Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1926.434533516860.0
Kwal_27.1259033834113740.0
Scas_667.2033834413270.0
YPR056W (TFB4)33834413030.0
ADL323C34133712641e-176
KLLA0B08569g33735111761e-162
CAGL0D01650g33532311531e-159
Scas_721.48d29655663.0
CAGL0M13827g184040645.5
YER014W (HEM14)53959637.5
Scas_588.9*20628617.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1926.4
         (345 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement        654   0.0  
Kwal_27.12590                                                         533   0.0  
Scas_667.20                                                           515   0.0  
YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II t...   506   0.0  
ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH] (127631..12...   491   e-176
KLLA0B08569g complement(756558..757571) similar to sgd|S0006260 ...   457   e-162
CAGL0D01650g complement(172035..173042) highly similar to tr|Q12...   448   e-159
Scas_721.48d                                                           30   3.0  
CAGL0M13827g 1360609..1366131 similar to sp|Q04952 Saccharomyces...    29   5.5  
YER014W (HEM14) [1437] chr5 (182599..184218) Protoporphyrinogen ...    29   7.5  
Scas_588.9*                                                            28   7.8  

>Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement
          Length = 345

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/335 (94%), Positives = 318/335 (94%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF
Sbjct: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60

Query: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSIINNDMYRQ 120
           LNAHLAFNNSNQVAVIAAHSTGLKYLYPK                 RKDLSIINNDMYRQ
Sbjct: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKTATTEGTGASSSSVVSGRKDLSIINNDMYRQ 120

Query: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180
           FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS
Sbjct: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180

Query: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240
           RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV
Sbjct: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240

Query: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300
           YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC
Sbjct: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300

Query: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGM 335
           VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGM
Sbjct: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGM 335

>Kwal_27.12590
          Length = 338

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/341 (75%), Positives = 289/341 (84%), Gaps = 8/341 (2%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           MDAISD +FQNTKSK ++ EE PSLLTV+VDT PK+WAELDKE + +G+LISALQSLIVF
Sbjct: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60

Query: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSIINNDMYRQ 120
           LNAHL+FN++NQVAVIAAHSTG+KYL+P                    DLSIIN++MYRQ
Sbjct: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFP------TPPSSQEEPAAKSPDLSIINSNMYRQ 114

Query: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180
           FRNVDETV+EELYKL Q EK+      +G  +STLSGA+SAG TYINRV KE    +LK+
Sbjct: 115 FRNVDETVLEELYKLLQDEKKRK--IPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKA 172

Query: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240
           RL+V TCGSSGG+DEIFQYIPIMNCIF+ATK+KCPIDVVKIGG QESTFLQQATDATNGV
Sbjct: 173 RLMVMTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGV 232

Query: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300
           YLHV STEGLIQYL TAMFIDPSLR ++VKPNQGSVDFRTSC+LTG+VVAVGFVCSVCLC
Sbjct: 233 YLHVPSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLC 292

Query: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGMVRKKKK 341
           VLSIIPPGNKCPACD+EFDE V TKLKR+PVVPG+  KKKK
Sbjct: 293 VLSIIPPGNKCPACDSEFDEHVTTKLKRRPVVPGIAAKKKK 333

>Scas_667.20
          Length = 338

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 289/344 (84%), Gaps = 10/344 (2%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           MDAI+D TFQ+TK ++SITEE PSLLTV+VD TPKLWAELD+E N KGNLI+ L+SL+VF
Sbjct: 1   MDAIADPTFQHTKVRSSITEETPSLLTVIVDITPKLWAELDEEINEKGNLINVLKSLLVF 60

Query: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSIINNDMYRQ 120
           LNAHLAFN+SNQVAVIAAHS G+KYL+PK                 +KDLSIIN DMYR+
Sbjct: 61  LNAHLAFNSSNQVAVIAAHSQGIKYLFPKNSISVKGVNSG------KKDLSIINKDMYRR 114

Query: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180
           FRNVDET+V+ELY LF++E ++ N+ +    +STLSGA+SAGLTYINRV KE E I+LKS
Sbjct: 115 FRNVDETLVDELYALFEEELKQVNTVTQ---KSTLSGAMSAGLTYINRVTKELEAISLKS 171

Query: 181 RLLVTTCGSSG-GRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNG 239
           RL+V TCG  G  +DEIFQYIPIMNCIF+ATK+KCPIDVVKIGG +ESTFLQQ TDATNG
Sbjct: 172 RLMVLTCGGKGESKDEIFQYIPIMNCIFSATKIKCPIDVVKIGGSKESTFLQQTTDATNG 231

Query: 240 VYLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCL 299
            YLHV+ST+GLIQYL TAMFIDPSLR +IVKPN GSVDFRTSC+LTG+VVAVGF+CSVCL
Sbjct: 232 AYLHVESTKGLIQYLATAMFIDPSLRQIIVKPNHGSVDFRTSCYLTGKVVAVGFICSVCL 291

Query: 300 CVLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGMVRKKKKVS 343
           CVLSIIPPGNKCPACD+EFDE VI KLK+KPVVP + +K  K +
Sbjct: 292 CVLSIIPPGNKCPACDSEFDEHVIAKLKKKPVVPRVAKKGNKTA 335

>YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II
           transcription initiation factor TFIIH (factor b), 37 kDa
           subunit [1017 bp, 338 aa]
          Length = 338

 Score =  506 bits (1303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/344 (69%), Positives = 285/344 (82%), Gaps = 7/344 (2%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           MDAISD TF++ +S+  +TEE+PSLLTV+++  PKLW   D+E N KG++I  L++LIVF
Sbjct: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60

Query: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSIINNDMYRQ 120
           LNAHLAFN++N+VAVIAA+S G+KYLYP+                 R DL IIN+DMYR+
Sbjct: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKT---RSDLKIINSDMYRR 117

Query: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180
           FRNVDET+VEE+YKLF+ EK++    S    RSTL+GA+SAGLTY+NR++KE+   +LKS
Sbjct: 118 FRNVDETLVEEIYKLFELEKKQIEQNSQ---RSTLAGAMSAGLTYVNRISKESVTTSLKS 174

Query: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240
           RLLV TCGS   +DEIFQYIPIMNCIF+ATKMKCPIDVVKIGG +ESTFLQQ TDATNGV
Sbjct: 175 RLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGV 234

Query: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300
           YLHV+STEGLIQYL TAMFIDPSLR +IVKPN GSVDFRTSC+LTGRVVAVGF+CSVCLC
Sbjct: 235 YLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLC 294

Query: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGMVRKKKKVSK 344
           VLSIIPPGNKCPACD++FDE VI KLKRKPVVP + + KKKV+K
Sbjct: 295 VLSIIPPGNKCPACDSQFDEHVIAKLKRKPVVPRL-KAKKKVTK 337

>ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH]
           (127631..128656) [1026 bp, 341 aa]
          Length = 341

 Score =  491 bits (1264), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 234/337 (69%), Positives = 271/337 (80%), Gaps = 5/337 (1%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           MDAI+DSTFQ  KSK  + EE PSLLT+V+DT PKLWAE D+E   KG L+  L+S IVF
Sbjct: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60

Query: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSIINNDMYRQ 120
           LNAHL+FNNSNQV+VIAA S G+KYLYP+                  +D SIIN +MYR 
Sbjct: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKS-----EDRSIINRNMYRG 115

Query: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180
           FRNVDE VVEELY++FQQE ++         RSTLSGA+SAGLTYINR+  E E ++LKS
Sbjct: 116 FRNVDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKS 175

Query: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240
           RLLV TCGSS  +DE+FQYIPIMNCIF+ATKMKCPIDVVK+GGV+ESTFLQQATDATNG 
Sbjct: 176 RLLVITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGN 235

Query: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300
           YLHV +T+GLIQYL TAMFIDPSLR  +VKPNQ SVDFRTSC+LTG+VVA+GFVCSVCLC
Sbjct: 236 YLHVANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLC 295

Query: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGMVR 337
           VLSIIPPGNKCPACD+EFDE+V+ KL RKPV+ G +R
Sbjct: 296 VLSIIPPGNKCPACDSEFDEKVVAKLSRKPVITGTLR 332

>KLLA0B08569g complement(756558..757571) similar to sgd|S0006260
           Saccharomyces cerevisiae YPR056w TFB4 component of RNA
           polymerase transcription initiation TFIIH factor, start
           by similarity
          Length = 337

 Score =  457 bits (1176), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/351 (64%), Positives = 273/351 (77%), Gaps = 24/351 (6%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKG--------NLIS 52
           MDAI+D+ FQ TKSKT   E+ PSLLTVVVDT+   W +L K+ +  G         LI 
Sbjct: 1   MDAIADTVFQGTKSKTQEIEDTPSLLTVVVDTSIHSWVQLTKQQSGSGSEGSSGEKQLIE 60

Query: 53  ALQSLIVFLNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSI 112
           AL+S++VFLNAHLAFN+ NQV +IAAHS G+KYLYP                  +  +S+
Sbjct: 61  ALKSIVVFLNAHLAFNSGNQVCLIAAHSEGMKYLYPSADS--------------KPSMSM 106

Query: 113 INNDMYRQFRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKE 172
           +++DMYR FRNVDE VVE+ Y+LF++E E   S  +   +S+LSGA+S+ LTY+NR+ KE
Sbjct: 107 VSSDMYRGFRNVDEIVVEQWYRLFKEELEGQESKVSM--KSSLSGAMSSALTYVNRILKE 164

Query: 173 NENITLKSRLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQ 232
           NEN +L+SRLLV TCG+S G+DEIFQYIPIMNCIF+ATKMKC IDVVKIGG  ESTFLQQ
Sbjct: 165 NENTSLRSRLLVITCGTSQGKDEIFQYIPIMNCIFSATKMKCSIDVVKIGGGIESTFLQQ 224

Query: 233 ATDATNGVYLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVG 292
           ATDAT+GVYLHV++T GLIQYL TAMFIDPSLR+VI+KPNQGSVDFRTSCFLTG+VVAVG
Sbjct: 225 ATDATSGVYLHVENTRGLIQYLSTAMFIDPSLRNVIIKPNQGSVDFRTSCFLTGKVVAVG 284

Query: 293 FVCSVCLCVLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGMVRKKKKVS 343
           FVCSVCLCVLS+IPPG KCPACD+ FD ++I +L+RKPV+   V KKK VS
Sbjct: 285 FVCSVCLCVLSVIPPGQKCPACDSPFDSKIIARLRRKPVLSNGVPKKKNVS 335

>CAGL0D01650g complement(172035..173042) highly similar to tr|Q12004
           Saccharomyces cerevisiae YPR056w TFB4, start by
           similarity
          Length = 335

 Score =  448 bits (1153), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 263/323 (81%), Gaps = 9/323 (2%)

Query: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           MDAI+D  FQ TK +++ TE+ PSLLTVV+D +P+LWAE D  S  K ++ + L+SLIVF
Sbjct: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60

Query: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKXXXXXXXXXXXXXXXXXRKDLSIINNDMYRQ 120
           LN+HLAFN++NQVAVIAA S G++YLYP+                  KDLSII++ MYR+
Sbjct: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNS------KDLSIISSHMYRR 114

Query: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180
           FRNVDET++EE YKL+Q+E+   +     V +STLSGA++A LTY NR+ KE E+I+L+S
Sbjct: 115 FRNVDETLIEEFYKLYQREE---SLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRS 171

Query: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240
           RLLV TCGSS  +DEIFQYIPIMNCIF+ATK+KCPIDV+KIGG ++STFLQQ TDATNGV
Sbjct: 172 RLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGV 231

Query: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300
           Y+H++ST G+IQYL TAM IDPSLR +IV+P QGSVDFRTSC+LTG+VVA+G++CSVCLC
Sbjct: 232 YIHLESTNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLC 291

Query: 301 VLSIIPPGNKCPACDAEFDERVI 323
           VLSIIPPGNKCPACD++FDERVI
Sbjct: 292 VLSIIPPGNKCPACDSQFDERVI 314

>Scas_721.48d
          Length = 296

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 240 VYLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFV 294
           +YL    +E +  +L    F  PS  HV VKP   ++   TSC +    V + ++
Sbjct: 73  IYLEESQSEQIFNHLKNFSF--PSRNHVQVKPMDSTLSSATSCDIDDPPVKIAYL 125

>CAGL0M13827g 1360609..1366131 similar to sp|Q04952 Saccharomyces
           cerevisiae YMR306w FKS3, hypothetical start
          Length = 1840

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 21  ENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60
           ENPS++ +  D  P L  +++  SN K  +I A+Q  + F
Sbjct: 941 ENPSMVALYGDNVPLLENDIESMSNRKFKMIVAMQRYLNF 980

>YER014W (HEM14) [1437] chr5 (182599..184218) Protoporphyrinogen
           oxidase, converts protoporphyrinogen to protoporphyrin
           during heme biosynthesis [1620 bp, 539 aa]
          Length = 539

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 32  TTPKLWAELDKESNSKGNLISALQS-LIVFLNAHLAFNNSNQVAVIAAHSTGLKYLYPK 89
           T PK+   L K+ NS   L+  +QS  I+ +N +L   +     VI A   G  YL PK
Sbjct: 334 TPPKIAKLLPKDQNSLSKLLDEIQSNTIILVNYYLPNKD-----VIDADLQGFGYLVPK 387

>Scas_588.9*
          Length = 206

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 22/28 (78%)

Query: 114 NNDMYRQFRNVDETVVEELYKLFQQEKE 141
           N  MY++ R+++++++EE  K+F QEK+
Sbjct: 176 NEVMYQEARDLNKSLLEEYMKVFPQEKQ 203

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,578,547
Number of extensions: 432533
Number of successful extensions: 1551
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1568
Number of HSP's successfully gapped: 22
Length of query: 345
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 243
Effective length of database: 13,065,073
Effective search space: 3174812739
Effective search space used: 3174812739
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)