSLR----HKFPLLSTGV 96
           + +   D +SD+        +    +WD ++ ++D    N +T  R    H+ P+L+T  
Sbjct: 28  INNPANDSVSDIAFSPQQDFLFSVAAWDNTVRIWDV--QNGMTQGRAQYEHQAPVLTTRW 85

Query: 97  VHNG-KIYVGSVQGEMLEVDLESEKFGTVS--ESAELGISSICIQDAS---VIAGSWDGS 150
             +G K+  G     +   D+ S +   +   +SA   +  +    ++   ++ GSWD +
Sbjct: 86  SSDGTKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKT 145

Query: 151 LRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKA--GL 208
           ++  D R        A+  +V ++D  +  L +      + + DL    A V R +   L
Sbjct: 146 IKYWDMRQPQPISTVAMPERVYALDSKQKLLVVGTAERHIVVIDLNNP-AQVFRTSMSPL 204

Query: 209 KFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKK---FAFRCHRMS------LQDAQF 259
           K+Q R +       G+   S++GR A++Y D++E++   F+F+CHR              
Sbjct: 205 KWQTRTVACYIEGNGFAIGSVEGRCAIQYVDEQEQRKNGFSFKCHRQQQPASGRASSESL 264

Query: 260 VFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACN 311
           V+PVN+I F P   T  T G DG    W+ + R +    P +++S+    CN
Sbjct: 265 VYPVNSIVFHPQYGTFATAGGDGSCNFWDKNQRHRLKGFPSMNASI--PVCN 314

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 90.5 bits (223), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 125/285 (43%), Gaps = 32/285 (11%)

Query: 47  KDYISDLVLLESYSHIV-CTSWDGSISMYDYDSMNRLTSLRHKF--PLLSTGVVHNG-KI 102
           +D ISD+        +   +SWDG + ++D  +       +H+   P+L T   ++G K+
Sbjct: 36  EDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKV 95

Query: 103 YVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQ-----------DASVIAGSWDGSL 151
             G     +   D+ S       ++ ++G+ S  I+              ++ GSWD ++
Sbjct: 96  ASGGCDNALKLYDIAS------GQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTI 149

Query: 152 RIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPV-SRKAGLKF 210
           +  D R         +  +V SMD  ++ L ++     + I +L        +  + LK+
Sbjct: 150 KYWDMRQPQPVSTVMMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKW 209

Query: 211 QARDIKIMPSYEGYVQSSLDGRVAVEYFD---QEEKKFAFRCHRMSLQD-------AQFV 260
           Q R +      +GY   S++GR ++ Y D   Q++  F+F+CHR +  +          V
Sbjct: 210 QTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFSFKCHRQTNPNRAPGSNGQSLV 269

Query: 261 FPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSV 305
           +PVN+I F P   T  T G DG    W+ + R +    P L +S+
Sbjct: 270 YPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASI 314

>Scas_721.115*
          Length = 318

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 82/193 (42%), Gaps = 17/193 (8%)

Query: 140 ASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGE----VKIFDL 195
           A  ++ SWD +LR+ D    +T ++  +GHK   M    ++    + +G     +K++ +
Sbjct: 78  AYALSASWDKTLRLWDVATGET-YQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI 136

Query: 196 RKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQ 255
           +  G  ++   G       ++I P+ +       D  V V     ++   A+  ++  ++
Sbjct: 137 K--GQCLATLLGHNDWVSQVRIAPTDQN------DDSVTVISAGNDKMVKAWNLNQFQIE 188

Query: 256 DAQFVF---PVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACND 312
            A FV     VNT+   P  + + + G DG I  WNL+ +K    L   D         +
Sbjct: 189 -ADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPN 247

Query: 313 RVVVAATSDDSFK 325
           R  +AA +    K
Sbjct: 248 RYWLAAATASGIK 260

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 86/199 (43%), Gaps = 16/199 (8%)

Query: 134 SICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGE---- 189
           ++    A  ++ SWD +LR+ D    +T ++  +GHK   M    +K    + +G     
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGET-YQRFVGHKSDVMSVDIDKKASMIISGSRDKT 130

Query: 190 VKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRC 249
           +K++ ++  G  ++   G       ++++P+     + + D  V +     ++   A+  
Sbjct: 131 IKVWTIK--GQCLATLLGHNDWVSQVRVVPN-----EKADDDSVTIISAGNDKMVKAWNL 183

Query: 250 HRMSLQDAQFVF---PVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVV 306
           ++  ++ A F+     +NT+   P  + + + G DG I  WNL+ +K    L   D    
Sbjct: 184 NQFQIE-ADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 307 KVACNDRVVVAATSDDSFK 325
                +R  +AA +    K
Sbjct: 243 LAFSPNRYWLAAATATGIK 261

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 112/251 (44%), Gaps = 52/251 (20%)

Query: 79  MNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEV--DLESEKFGTVSESAELGIS-SI 135
           ++RL  + H  P++S    + G +   S   E ++V   L      T+S  +E  +S  +
Sbjct: 89  LHRL--VGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDL 146

Query: 136 CIQDASVIA-GSWDGSLRIVDSRNNDTQFETALGH--KVLSMDCHENKLCISLTAGEVKI 192
              D S+++ GS DG +RI         F+TA GH  K L+ D               K 
Sbjct: 147 SDNDGSILSSGSHDGLIRI---------FDTATGHCLKTLTYD---------------KD 182

Query: 193 FDLRKLGAPVSRKAGLKFQARDIKIM-PSYEGYVQ--SSLDGRVAVEYFDQEEKKFAF-R 248
           +       P+++   +KF A    ++  SY+G V+   S+ G V V  F    KK+    
Sbjct: 183 WQSETGVVPIAK---VKFSANTKYLLVKSYDGVVKIWDSVSGDV-VRTFKPSNKKYNLTH 238

Query: 249 CHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSD--ELPKLDSSVV 306
           C  M      F++P +T      S  + +G   G IY W+ +T+ +    ++ + DS+++
Sbjct: 239 CCGM-----DFMYPQST-----QSPLILSGYEKGEIYCWDSNTKAELQVLKIEECDSAII 288

Query: 307 KVACNDRVVVA 317
            + C++ ++ +
Sbjct: 289 SIDCHNNLMCS 299

>Scas_592.4*
          Length = 318

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 81/193 (41%), Gaps = 17/193 (8%)

Query: 140 ASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGE----VKIFDL 195
           A  ++ SWD +LR+ D    +T ++  +GHK   M    ++    + +G     +K++ +
Sbjct: 78  AYALSASWDKTLRLWDVATGET-YQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI 136

Query: 196 RKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQ 255
           +  G  ++   G       ++I P+ +       D  V V     ++   A+  ++  ++
Sbjct: 137 K--GQCLATLLGHNDWVSQVRIAPTDQN------DDAVTVISAGNDKMVKAWNLNQFQIE 188

Query: 256 DAQFVF---PVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACND 312
            A FV     VN +   P  + + + G DG I  WNL+ +K    L   D         +
Sbjct: 189 -ADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPN 247

Query: 313 RVVVAATSDDSFK 325
           R  +AA +    K
Sbjct: 248 RYWLAAATASGIK 260

>Scas_589.13
          Length = 1311

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 57/138 (41%), Gaps = 25/138 (18%)

Query: 188 GEVKIFDLRKLGAPVSRKAGLKFQA-----RDIKIMPSYEGYVQSS---LDGRVAVEYFD 239
           G VKI+DLR      S +  + F       RD+K MP+Y      +   L G    ++  
Sbjct: 244 GCVKIWDLRSNSIKGSSRCDISFNTGSDSIRDVKWMPNYAFNTTQAVPHLTGSPGYKFAS 303

Query: 240 QEEK----KFAFRCHRMSLQDAQFVFPVNT-----ICFK--PHSSTLFTGGSDGRIYAWN 288
             +     KF  R      Q  QF   +N      +C    PH + + TGG DG+   W 
Sbjct: 304 IHDSGLLLKFDMR------QPGQFEKKINAHTGPGLCLNWHPHENYIATGGRDGKCCLWY 357

Query: 289 LSTRKKSDELPKLDSSVV 306
           +  R++ D     +S+++
Sbjct: 358 VGDRQQLDSNSYTNSNLI 375

>Scas_512.3
          Length = 534

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 262 PVNTICFKPHSST---LFTGGSDGRIYAWNLSTRKKSDELPKLD 302
           PV ++CF+P+S     L T G D +I +WNL+  K ++++  +D
Sbjct: 15  PVYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTID 58

>Kwal_55.22076
          Length = 1286

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 51/130 (39%), Gaps = 41/130 (31%)

Query: 188 GEVKIFDLRKLGAPVSRKAGLKFQA-----RDIKIMPSYEGYVQSSLDGRVAVEYFDQEE 242
           G +K++DLR        K+ L   +     RD+K MP+Y+               F  EE
Sbjct: 236 GCIKVWDLRSSQG-RKNKSDLTINSGSDSVRDVKWMPTYD---------------FSPEE 279

Query: 243 KKFAFRCHRM-SLQDAQFVF-------------------PVNTICFKPHSSTLFTGGSDG 282
           +  + R HR  S+ D+  +                    P   +C+ P +  + TGG DG
Sbjct: 280 QGPSNRGHRFASIHDSGLLLTYDLRQPSQAEKRINAHSGPGLCLCWHPTADYIMTGGRDG 339

Query: 283 RIYAWNLSTR 292
           +   WN  +R
Sbjct: 340 KCCLWNTGSR 349

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 58/137 (42%), Gaps = 16/137 (11%)

Query: 189 EVKIFDLRKLGA-PVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAF 247
            V+++D+R     PVS   G K     I         V SS DG + V           +
Sbjct: 54  HVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKV-----------W 102

Query: 248 RCHRMSLQ-DAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVV 306
                S+Q + +   PVN +   P+   L +   DG I  W+L   + +++L   D++ +
Sbjct: 103 DVRSPSVQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPL 162

Query: 307 K---VACNDRVVVAATS 320
           +   VA +  ++VA  +
Sbjct: 163 QSLSVASDGSMLVAGNN 179

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 70/186 (37%), Gaps = 26/186 (13%)

Query: 115 DLESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSM 174
           + ES  FGTVSE   L +               D  +R+   +    +  TA     LS 
Sbjct: 240 EFESNVFGTVSEDKTLQVH--------------DKRVRLEPVK----KLPTASPFNTLSF 281

Query: 175 DCH-ENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRV 233
             H  N L  +    ++ ++D+R + +P+   +G +     ++  P  +G + SS   R 
Sbjct: 282 SKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRR 341

Query: 234 AVEY------FDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGG-SDGRIYA 286
           A+ +       +Q +         + +  A    PVN   F P    L      D  I A
Sbjct: 342 AIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQA 401

Query: 287 WNLSTR 292
           W +S +
Sbjct: 402 WKVSMK 407

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 14/136 (10%)

Query: 189 EVKIFDLRKLGA-PVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAF 247
            V+++D+R     PV+   G +     I      +  V SS DG + V  +D        
Sbjct: 54  HVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKV--WDVRSPSV-- 109

Query: 248 RCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVK 307
              R    DA    PVN +   P+   L +   DG I  W+L   + +++L   D++ ++
Sbjct: 110 --QRNYKHDA----PVNEVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQ 163

Query: 308 ---VACNDRVVVAATS 320
              +A +  ++VA  +
Sbjct: 164 SLSIASDGSMLVAGNN 179

>YBR246W (YBR246W) [425] chr2 (711548..712711) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.3427p [1164 bp, 387 aa]
          Length = 387

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 63/138 (45%), Gaps = 19/138 (13%)

Query: 174 MDCHENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRV 233
           +DC   KL ++ TAGE    D+R L    +  A  +  ++  KI   YE  VQ + +  +
Sbjct: 132 LDC--KKLLVTNTAGEAATIDIRTLSVQFTASAIAQAYSKLDKI--DYE--VQGATEKVI 185

Query: 234 AVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
            VE       +F  + H +    A+F         +P    +FTGG D RI A +L +++
Sbjct: 186 HVE-----SGQF-LKPHELECWTAEFG------SLQPFQDVVFTGGDDSRIMAHDLRSKE 233

Query: 294 KSDELPKL-DSSVVKVAC 310
                 ++ D+ VV + C
Sbjct: 234 FIWSNNRIHDAGVVSIKC 251

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 57/136 (41%), Gaps = 14/136 (10%)

Query: 189 EVKIFDLRKLGA-PVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAF 247
            V+++D+R     PV+   G +     I      +  V SS DG + V        +  +
Sbjct: 54  HVRLYDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNY 113

Query: 248 RCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDEL-PKLDSSV- 305
           + H           PVN +   P+   L +   DG I  W+L   + + +L P+ D+ + 
Sbjct: 114 KHHA----------PVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQ 163

Query: 306 -VKVACNDRVVVAATS 320
            + +A +  ++VA  +
Sbjct: 164 SLSIASDGSMLVAGNN 179

>Kwal_26.7736
          Length = 507

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 81/197 (41%), Gaps = 34/197 (17%)

Query: 132 ISSICIQDAS---VIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAG 188
           + S+C+   +   V+ GS+DG +R+ D+R N+     A G  V  +        +S    
Sbjct: 171 VRSVCMVPQAPHLVVTGSYDGQVRLFDTRTNERATTLAQGMPVEDVIAVSATQLVSCGGP 230

Query: 189 EVKIFDLRKLGAPVSRKAGLKFQARDIKIM---------PSYEGYVQSSLDGRVAV-EYF 238
           + K++DL     P+  +A     A+ +  +         P     V SSLDG V + +  
Sbjct: 231 KFKVWDL-TAQRPLLERANF---AKTVTCLNHVDLVEDSPMSSTLVASSLDGHVKIFDPL 286

Query: 239 DQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSST----LFTGGSDGRIYAWNLSTRKK 294
           D  + KF ++          F  PV +    P  +     L  G S G +    + T++K
Sbjct: 287 DGYKVKFGWK----------FSAPVLSCAVSPGDAQGNKHLVAGLSSGLLA---IRTKRK 333

Query: 295 SDELPKLDSSVVKVACN 311
           + +  K+D   V  + N
Sbjct: 334 AQKNEKVDIEKVTKSSN 350

>Scas_671.32
          Length = 1468

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 6/109 (5%)

Query: 101 KIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVD-SRNN 159
           K+ + +++GE+L V LES  F     S E+ I S+ +   S+      G+L I D S+ N
Sbjct: 103 KVILVTLEGEILSVSLESLGFPETIHSLEVRIKSLFLYQDSLYLLDTQGTLSIFDLSKKN 162

Query: 160 DTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKAGL 208
            T+    L  +V S D  + +L + L   +V++F++   G  +   +G 
Sbjct: 163 LTK---VLEDQVASFDILDTRLTVLLKNQDVQVFNIN--GPSIEPSSGF 206

>Kwal_56.23035
          Length = 424

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 145 GSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVS- 203
           GS D  +++ D+   +      +GH+V+ +D   + L ++      ++ DL  + A ++ 
Sbjct: 161 GSNDHKVKVWDTNAFEVASTIDVGHRVVQLDVQGDLLAVASEDSHPRLIDLASMSAAITL 220

Query: 204 --RKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQ--- 258
             ++  +++     K   S EG  Q  L    A    D   + +  R    +L D Q   
Sbjct: 221 GVKRTDMRYGINTAKFARSDEGSPQQLL----ATGDDDGNVRLWDLRMGNRALCDLQEPD 276

Query: 259 -FVFP----VNTICFKPHSST-LFTGGSDGRIYAWNLSTRKKSDELPKLDSS 304
               P     N +C+ P  +  + T G+DG+   W +S    S  L ++ ++
Sbjct: 277 SLAKPHARCCNDLCWDPSGANRIVTTGNDGKCKLWEISPDGSSQLLRQIGAT 328

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 23/105 (21%)

Query: 242 EKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKL 301
           E +F+   H   ++D QF               L T GSDGRI  W++ TR   D++   
Sbjct: 268 EAEFSLLGHSNRVKDFQFYH-------NKFGHYLVTIGSDGRIVVWDMKTR---DQVAVY 317

Query: 302 DSSVVKVACNDRVVVAATSDDSFKTSATV-----EDLPL-QPSDI 340
           D       C +R+   A  D+S +   TV     E++ + +PSD+
Sbjct: 318 D-------CGERLNCVAVCDESIEKYDTVKKRAPEEVEVGEPSDV 355

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 71/170 (41%), Gaps = 18/170 (10%)

Query: 178 ENKLCISLTAGEVKIFDLRKLGA-PVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVE 236
           + KL  +     V+++D+R     PV+   G +     +         V SS DG + V 
Sbjct: 43  DKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKV- 101

Query: 237 YFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSD 296
            +D               ++ +   PVN +   P+   L +   DG I  W+L   + + 
Sbjct: 102 -WDVRSPSIP--------RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152

Query: 297 EL-PKLDSSV--VKVACNDRVVVAATSDDSFKTSATVEDLPLQPSDIYIK 343
           +L P+ D+S+  + +A +  ++ AA +    K +  V ++P      ++K
Sbjct: 153 QLTPEDDTSLQSLSMASDGSMLAAANT----KGNCYVWEMPNHTDASHLK 198

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 35.0 bits (79), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 49/115 (42%), Gaps = 27/115 (23%)

Query: 195 LRKLGAPVSRKAG----LKFQ--------ARDIKIMPSYE---GYVQSSLDGRVAVEYFD 239
           LRK  A +SR  G    LKF           D KI+  +E   G VQ   D    +E+++
Sbjct: 66  LRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWN 125

Query: 240 QEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKK 294
              +  A   H   +QD         IC+ P SS L T G D  I  WN ST +K
Sbjct: 126 VRRRLVA---HDNDIQD---------ICWAPDSSILVTVGLDRSIIVWNGSTFEK 168

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 262 PVNTICFKPHSST------LFTGGSDGRIYAWNLSTRKKSDELPKLD 302
           P+ ++CF+P S T      LFT G D +I  W L+  +   ++  +D
Sbjct: 16  PIYSLCFQPLSETNQNTRRLFTSGGDNKIRVWQLNESENDGKIETID 62

>KLLA0D08514g complement(726710..727945) weakly similar to sp|P53873
           Saccharomyces cerevisiae YNL187w hypothetical protein
           singleton, start by similarity
          Length = 411

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 79/204 (38%), Gaps = 60/204 (29%)

Query: 53  LVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGV---------------V 97
           + +L+   H +  S    I+MYDY+    +   +H++   S G                V
Sbjct: 169 MTILQDTMHFMTGSVRNRITMYDYNRHKPI--WQHQWTKQSCGKSSQKAIVSCFDEYNEV 226

Query: 98  HNGKIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSW-DGSLRIVDS 156
           H+   + G+ + E+L +D  S K   +SE   L               SW +G  +++ S
Sbjct: 227 HDNVRFAGTYKTEVLRIDTRSTKSELISERDSL--------------DSWSNGIYQVIKS 272

Query: 157 RNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVS------RKAGLKF 210
            N         GH +          CI   A E+ + D R L + ++      +    KF
Sbjct: 273 DN---------GHYL---------YCIKRNAREIDVIDTRMLKSRINILELPFKIGKQKF 314

Query: 211 QARDIKIMPSYEGYVQSSLDGRVA 234
           +A     + S +G +  S DG+VA
Sbjct: 315 KAS----LNSAKGLLIGSYDGQVA 334

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 28/165 (16%)

Query: 139 DASVIAGSWDGSLRI--VDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLR 196
           D  +  G  DG+  I  V++ ++     ++LG ++ S D  +  +CI   +GE+++ D+R
Sbjct: 275 DCHISIGKDDGNTEIWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVR 334

Query: 197 -------KLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRC 249
                        S   G+KF+   +++            D  V +    Q+E  +  R 
Sbjct: 335 VKDHIVSTWEKHTSEVCGIKFRQDGLQL-------ASGGNDNTVMIWDTRQDEPLWVKRN 387

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLF-TGGS--DGRIYAWNLST 291
           H  +         V  I + P    L  TGG   D  I+ WN +T
Sbjct: 388 HNAA---------VKAITWHPDVVNLLATGGGSLDRHIHFWNTTT 423

>CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021
           Saccharomyces cerevisiae YDR030c RAD28, hypothetical
           start
          Length = 522

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 38/107 (35%), Gaps = 28/107 (26%)

Query: 181 LCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQ 240
           L      G  K++DLR +G P    A ++     + +  S  G   +S            
Sbjct: 300 LATGDAGGNCKLWDLRMVGKPWGNMASMRPGNPGVTVANSGLGSASNS------------ 347

Query: 241 EEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAW 287
                  + H  S          N + + P  S L T G+DGRIY W
Sbjct: 348 -------KAHLRS---------CNALTWSPGGSELVTMGTDGRIYCW 378

>CAGL0E01485g complement(138830..142840) similar to tr|Q08281
           Saccharomyces cerevisiae YOL138c, start by similarity
          Length = 1336

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 25/133 (18%)

Query: 188 GEVKIFDLRKLGAPVSRKAGLKFQA-----RDIKIMPSYE-GYVQSSLDGRVAVEYFDQE 241
           G VK++D+R        ++ L  +      RD+K MPS+    + SS DG+      +  
Sbjct: 307 GCVKVWDIRSDSMKRQGRSDLNIKTANDSIRDVKWMPSHNFASLPSSADGKS----LNIS 362

Query: 242 EKKFAF-RCHRMSL-------QDAQFVFPVNT-----IC--FKPHSSTLFTGGSDGRIYA 286
              + F   H   +       Q  Q    +N      +C  + PH   + TGG DG+   
Sbjct: 363 SPGYTFASIHDTGVLLKYDLRQTTQVDKKINAHSGPGLCLNWHPHQDYIATGGRDGKCSL 422

Query: 287 WNLSTRKKSDELP 299
           W +  R+ +D+ P
Sbjct: 423 WYVGDRRSTDQSP 435

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 60/299 (20%), Positives = 115/299 (38%), Gaps = 43/299 (14%)

Query: 62  IVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLESEKF 121
           ++ T+ +G + +++  +   + +    + L S  +     + VG+ QGE+   DL S   
Sbjct: 397 LLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTL 456

Query: 122 GTVSESAELGISSICI--QDASVIAGSWDGSLRIVD-------------------SRNND 160
            + +E+    I S+ +      ++ GS D S +  D                      +D
Sbjct: 457 LSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHD 516

Query: 161 TQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPS 220
           T  E       + +   +  L +SL    VK+F    L   +S   G K     I     
Sbjct: 517 TTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSL-YGHKLPVLSIDFSVD 575

Query: 221 YEGYVQSSLDGRVAVEYFDQEEKKFAFRCHR--MSLQDAQFVFPVNTICFKPHSSTLFTG 278
            +  + SS D  + +   D  +      CH+   + QD+     + ++ F+  +   F+ 
Sbjct: 576 SKMLITSSADKNIKIWGVDFGD------CHKSIFAHQDS-----IMSVRFEADTHNFFSC 624

Query: 279 GSDGRIYAWNLSTRKKSDELPKLDSSVVKVAC-----NDRVVVAATSDDSFKTSATVED 332
           G DG +  W+     K D + KL+    +V C     + R VV+ + D S +     +D
Sbjct: 625 GKDGAVKRWD---GDKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVWQETDD 680

>ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407)
           [4086 bp, 1361 aa]
          Length = 1361

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 69/174 (39%), Gaps = 26/174 (14%)

Query: 188 GEVKIFDLRKLGAPVSRKAGLKFQA-----RDIKIMPSYEGYVQSSLDGRVAVEYFDQEE 242
           G +K++DLR     V+R + L F +     RD+K MP+Y+ +     D  +         
Sbjct: 254 GCIKVWDLRSHSYKVNR-SDLNFNSGSDSVRDVKWMPTYD-FASLGADTSLCSS---GRS 308

Query: 243 KKFAFRCHRMSL-------QDAQFVFPVNT-----IC--FKPHSSTLFTGGSDGRIYAWN 288
            KFA   H   L       Q  Q    +N      +C  + PH   + +GG DG+   W 
Sbjct: 309 NKFA-SVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMHWHPHMDYIISGGRDGKCALWY 367

Query: 289 LSTRKKSD-ELPKLDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQPSDIY 341
           +  +  S   +P+  +S    + N   +     +    TS  V  L  +P  ++
Sbjct: 368 VGDKVNSMVSVPQGHNSATSYSINTAPITTGYLETVINTSHPVSKLKFRPKYVH 421

>Scas_721.29
          Length = 414

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 67/168 (39%), Gaps = 36/168 (21%)

Query: 178 ENKLCISLTAGEVKIFDLRK-------LGAPVSRKAGLKFQARDIKIMPSYEGYVQSS-- 228
           E  L    ++G+++++DL+K       +  P+           D+   PS++  + +S  
Sbjct: 205 EGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNWHPSHDSILAASGE 264

Query: 229 ------LDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDG 282
                  D R+  E     EK      H   +   +F    N+ C     S L +G S+G
Sbjct: 265 SNIIGLFDNRLGTEILRSNEK-----MHNGGINSCKF----NSHC----DSLLISGDSEG 311

Query: 283 RIYAWNLSTRKKSDELPKL---DSSVVKVACN---DRVVVAATSDDSF 324
           RI  W+L  RK   E  K     SS+  +  N   + +V +A  DD  
Sbjct: 312 RINLWDL--RKLDGEPIKTLHHGSSISTLEWNPNLETIVASAGQDDGL 357

>Kwal_27.12586
          Length = 509

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 4/109 (3%)

Query: 130 LGISS-ICIQDASVIAGSWDGSLRIVDSRNNDTQFETAL-GHKVL--SMDCHENKLCISL 185
           LGI+S   I D  VIA S DGS+R+     N  Q  + + G  +   S+   + K  I  
Sbjct: 378 LGITSAFWIDDDKVIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGK 437

Query: 186 TAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVA 234
             GEV ++++ KL A +   A +      I I   Y+  ++ +    +A
Sbjct: 438 MDGEVTVYNIEKLLATLKSIADVGNSPISIPIYGDYQSNIEGNYVNNIA 486

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 46/105 (43%)

Query: 90  PLLSTGVVHNGKIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSWDG 149
           P++     ++  +  G+  G +   DL S +     E     ++S+     +++ GS D 
Sbjct: 568 PIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDN 627

Query: 150 SLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFD 194
           S+RI D R        +  H V  +    NK+ ++   G VK+++
Sbjct: 628 SIRIWDLRTGTLADTFSYEHPVTCLQFDLNKIVVANQEGTVKVYN 672

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 75/176 (42%), Gaps = 39/176 (22%)

Query: 61  HIVCTSWDGSISMYDYDSMNRLTSLRHKFPL----LSTGVVHNGKIYVGSVQGEMLEVDL 116
            ++  S DG+++++D      +TS  +K P     + T +V++ K +           + 
Sbjct: 184 QLLSASDDGTVALWD------VTSTANKSPSQTFDVHTDIVNDCKWH-----------EF 226

Query: 117 ESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDC 176
           +S  FGTVSE      +++ I D +        S R +   +  + F T    K      
Sbjct: 227 QSSLFGTVSED-----NTLIIHDTN--------SDRAIQKLSVSSAFNTLAFSK-----R 268

Query: 177 HENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGR 232
            EN L  + T   V ++DLR+L  P+   AG +     ++  P  +G + SS   R
Sbjct: 269 SENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDR 324

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 28/173 (16%)

Query: 14  QHLNNRSI--SKRGRTIQARARRATMPFHKLQDV--TKDYISDLVLLESYSHIVCTSWDG 69
           QH ++ ++  S R +   +R R+    F + +DV  +  +  D  LL +          G
Sbjct: 50  QHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAGDAT------G 103

Query: 70  SISMYD-YDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLESEKFGTVSESA 128
            +S+YD Y+  N L S++      ST   H  K +    Q  +   D    +   +S + 
Sbjct: 104 LVSVYDSYNPRNLLVSIK-----ASTHPAHVTKFHPLDKQTLVTATDDRVVRVWDISHAY 158

Query: 129 E-----LGIS----SICIQDAS---VIAGSWDGSLRIVDSRNNDTQFETALGH 169
           E     LG S    S+C    +   V++G +DG +R+ D+R    Q  T L H
Sbjct: 159 EPTLELLGASDYVRSVCFVPGAPHMVVSGCYDGVVRLHDTRTRSAQPVTQLNH 211

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 70/162 (43%), Gaps = 18/162 (11%)

Query: 177 HENKLCISLTAGEVKIFDLRKLGA-PVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAV 235
           ++ KL  +     ++++D++   + PV+   G +     +      +  V SS DG + V
Sbjct: 42  NDKKLLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKV 101

Query: 236 EYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKS 295
             +D               ++ +   PVN +   P+   L +   DG I  W+L   + +
Sbjct: 102 --WDIRSPSVP--------RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCT 151

Query: 296 DEL-PKLDSSV--VKVACNDRVVVAATSDDSFKTSATVEDLP 334
            +L P+ D  +  + VA +  ++VAA +    K +  V ++P
Sbjct: 152 HQLTPEDDVPLQSLSVASDGSMLVAANN----KGNCYVWEMP 189

>ABR189W [782] [Homologous to ScYPL100W - SH]
           complement(764140..765369) [1230 bp, 409 aa]
          Length = 409

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (53%), Gaps = 8/84 (9%)

Query: 151 LRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLR--KLGAPVSRKAGL 208
           LRIV+++   T  E    H+V+ +  +  ++C+ L++ ++ I+D+   KL   +S     
Sbjct: 88  LRIVNTKRKTTICELTFPHEVVDIVMNRKRMCVLLSSDQIFIYDISCMKLLQTIS----- 142

Query: 209 KFQARDIKIMPSYEGYVQSSLDGR 232
                 +K+  S +G+V +S+ GR
Sbjct: 143 -VLEDKLKMAVSDQGHVSTSVVGR 165

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 77/206 (37%), Gaps = 53/206 (25%)

Query: 134 SICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGH--KVLSMDCH---ENKLCISLTAG 188
           S+   D  V  GSW G L++++S+      +    H  K+ ++D H    N++      G
Sbjct: 182 SLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDG 241

Query: 189 EVKIFD-------LRKLGAPVSRKAGLKFQARDIKIMPS--YEGYVQSSLDGRV------ 233
            +K F        LR LG  V    G + +  D+K  PS  + G     +  R+      
Sbjct: 242 LIKNFQYSNEEGGLRLLGDLV----GHERRISDVKYHPSGKFIGSASHDMTWRLWDASTH 297

Query: 234 ----AVEYFDQEEKKFAFRCHR-----------------------MSLQDAQFVFPVNTI 266
                 E  D+     +F+C                         M+L  A    P+ T+
Sbjct: 298 QELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTL--AGHSKPIYTV 355

Query: 267 CFKPHSSTLFTGGSDGRIYAWNLSTR 292
            + P+   + TGG DG I  W++  R
Sbjct: 356 AWSPNGYQVATGGGDGIINVWDIRKR 381

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + ++CF P    L TG  D  I  W+L+T+K
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKK 385

>Scas_630.6
          Length = 621

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + +ICF P    L TG  D  I  WN+  RK
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERK 374

>Scas_705.3
          Length = 924

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 44  DVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIY 103
           DV K+  S  +  +S S  + T+ +G    YD+ +       R   P+    VVH GK+ 
Sbjct: 52  DVEKEITS--IQCDSQSSFLMTTHNGDAYRYDFKTTKDQLLARFSLPVRDCTVVHGGKMG 109

Query: 104 V-GSVQGEMLEVDLESEKFGTVSESAELGISSI 135
           V G    E+  ++LE++ F   S + +  IS +
Sbjct: 110 VFGGDDLELTLIELETDNFKKHSITVDEQISQL 142

>Kwal_23.6429
          Length = 750

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + ++CF P    L TG  D  I  W+L+TR+
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRR 503

>Scas_660.7*
          Length = 603

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 96/238 (40%), Gaps = 29/238 (12%)

Query: 62  IVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGE---ML--EVDL 116
           ++  S+DG I   D+ +   +   +H   ++S  V       + SV  +   M+  E+  
Sbjct: 340 LITGSYDGKI--MDWSNKPEVAHTKHNNLIVSIDVQTGKADQISSVSWDDTLMINDEIKY 397

Query: 117 ESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDC 176
           + E    V+   E GI+++ +  A V        L I+DS   +T     L     ++  
Sbjct: 398 QFEHQPKVATHNEDGITAV-VTTADV--------LLILDSFTGETLQRLQLSEPASAVGL 448

Query: 177 HENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVE 236
            +  + +   +  +K+FD   L      K+GL+     I I PS +      + G++ + 
Sbjct: 449 SKRFVALGFESNAIKVFDTADLSVSHELKSGLRATPSYISISPSEKYLAAGDVMGKILL- 507

Query: 237 YFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKP-----HSSTLFTGGSDGRIYAWNL 289
            FD E K    +  R +    +    +N I ++P         + TG  D  I+ +++
Sbjct: 508 -FDMETK--GIKTSRWAFHTGK----INAISWRPIGEEEDEDLVATGSLDTNIFVYSI 558

>Scas_685.11
          Length = 384

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 19/101 (18%)

Query: 241 EEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSST-LFTGGSDGRIYAWNLSTRKKSDELP 299
           EE +F+   H   ++D +F        +K    T + + GSDGR+  W++   +K DEL 
Sbjct: 261 EEPEFSLLGHSNRVKDFKF--------YKNDFGTYMVSIGSDGRVVVWDM---EKKDELA 309

Query: 300 KLDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQPSDI 340
             D       C +R+   A  D++ +   T++    + +D+
Sbjct: 310 VYD-------CGERLNCLAVVDETVEKYETMKKRDSESADL 343

>Scas_695.15
          Length = 327

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 15/149 (10%)

Query: 177 HENKLCISLTAGEVKIFDLRKLGA-PVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAV 235
           ++ KL  +     V+++D+R      V+   G K     +      +  V SS DG + V
Sbjct: 62  NDKKLLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKV 121

Query: 236 EYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKS 295
             +D               ++ +   PVN +   P+   L +   DG I  W+L   + +
Sbjct: 122 --WDVRSPSVP--------RNYKHNAPVNEVVIHPNQGELISCDRDGTIKIWDLGENQCT 171

Query: 296 DEL-PKLDSSVVK---VACNDRVVVAATS 320
            +L P  D++ ++   VA +  ++VAA +
Sbjct: 172 HQLIPDDDNTSLQSLSVASDGSMLVAANN 200

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 80/192 (41%), Gaps = 30/192 (15%)

Query: 117 ESEKFGTVSESAELGISSICIQDASV-------IAGSWDGSLRIVDSRNNDTQFETALGH 169
           E +++G    S + G S I +QD +V       ++ SWD +LR+ D ++     +  +GH
Sbjct: 66  EDQQYGVPVRSFK-GHSHI-VQDCTVTHDGKYALSASWDKTLRLWDLQSGKC-IKRFVGH 122

Query: 170 KV----LSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEG-- 223
           K     +S+D    ++  +     VK+++   +G  V    G      +++I PS +   
Sbjct: 123 KSDVMSVSIDPRATQIVSASRDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAPSEKSDD 180

Query: 224 ---YVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTGGS 280
               + + +D  V V        +  F  H            V T+   P  S   + G 
Sbjct: 181 AVTVISAGMDKVVKVWDLQSFTIEADFIGHNNY---------VTTVTPSPDGSIFASAGK 231

Query: 281 DGRIYAWNLSTR 292
           DG+I  WNL+ +
Sbjct: 232 DGQIILWNLNEK 243

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 58  SYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLE 117
           S+++++ TS +  +S       + L + R++ P +      +  +  G+  G +   DL 
Sbjct: 541 SFANVLTTSTNVDLSK------STLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLR 594

Query: 118 SEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDC- 176
           S K     +     I+S+    A ++ GS+D ++RI D R        A    VLS+D  
Sbjct: 595 SGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLF 654

Query: 177 HENKLCISLTAGEVKIFDLRK 197
            EN   +      V+I+D  K
Sbjct: 655 QENAAVVVADEPSVQIYDSEK 675

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + ++CF P    L TG  D  I  W+L T+K
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKK 439

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 235 VEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKP-HSSTLFTGGSDGRIYAWNLSTRK 293
           VE+FD +  K   + H+          PV T+ F    ++ L +GG+ G I+ W+ +   
Sbjct: 86  VEFFDPKALKSVAKIHKHQ-------GPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIG 138

Query: 294 KSDELP 299
            SD  P
Sbjct: 139 SSDYSP 144

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 275 LFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATVEDLP 334
           L T GSDG+I  W++ST+++          V    C +R+      D+S +   T++   
Sbjct: 371 LVTIGSDGKIVVWDMSTKEQ----------VAVYDCGERLNCLTLCDESIEKYNTMKKRD 420

Query: 335 LQPSDI 340
            + +DI
Sbjct: 421 AETADI 426

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 57/138 (41%), Gaps = 12/138 (8%)

Query: 190 VKIFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRC 249
           +KI++L      V+ KA      RD+ I   +      S D    V+ +D E K  A R 
Sbjct: 140 IKIWNLASGKLKVTLKAH-DMTVRDLAISNRHPYMFSVSEDK--TVKCWDLE-KNTAIRN 195

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVA 309
           +   L        V+T+   P    + T G D  +  W++ TR     LP     + KV 
Sbjct: 196 YHGHLSG------VHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVR 249

Query: 310 C--NDRVVVAATSDDSFK 325
           C   D  V++++ D S +
Sbjct: 250 CLPVDPQVISSSVDASIR 267

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLD--SSVVKVACNDRV--VVAA 318
           +  IC+ P SS L T G D  +  WN ST +K   L + D   S+VK    D      A 
Sbjct: 140 IQDICWAPDSSILVTVGLDRSVIVWNGSTFEK---LKRFDVHQSLVKGVVFDPANKYFAT 196

Query: 319 TSDD 322
           TSDD
Sbjct: 197 TSDD 200

>CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06822
           Saccharomyces cerevisiae YPR085c, hypothetical start
          Length = 475

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 9/44 (20%)

Query: 272 SSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVV 315
           S  LF+G  DG +  WNL TR+     P   S +    CN++VV
Sbjct: 32  SPVLFSGDIDGEVTIWNLITRR-----PIFTSKI----CNEQVV 66

>Kwal_56.22345
          Length = 396

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 262 PVNTICFKPHSSTLF-TGGSDGRIYAWNLSTRKKSDEL 298
           P NTI F  HSS LF   G+D  +Y ++  +RK ++ L
Sbjct: 248 PFNTIAFSKHSSNLFAAAGTDAMVYLFD--SRKPTEAL 283

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 117 ESEKFGTVSESAELGISSICIQD-------ASVIAGSWDGSLRIVDSRNNDTQFETALGH 169
           + +KFG   +S + G S I +QD       A  ++GSWD +LR+ D    +T F+T +GH
Sbjct: 50  DDQKFGVPVKSFK-GHSHI-VQDCTLTENGAYALSGSWDKTLRLWDVATGET-FQTFVGH 106

Query: 170 K 170
           K
Sbjct: 107 K 107

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + ++CF P    L TG  D  I  W+++ RK
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQRK 406

>Kwal_47.17465
          Length = 800

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRKK 294
           +  IC+ P SS L T G D  +  WN ST +K
Sbjct: 82  IQDICWAPDSSILVTVGLDRSVIVWNGSTFEK 113

>Kwal_56.24478
          Length = 1296

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 220 SYEGYV-QSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICF--KPHSSTLF 276
           SY+  V   +LD  V VE+F   E K   +        AQ   PV T+ F  K H+  L 
Sbjct: 71  SYDNSVLTGALDNGV-VEFFSPSEYKSIAKL-------AQHSTPVKTVRFNAKQHN-VLC 121

Query: 277 TGGSDGRIYAWN 288
           +GGS G IY W+
Sbjct: 122 SGGSKGEIYIWD 133

>Scas_721.7
          Length = 325

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 71  ISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEV--DLESEKFGTVSESA 128
           I+   +  ++RL  + H  P++S     +G +   S   E +++          T+S  +
Sbjct: 83  ITHLTHGCLHRL--MGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHS 140

Query: 129 ELGIS-SICI-QDASVIA-GSWDGSLRIVDSRN 158
           E  +S SIC  +D+SV+A GS+DG +R+ D+R 
Sbjct: 141 ESVVSLSICPDRDSSVLASGSFDGLIRLFDTRT 173

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/105 (20%), Positives = 48/105 (45%)

Query: 90  PLLSTGVVHNGKIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSWDG 149
           P++ +    +  +  G+  G +   D+ + +   V E     I+S+     ++I+GS DG
Sbjct: 565 PIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDG 624

Query: 150 SLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFD 194
           ++R+ D R+N+     +    + S+D     + ++       I+D
Sbjct: 625 TIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYD 669

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 48/119 (40%), Gaps = 13/119 (10%)

Query: 192 IFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKF--AFRC 249
           +++  K   P+SR  G +     +   P  +  V +S D   +++ +D +E  F   FR 
Sbjct: 387 LWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDN--SIKLWDGKEGTFLSTFRG 444

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKV 308
           H         V  V  + +      L +   D  +  W++ TRK S +LP     V  V
Sbjct: 445 H---------VASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

>Kwal_55.21559
          Length = 351

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 254 LQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLD 302
           L D+     V ++ F+PHSS L  G  D  I  W     K+ D  P+ D
Sbjct: 71  LDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG----KEEDADPQDD 115

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLST 291
           V+T+ F P+   +FTG SD     W++ST
Sbjct: 620 VDTVSFHPNGCYVFTGSSDKTCRMWDVST 648

>Scas_629.12
          Length = 671

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + ++CF P    L TG  D  I  W++  RK
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERK 420

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 22/121 (18%)

Query: 52  DLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHN------GKIYVG 105
           D + +   SH V  S +G+IS++         SL  K PL +    H        K   G
Sbjct: 397 DCISMVDDSHFVTGSDNGNISLW---------SLSKKKPLFTVRTAHGVVPLVEDKKISG 447

Query: 106 SVQGEMLEVDLESEKFGTVSESAELGISSICIQDAS--VIAGSWDGSLRIVDSRNNDTQF 163
            V  E+    L+    G++++     I+S+     S   I+GSW+G+L++     N   F
Sbjct: 448 EVSDELRNAQLQG---GSIAQP--FWITSLYAVPYSDIFISGSWNGTLKVWKINENLRAF 502

Query: 164 E 164
           E
Sbjct: 503 E 503

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 263 VNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
           + ++CF P    L TG  D  I  W++  RK
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRK 476

>Scas_646.14
          Length = 755

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 22/121 (18%)

Query: 240 QEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFTG-GSDGRIY-----AWNLSTRK 293
           + EK +   C +++L+D Q    +NT    P    L  G  S  +++        L   K
Sbjct: 387 ESEKNYRLVC-KLTLKDEQ---NINTCALSPDGQVLIVGRPSTTKLFHLQPMGTKLKVTK 442

Query: 294 KSDE-LPKLDSSVVKVACNDRVVVAATSDDSF-----------KTSATVEDLPLQPSDIY 341
             +E L K  +  VK   N R+V++++SDD +                +EDLP   S I 
Sbjct: 443 LDNEFLLKTGTKFVKFIDNSRIVMSSSSDDIYTLDLEGEDDEAPKEYELEDLPSTKSSIK 502

Query: 342 I 342
           I
Sbjct: 503 I 503

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 262 PVNTICFKPHSSTLF-TGGSDGRIYAWNL 289
           P NT+ F P SS LF   G+D  +Y +++
Sbjct: 271 PYNTLAFSPFSSNLFAAAGTDNLVYLYDI 299

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 74/159 (46%), Gaps = 20/159 (12%)

Query: 143 IAGSWDGSLRIVD--SRNNDTQFETALGHK--VLS--MDCHENKLCISLTAGEVKIFDLR 196
           ++ SWD +LR+ +  + N++ +F   +GH   VLS  +D + +K+  +     +++++  
Sbjct: 82  VSASWDKTLRLWNLATGNSEARF---VGHTGDVLSVAIDANSSKIISASRDKTIRVWN-- 136

Query: 197 KLGAPVSRKAGLKFQARDIKIMPSY--EGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSL 254
            +G       G       +++ P    +G V    DGR+       ++   ++  +  S 
Sbjct: 137 TVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVD---DGRITFVSAGMDKIVRSWSLNEDSY 193

Query: 255 Q-DAQFVFP---VNTICFKPHSSTLFTGGSDGRIYAWNL 289
           + +A F+     +N +   P  S   + G DG+IY WNL
Sbjct: 194 RIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNL 232

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 3/28 (10%)

Query: 274 TLFTGGSDGRIYAWNLSTRKKSDELPKL 301
           TL TGG DG I  W+L   +KSD+L K+
Sbjct: 396 TLATGGGDGVITIWDL---RKSDKLTKI 420

>Scas_544.4
          Length = 524

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 60  SHIVCTSWDGSISMYDYDSMNR--LTSLRHKF--PL----LSTGVVHNGKIYVGSVQGEM 111
           S I+ TS+DGSI   D ++++   + +L++++  PL          +   + + ++ GE 
Sbjct: 259 SKILLTSYDGSIRSVDLNNLDSADILTLKNEYDDPLGISDCQFSYDNPNLLLLTTLSGEF 318

Query: 112 LEVDLESEKFGT-VSESAELGISSICIQDA---SVIAGSWDGSLRIVDSRN-----NDTQ 162
            ++DL  +     +   A+  I S+CI       +  GS D +L+I D R      + +Q
Sbjct: 319 TKLDLRMKNIEVDLKRLADKKIGSMCINPQRPYEIATGSLDRTLKIWDIRKIIEKPDWSQ 378

Query: 163 FETALGHKVLSMDCHENKLCIS 184
           +E    H+++S   ++++L +S
Sbjct: 379 YEDFPSHEIVS--TYDSRLSVS 398

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 97/227 (42%), Gaps = 32/227 (14%)

Query: 100 GKIYVGSVQGEMLEVDLESEKFGTVSE-SAELG-ISSICIQDASVIAGSWDGSLRIVDSR 157
           G +   +V+ + +E +LE  +   V   +  +G I       + ++  S+DGS+R VD  
Sbjct: 217 GNVGFWNVRDDPIEDELEEPEITRVKLFNKNVGRIDCFPTDTSKILLTSYDGSIRSVDLN 276

Query: 158 NNDT--------QFETALGHKVLSMDC-----HENKLCISLTAGEVKIFDLR--KLGAPV 202
           N D+        +++  LG      DC     + N L ++  +GE    DLR   +   +
Sbjct: 277 NLDSADILTLKNEYDDPLGIS----DCQFSYDNPNLLLLTTLSGEFTKLDLRMKNIEVDL 332

Query: 203 SRKAGLKFQARDIKIMPSYE---GYVQSSL---DGRVAVEYFDQEEKKFAFRCHRM-SLQ 255
            R A  K  +  I     YE   G +  +L   D R  +E  D  + +  F  H + S  
Sbjct: 333 KRLADKKIGSMCINPQRPYEIATGSLDRTLKIWDIRKIIEKPDWSQYE-DFPSHEIVSTY 391

Query: 256 DAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDEL-PKL 301
           D++    V+ + + P   TL   G D  I  +++   K  ++L PKL
Sbjct: 392 DSR--LSVSGVSYSPTDGTLVCNGYDDTIRLFDVKEPKLPEDLQPKL 436

>Scas_711.11
          Length = 695

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%)

Query: 115 DLESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVDSRNNDTQFETALGHKVLSM 174
           DL + K     E     I+ +   + +++ GS D ++RI D R+            VLS+
Sbjct: 565 DLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLTFEKPVLSV 624

Query: 175 DCHENKLCISLTAGEVKIFD 194
           D  +NK+ I+      K++D
Sbjct: 625 DFDKNKIAIATHDEACKVYD 644

>YLR450W (HMG2) [3824] chr12 (1032623..1035760)
           3-Hydroxy-3-methylglutaryl-coenzyme A reductase 2, rate
           limiting enzyme for sterol biosynthesis, converts
           HMG-CoA to mevalonate [3138 bp, 1045 aa]
          Length = 1045

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 21  ISKRGRTIQARARRATMPFHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMN 80
           I  RG+++ A A   T+P   ++ V K  +S LV L    ++V ++  GS+  ++  + N
Sbjct: 852 IEGRGKSVVAEA---TIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAAN 908

Query: 81  RLTSL 85
            +T+L
Sbjct: 909 LVTAL 913

>Scas_720.95
          Length = 515

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 45/110 (40%), Gaps = 13/110 (11%)

Query: 192 IFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKF--AFRC 249
           +++  K   P++R  G +     +   P     V +S D   +++ +D  + KF   FR 
Sbjct: 385 LWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRDGKFISTFRG 442

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELP 299
           H         V  V  + +      L +   D  +  W++ TRK S +LP
Sbjct: 443 H---------VASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLP 483

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 36  TMPFHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTG 95
           T+  H+ + V  +Y+ D   L+   +++ TS DG+I ++DY + + + +L      +S  
Sbjct: 178 TLKAHETKGV--NYV-DYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYA 234

Query: 96  VVH 98
           V H
Sbjct: 235 VFH 237

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 47/119 (39%), Gaps = 13/119 (10%)

Query: 192 IFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKF--AFRC 249
           +++  K   P++R  G +     +   P     V +S D   +++ +D  + KF   FR 
Sbjct: 385 LWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRDGKFLSTFRG 442

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKV 308
           H         V  V  + +      L +   D  +  W++ TRK S +LP     V  V
Sbjct: 443 H---------VASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 492

>Kwal_55.20583
          Length = 1903

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 107 VQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVDS 156
           V+ E LE DLE  +   + +  EL I  + ++  +V A  W   L ++ S
Sbjct: 497 VKDEKLEADLEGLRLVLIGDIYELPILDMNVKPFTVSANDWSSKLEVIAS 546

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 209 KFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKF---AFRCHRMSLQDAQFVFPVNT 265
           ++ A  I++ P +  +   S+D  + V     + K+    AFR H+ +  ++ F      
Sbjct: 348 QYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMF------ 401

Query: 266 ICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
               P    +  G + GR++ W+  T K
Sbjct: 402 -DIAPDGRYVAAGDTSGRLFIWDWKTTK 428

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 68  DGSISMYDYDSMNRLTSLR-HKFPLLSTGVVHNGKIYVGS 106
           D ++ ++  DSM    SL  HK P+LS  + H+ K+ + S
Sbjct: 546 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITS 585

>Sklu_2071.4 YPL100W, Contig c2071 4876-6096
          Length = 406

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/45 (22%), Positives = 28/45 (62%)

Query: 151 LRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDL 195
           L++V+++   T  E    H+++ +  +  ++CI L++ ++ I+D+
Sbjct: 88  LKVVNTKRKSTICELTFPHEIVDVVMNRKRMCILLSSDQIFIYDI 132

>Scas_700.4
          Length = 435

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 58/134 (43%), Gaps = 11/134 (8%)

Query: 63  VCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDLESEKFG 122
           V T+   S+++Y+ D   +   L  +          N      S+ G  L+  + +E+  
Sbjct: 14  VVTTAPHSLTIYNCDPFGKCFELDTR--------TRNNTGSNDSLDGTALDASVANEEDN 65

Query: 123 TVSESAELGISSICIQDASVIAGSWDGS-LRIVDSRNNDTQFETALGHKVLSMDCHENKL 181
            +        S + I D +   G   G  L+IV+++   T  E    H+++ +  +  ++
Sbjct: 66  GIIVQMLFSTSLVAIADRN--QGVKKGKKLKIVNTKRKSTICEIVFPHEIVDVVMNRKRM 123

Query: 182 CISLTAGEVKIFDL 195
           CI L + ++ I+D+
Sbjct: 124 CILLESDQIFIYDI 137

>Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement
          Length = 478

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 12/153 (7%)

Query: 143 IAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPV 202
             GS D  ++I D+   +      LG++V  +D   + + ++      ++ DL+ + + +
Sbjct: 219 FTGSSDREVKIWDTNEFEVVQNFQLGYRVNQLDTKGDLVIVASEDTYPRVIDLKSMSSVI 278

Query: 203 S---RKAGLKFQARDIKIMPSYEGYVQSS-LDGRVAVEYFDQEEKKFAFRCHRMSLQDA- 257
           S   +   +KF     K  P     V S   DG V +     + +K     + ++ QD  
Sbjct: 279 SLGVKNKKMKFGINTAKFAPMGTDLVASGDDDGNVRI----WDLRKSNSMLYDLTEQDTL 334

Query: 258 --QFVFPVNTICFKPH-SSTLFTGGSDGRIYAW 287
                   N +C+ P     L T G+DG+   W
Sbjct: 335 SKPHAKCCNDLCWNPRLEDELVTTGNDGKCKLW 367

>YPR135W (CTF4) [5554] chr16 (799228..802011) Protein required for
           DNA synthesis, binds DNA polymerase alpha [2784 bp, 927
           aa]
          Length = 927

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 58  SYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYV 104
           S SH + T+  G    Y+ DS       R   PL    V+H+GK+ V
Sbjct: 64  SNSHFLMTTMQGDALRYNIDSSQEELLARFALPLRDCCVIHSGKMAV 110

>Kwal_23.3869
          Length = 414

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 275 LFTGGSDGRIYAWNLSTRK 293
           L +G S G IY WNL TR+
Sbjct: 32  LISGDSQGHIYLWNLITRR 50

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%)

Query: 275 LFTGGSDGRIYAWNLSTRKKSDELPKL--DSSVVKVACNDRVV 315
           +  GG DG I  WN  ++  +  L     DS V+ V+C + +V
Sbjct: 256 VVVGGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAVSCKETLV 298

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 45/110 (40%), Gaps = 13/110 (11%)

Query: 192 IFDLRKLGAPVSRKAGLKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKF--AFRC 249
           +++  K   P++R  G +     +   P     V +S D   +++ +D  + KF   FR 
Sbjct: 385 LWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRDGKFISTFRG 442

Query: 250 HRMSLQDAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRKKSDELP 299
           H         V  V  + +      L +   D  +  W++ TRK S +LP
Sbjct: 443 H---------VASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLP 483

>CAGL0J01265g complement(118375..119928) highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w, start by similarity
          Length = 517

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 22/134 (16%)

Query: 132 ISSICIQDAS---VIAGSWDGSLRIVDSRNNDTQFETALGHKVLSMDCHENKLCISLT-- 186
           + ++C   A+   V+ GS+DG+LR+ D+R       T +  + +     EN + IS T  
Sbjct: 171 VRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLVHDQPV-----ENVVAISPTQL 225

Query: 187 ----AGEVKIFDLRKLGAPVSRKAGLK-FQARDIKIMPSYEG------YVQSSLDGRVAV 235
                   K++DL        R    K     D   +PS  G       + SSLDG V V
Sbjct: 226 VSCGGPNFKVWDLTSNKKIFERANFNKTVTCLDYVNLPSDSGLASNSALLASSLDGHVKV 285

Query: 236 -EYFDQEEKKFAFR 248
            +  D  + KF ++
Sbjct: 286 FDPLDNFQVKFGWK 299

>YJL109C (UTP10) [2806] chr10 complement(211917..217226) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis [5310 bp, 1769
           aa]
          Length = 1769

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 20  SISKRGRTIQARARRATMP--FHKLQDVTKDYISDLVLLESYSHIVC----TSWDGSISM 73
           +I K  +T++ +     +P    KL D   D +S L  L+     VC    TS+  SI+ 
Sbjct: 298 TICKLFQTLKGQGNVDQLPSKIFKLFDSKFDTVSILTFLDKEDKPVCDKFITSYTRSIAR 357

Query: 74  YDYDSMNRLTSLRHKFPL 91
           YD   +N + SL  K  L
Sbjct: 358 YDRSKLNIILSLLKKIRL 375

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 67/158 (42%), Gaps = 31/158 (19%)

Query: 142 VIAGSWDGSLRIVDSRN-NDTQFETALGHKVLSMDCHENK-LCISLTAGE-VKIFDLRKL 198
           VI+ S D ++RI + +N  +    T   H V+    H+ + L +S +  E V+++D+  L
Sbjct: 110 VISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGL 169

Query: 199 GAPVSRKAGLKFQARDIKIMPSYEGYV---QSSLDGRVAVEYFDQEEKKFAFRCHRMSLQ 255
                RK   K  A  +    SYE  +   Q+ LDG      F   + KF    H     
Sbjct: 170 -----RK---KHSAPGVT---SYEDSLASQQNLLDGA-----FGDCKVKFILEGHTRG-- 211

Query: 256 DAQFVFPVNTICFKPHSSTLFTGGSDGRIYAWNLSTRK 293
                  VN   F P    + TGG D ++  W +S+ K
Sbjct: 212 -------VNWASFHPTLPLIVTGGDDRQVKLWRMSSNK 242

>Kwal_55.21144
          Length = 570

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query: 52  DLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEM 111
           D V +   SH +  S +G+IS++         SL  K PL +    H       S Q   
Sbjct: 400 DCVTMIDDSHFITGSDNGNISLW---------SLSKKKPLYTERTAHGVAPAPTSTQ--- 447

Query: 112 LEVDLESEKFGTVSESAELG----ISSI-CIQDASV-IAGSWDGSLRIVDSRNNDTQFE 164
           +  + + +K     ++ ++     I+++  I  ++V ++GSWDGSLRI     N  +F+
Sbjct: 448 ISAEADEQKRNLQLQNQKIAQPYWITALHAIPYSNVFVSGSWDGSLRIWKLTENLREFQ 506

>Kwal_55.21133
          Length = 906

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 58  SYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVHNGKIYVGSVQGEMLEVDL 116
           S S  +  S  G + ++D    N    LR   P+    +VHNGK    +V G+ LE+ L
Sbjct: 74  SNSKCIIASLKGDVHLHDSRDSNSRLLLRCALPVRDAVLVHNGKTV--AVGGDDLELSL 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,763,250
Number of extensions: 438808
Number of successful extensions: 1944
Number of sequences better than 10.0: 126
Number of HSP's gapped: 1889
Number of HSP's successfully gapped: 129
Length of query: 345
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 243
Effective length of database: 13,065,073
Effective search space: 3174812739
Effective search space used: 3174812739
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)