Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1926.230530516200.0
Scas_667.2230630712321e-172
CAGL0D01606g30530712251e-171
Kwal_27.1259930430612191e-170
YPR058W (YMC1)30730912001e-167
KLLA0B08503g30330511501e-160
Scas_718.532432410591e-145
Kwal_33.1298830330410401e-143
YBR104W (YMC2)32932710271e-140
Kwal_56.2301130330410241e-140
Sklu_1275.131130410231e-140
Sklu_2398.430930410171e-139
CAGL0K12210g3113119931e-136
KLLA0F17864g3073039281e-126
ADL264C3292873682e-41
KLLA0C13431g3283143649e-41
Scas_697.473282923561e-39
YOR100C (CRC1)3272923482e-38
Kwal_23.29133203063472e-38
CAGL0B04543g3173203463e-38
Sklu_2127.52782813372e-37
Kwal_33.154463052903359e-37
KLLA0E09680g3072863271e-35
Kwal_55.213353172893272e-35
YOR130C (ORT1)2922893085e-33
Sklu_2075.33452903091e-32
Scas_714.183053093061e-32
AFR146W2812943023e-32
KLLA0E02772g2842902962e-31
Scas_632.92923112893e-30
CAGL0B03883g3062972878e-30
CAGL0K02365g9192842934e-29
CAGL0K10362g3013122782e-28
KLLA0E13453g9063002784e-27
ADL049W9122842722e-26
YPR021C (AGC1)9022842671e-25
Kwal_26.86692962882511e-24
Sklu_2037.23103102502e-24
YOR222W (ODC2)3072912474e-24
ACR109W2992882465e-24
Scas_709.93652912487e-24
AGL311C3623122487e-24
Kwal_47.173218812912537e-24
Scas_602.88852872474e-23
YPL134C (ODC1)3102972404e-23
Sklu_2359.69022872465e-23
Scas_691.43343072406e-23
KLLA0D07073g2972862379e-23
CAGL0J02002g3612952363e-22
Sklu_2334.23192932327e-22
CAGL0J04114g3032962212e-20
YJR095W (SFC1)3222932212e-20
YIL006W3732822223e-20
KLLA0F03212g3052952176e-20
Scas_640.253062992097e-19
Kwal_47.182163333262108e-19
Scas_589.103163012044e-18
Scas_662.123083072011e-17
KLLA0F04697g3072962011e-17
ACR260W3113202011e-17
Kwal_23.47313143082011e-17
YIL134W (FLX1)3113091983e-17
Kwal_55.208683803121985e-17
Scas_716.293163211948e-17
YPR011C3263201959e-17
CAGL0G08910g2892821931e-16
Scas_379.23013181921e-16
Kwal_0.2322742851893e-16
YJL133W (MRS3)3143181878e-16
Sklu_2363.23233251871e-15
AER366W2932941842e-15
CAGL0M09020g3483261862e-15
Kwal_27.120813693031834e-15
YEL006W3352981817e-15
Sklu_2431.53703071801e-14
AGL047C3163031781e-14
YNL003C (PET8)2842741772e-14
CAGL0J01661g3272961754e-14
AAL014C2712771718e-14
Scas_717.203563271721e-13
Scas_721.273742611712e-13
KLLA0E23705g3683061692e-13
CAGL0L05742g3053141682e-13
CAGL0K08250g2972941683e-13
Sklu_2442.82752791664e-13
Kwal_33.140503143081665e-13
KLLA0E15532g3263191657e-13
KLLA0D14036g4313201677e-13
YHR002W (LEU5)3573201613e-12
Kwal_23.43543432931586e-12
CAGL0K02915g3423251587e-12
ADL009W3792851571e-11
Scas_558.22892831551e-11
YGR096W (TPC1)3143051551e-11
Kwal_14.22103152931551e-11
CAGL0G03135g3073031551e-11
Kwal_23.30425422071572e-11
Sklu_2432.52882801542e-11
CAGL0H03839g2822821532e-11
KLLA0D04950g2742791522e-11
YKR052C (MRS4)3043041532e-11
Kwal_26.79672972951532e-11
AER419W4931871543e-11
CAGL0G01166g2952811514e-11
YBL030C (PET9)3181801514e-11
YBR085W (AAC3)3071821506e-11
AEL253W3653091507e-11
CAGL0M05225g3813111491e-10
YBR192W (RIM2)3772661481e-10
YLR348C (DIC1)2982811472e-10
Sklu_1149.22962961462e-10
CAGL0F04213g3062511462e-10
KLLA0C11363g5173381464e-10
Scas_718.243371761444e-10
YNL083W5452101455e-10
YBR291C (CTP1)2993071435e-10
AER184W3051761427e-10
Scas_582.73292911427e-10
KLLA0E18810g3772961428e-10
CAGL0H10538g2971851418e-10
Sklu_2374.75132011429e-10
KLLA0A09383g3662751401e-09
AGL065C3353131373e-09
CAGL0L02079g2973021347e-09
Kwal_26.79723583181357e-09
AGR383W2931921338e-09
Kwal_27.124813041761321e-08
KLLA0D15015g3173071321e-08
Scas_578.3*5242741332e-08
Scas_667.43081811312e-08
Scas_645.93912701303e-08
KLLA0E18788g3813271303e-08
KLLA0E08877g2941861284e-08
Scas_702.103022801284e-08
KLLA0E12353g3051361275e-08
YMR166C3683311276e-08
Kwal_27.114192981871267e-08
YGR257C (MTM1)3662001268e-08
KLLA0D09889g3642861268e-08
CAGL0J09790g3002821241e-07
YDL198C (YHM1)3002841231e-07
Kwal_23.35293952971242e-07
KLLA0B12826g3191831232e-07
Scas_562.123002821213e-07
Sklu_2115.42991831213e-07
Scas_721.1293233121204e-07
Scas_613.241771671165e-07
KLLA0D04290g1881301166e-07
Sklu_2260.53022481186e-07
Kwal_47.192282811581178e-07
Scas_669.63732961189e-07
CAGL0J05522g5193211199e-07
AFR131C3442681171e-06
Scas_489.42972941161e-06
Scas_328.12271361142e-06
YMR056C (AAC1)3091811152e-06
Sklu_2435.23442511152e-06
Sklu_2117.22982851143e-06
Kwal_23.39653072991124e-06
Kwal_26.76533251811124e-06
CAGL0K11616g3202951124e-06
CAGL0F07711g3683371125e-06
Kwal_27.116262992861116e-06
CAGL0F08305g3742681091e-05
Sklu_2433.84201241082e-05
AFR253W3441631062e-05
CAGL0K07436g3071341044e-05
KLLA0F13464g3002861035e-05
AFR542W3101841036e-05
Kwal_33.15597305801027e-05
KLLA0E02750g3042781027e-05
Sklu_2430.103241811029e-05
KLLA0F08547g308133982e-04
Kwal_34.15907312133973e-04
Scas_715.4530566974e-04
Kwal_55.21106328250974e-04
YFR045W285209964e-04
AGL064W296274955e-04
Scas_705.9323243956e-04
YKL120W (OAC1)324182957e-04
Sklu_2194.3312133947e-04
AGR191W298285930.001
AFL196W361284930.001
Scas_673.17314190900.002
YER053C300251900.002
YMR241W (YHM2)314133900.002
Kwal_55.21338323260900.002
KLLA0A00979g343126880.004
ADR036C340244880.004
AAR036W317299880.004
Kwal_23.5757307261880.005
Scas_696.9312154870.005
Scas_687.15*328150870.006
KLLA0B11319g355245870.006
YJR077C (MIR1)311171860.008
KLLA0D04312g10389800.009
Sklu_2127.4323264860.009
AFR147C315257850.011
CAGL0D05500g377154840.015
ABL023W309137820.027
KLLA0B14454g30582810.028
CAGL0F00231g307226810.029
CAGL0C02013g329149810.035
AER450C308197790.048
Sklu_1119.1307190780.071
YDL119C30767710.50
YPR128C (ANT1)328110710.51
KLLA0E22880g436191700.82
AFR373W467165700.92
CAGL0L07392g39562672.0
CAGL0D04774g32268652.7
Scas_693.758356653.6
Sklu_2129.3141947654.1
AEL060C42993635.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1926.2
         (305 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         628   0.0  
Scas_667.22                                                           479   e-172
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   476   e-171
Kwal_27.12599                                                         474   e-170
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   466   e-167
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   447   e-160
Scas_718.5                                                            412   e-145
Kwal_33.12988                                                         405   e-143
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   400   e-140
Kwal_56.23011                                                         399   e-140
Sklu_1275.1 , Contig c1275 314-1249                                   398   e-140
Sklu_2398.4 , Contig c2398 9476-10405                                 396   e-139
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   387   e-136
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   362   e-126
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   146   2e-41
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   144   9e-41
Scas_697.47                                                           141   1e-39
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   138   2e-38
Kwal_23.2913                                                          138   2e-38
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   137   3e-38
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        134   2e-37
Kwal_33.15446                                                         133   9e-37
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   130   1e-35
Kwal_55.21335                                                         130   2e-35
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   123   5e-33
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               123   1e-32
Scas_714.18                                                           122   1e-32
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...   120   3e-32
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   118   2e-31
Scas_632.9                                                            115   3e-30
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   115   8e-30
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   117   4e-29
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   111   2e-28
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   111   4e-27
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   109   2e-26
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   107   1e-25
Kwal_26.8669                                                          101   1e-24
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement        100   2e-24
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   100   4e-24
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    99   5e-24
Scas_709.9                                                            100   7e-24
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   100   7e-24
Kwal_47.17321                                                         102   7e-24
Scas_602.8                                                            100   4e-23
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    97   4e-23
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          99   5e-23
Scas_691.4                                                             97   6e-23
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    96   9e-23
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    96   3e-22
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         94   7e-22
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    90   2e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    90   2e-20
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    90   3e-20
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    88   6e-20
Scas_640.25                                                            85   7e-19
Kwal_47.18216                                                          86   8e-19
Scas_589.10                                                            83   4e-18
Scas_662.12                                                            82   1e-17
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    82   1e-17
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    82   1e-17
Kwal_23.4731                                                           82   1e-17
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    81   3e-17
Kwal_55.20868                                                          81   5e-17
Scas_716.29                                                            79   8e-17
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    80   9e-17
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    79   1e-16
Scas_379.2                                                             79   1e-16
Kwal_0.232                                                             77   3e-16
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    77   8e-16
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          77   1e-15
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    75   2e-15
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    76   2e-15
Kwal_27.12081                                                          75   4e-15
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    74   7e-15
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            74   1e-14
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    73   1e-14
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    73   2e-14
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    72   4e-14
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    70   8e-14
Scas_717.20                                                            71   1e-13
Scas_721.27                                                            70   2e-13
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    70   2e-13
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    69   2e-13
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    69   3e-13
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          69   4e-13
Kwal_33.14050                                                          69   5e-13
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    68   7e-13
KLLA0D14036g complement(1203522..1204817) some similarities with...    69   7e-13
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    67   3e-12
Kwal_23.4354                                                           65   6e-12
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    65   7e-12
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    65   1e-11
Scas_558.2                                                             64   1e-11
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    64   1e-11
Kwal_14.2210                                                           64   1e-11
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    64   1e-11
Kwal_23.3042                                                           65   2e-11
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       64   2e-11
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    64   2e-11
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    63   2e-11
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    64   2e-11
Kwal_26.7967                                                           64   2e-11
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    64   3e-11
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    63   4e-11
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    63   4e-11
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    62   6e-11
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    62   7e-11
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    62   1e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    62   1e-10
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    61   2e-10
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         61   2e-10
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    61   2e-10
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    61   4e-10
Scas_718.24                                                            60   4e-10
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    60   5e-10
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    60   5e-10
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    59   7e-10
Scas_582.7                                                             59   7e-10
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    59   8e-10
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    59   8e-10
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       59   9e-10
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    59   1e-09
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    57   3e-09
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    56   7e-09
Kwal_26.7972                                                           57   7e-09
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    56   8e-09
Kwal_27.12481                                                          55   1e-08
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    55   1e-08
Scas_578.3*                                                            56   2e-08
Scas_667.4                                                             55   2e-08
Scas_645.9                                                             55   3e-08
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    55   3e-08
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    54   4e-08
Scas_702.10                                                            54   4e-08
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    54   5e-08
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    54   6e-08
Kwal_27.11419                                                          53   7e-08
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    53   8e-08
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    53   8e-08
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    52   1e-07
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    52   1e-07
Kwal_23.3529                                                           52   2e-07
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    52   2e-07
Scas_562.12                                                            51   3e-07
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            51   3e-07
Scas_721.129                                                           51   4e-07
Scas_613.24                                                            49   5e-07
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    49   6e-07
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         50   6e-07
Kwal_47.19228                                                          50   8e-07
Scas_669.6                                                             50   9e-07
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    50   9e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    50   1e-06
Scas_489.4                                                             49   1e-06
Scas_328.1                                                             49   2e-06
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    49   2e-06
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         49   2e-06
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            49   3e-06
Kwal_23.3965                                                           48   4e-06
Kwal_26.7653                                                           48   4e-06
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    48   4e-06
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    48   5e-06
Kwal_27.11626                                                          47   6e-06
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    47   1e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       46   2e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    45   2e-05
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    45   4e-05
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    44   5e-05
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    44   6e-05
Kwal_33.15597                                                          44   7e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    44   7e-05
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         44   9e-05
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    42   2e-04
Kwal_34.15907                                                          42   3e-04
Scas_715.45                                                            42   4e-04
Kwal_55.21106                                                          42   4e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    42   4e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    41   5e-04
Scas_705.9                                                             41   6e-04
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    41   7e-04
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            41   7e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    40   0.001
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    40   0.001
Scas_673.17                                                            39   0.002
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    39   0.002
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    39   0.002
Kwal_55.21338                                                          39   0.002
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    39   0.004
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    39   0.004
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    39   0.004
Kwal_23.5757                                                           39   0.005
Scas_696.9                                                             38   0.005
Scas_687.15*                                                           38   0.006
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    38   0.006
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    38   0.008
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    35   0.009
Sklu_2127.4 , Contig c2127 6322-7293                                   38   0.009
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    37   0.011
CAGL0D05500g complement(524950..526083) highly similar to sp|P48...    37   0.015
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    36   0.027
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    36   0.028
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    36   0.029
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    36   0.035
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    35   0.048
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             35   0.071
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    32   0.50 
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    32   0.51 
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    32   0.82 
AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH] complement(...    32   0.92 
CAGL0L07392g 815667..816854 similar to sp|P43122 Saccharomyces c...    30   2.0  
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    30   2.7  
Scas_693.7                                                             30   3.6  
Sklu_2129.3 YIL115C, Contig c2129 2430-6689 reverse complement         30   4.1  
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    29   5.1  

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA
Sbjct: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL
Sbjct: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180
           LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL
Sbjct: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240
           TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV
Sbjct: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240

Query: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA
Sbjct: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300

Query: 301 MRVLG 305
           MRVLG
Sbjct: 301 MRVLG 305

>Scas_667.22
          Length = 306

 Score =  479 bits (1232), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 262/307 (85%), Gaps = 3/307 (0%)

Query: 1   MTEELPTPLIIDDLDG--AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT 58
           M+EE PTP +IDDL+    HD+ RV KDLLAGTAGG++QVL+GQPFDTTKVRLQTSS PT
Sbjct: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 59  TALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETL 118
           TA++V++KL+KNEG +GFYKGTLTPL+GVGACVS+QFGVNEAMKRFFHSRN +S  ++ L
Sbjct: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDS-TSQIL 119

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
            L QYY+CG  GG  NSFLASPIEHVRIRLQTQTG+G   +F GPLDCI+KL A    MR
Sbjct: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMR 179

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPL 238
           GLTPTMLRE HGCG YFL YEA++ANE++KG  R+E+P WKLCLFGA SGTTLW+M+YPL
Sbjct: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPL 239

Query: 239 DVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           DVIKSVMQTD+L  PK G ++  VAKT+Y+  GL +FFKGFGPTMLRAAPANGATFATFE
Sbjct: 240 DVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFE 299

Query: 299 LAMRVLG 305
           LAMR+LG
Sbjct: 300 LAMRLLG 306

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  476 bits (1225), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 223/307 (72%), Positives = 261/307 (85%), Gaps = 4/307 (1%)

Query: 1   MTEELPTPLIIDDLDG--AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT 58
           M+EE PTP +IDDL+     D+ RV KDLLAGTAGG++QVLIGQPFDTTKVRLQTS VPT
Sbjct: 1   MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT 60

Query: 59  TALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETL 118
           +A +VVK L+KNEG +GFYKGTLTPLVGVGACVS+QFGVNEAMKRFFH+RN +   N TL
Sbjct: 61  SAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDH--NATL 118

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
            L QYYLCG  GG  NSFLASPIEHVRIRLQTQTG+GA A+F GP+DCIKKL +   LMR
Sbjct: 119 SLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMR 178

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPL 238
           GL PTMLRE HGCG YFL YEAL++ ++++G+ R+EIP WKLCL+GA SGT LWLM+YP+
Sbjct: 179 GLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPI 238

Query: 239 DVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           DV+KSVMQTD+L +P+ GKNM+QVA+ +Y+  GL +FFKGFGPTMLRAAPANG TFATFE
Sbjct: 239 DVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFE 298

Query: 299 LAMRVLG 305
           LAMR+LG
Sbjct: 299 LAMRLLG 305

>Kwal_27.12599
          Length = 304

 Score =  474 bits (1219), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 225/306 (73%), Positives = 261/306 (85%), Gaps = 3/306 (0%)

Query: 1   MTEELPTPLIIDDLDGA-HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT 59
           M EE  +PL+IDD+D   HDS RV KDLLAGTAGG++QVL+GQPFDTTKVRLQTS+ PTT
Sbjct: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60

Query: 60  ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG 119
           A++VVKKLVKNEG RGFYKGTLTPLVGVGACVS QFGVNEAMKRFF  R  ++ P++TL 
Sbjct: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFF--RGSSADPHKTLT 118

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRG 179
           L QYY+CGF GG ANSFLASPIEHVRIRLQTQT +G  A+F GPLDCI KL AN +LMRG
Sbjct: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRG 178

Query: 180 LTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLD 239
           L+PT+LRE+ GC  YFLTYEAL+AN++ KG++RS++P WKLCLFGA SG TLWL +YPLD
Sbjct: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLD 238

Query: 240 VIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
           VIKS+MQTD+L  P +GKN++QVA+ + +  G  SFFKGFGPTMLRAAPANGATFATFEL
Sbjct: 239 VIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298

Query: 300 AMRVLG 305
           AMR LG
Sbjct: 299 AMRFLG 304

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  466 bits (1200), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/309 (72%), Positives = 261/309 (84%), Gaps = 6/309 (1%)

Query: 1   MTEELPTPLIIDDLDG--AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT 58
           M+EE P+P +IDDL+    HD+ RV KDLLAGTAGG++QVL+GQPFDTTKVRLQTSS PT
Sbjct: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 59  TALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETL 118
           TA++VV+KL+ NEG RGFYKGTLTPL+GVGACVS+QFGVNEAMKRFFH RN +   + TL
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADM--SSTL 118

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
            L QYY CG  GG  NSFLASPIEHVRIRLQTQTG+G  A+F GPL+CIKKL  N +L+R
Sbjct: 119 SLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLR 178

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHK--GVSRSEIPTWKLCLFGATSGTTLWLMIY 236
           GLTPT+LRE HGCG YFL YEALIAN+++K  G+ R +IP WKLC+FGA SGT LWLM+Y
Sbjct: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238

Query: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           PLDVIKSVMQTD+L +PK G ++  VAKT+Y+  G+ +FFKGFGPTMLRAAPANGATFAT
Sbjct: 239 PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFAT 298

Query: 297 FELAMRVLG 305
           FELAMR+LG
Sbjct: 299 FELAMRLLG 307

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  447 bits (1150), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/305 (72%), Positives = 253/305 (82%), Gaps = 2/305 (0%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           MTEE PTP +IDDL+  HD+TRV KDLLAGTAGG++QVL+GQPFDTTKVRLQTS   T A
Sbjct: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           + V+K L+KNEG  GFYKGTLTPLVGVGACVS+QFGVNEAMKRFFH+ +     ++ L L
Sbjct: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD--EAASQHLSL 118

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180
           LQYY+CG AGG  NSFLASPIEH+RIRLQTQTG+GA A+F GP+DCIKKL  N  LMRGL
Sbjct: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGL 178

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240
           TPTMLRESHGCGVYFLTYEALI +++  G+ R +IP WKLCLFGA SGT LW M+YPLDV
Sbjct: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238

Query: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           IKSVMQTD+L  PK G N+L V +TI + +G+S  FKGF PTMLRAAPAN ATFATFE A
Sbjct: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETA 298

Query: 301 MRVLG 305
           MR+LG
Sbjct: 299 MRLLG 303

>Scas_718.5
          Length = 324

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 235/324 (72%), Gaps = 19/324 (5%)

Query: 1   MTEELPTPLIIDDLDG----------------AHDSTRVFKDLLAGTAGGVSQVLIGQPF 44
           M+E+  +P +I++ D                 A DSTRV KD+LAGT GG+SQV++GQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 45  DTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRF 104
           DTTKVR+QTS+    ALD+++KLVKNEG   FYKG+L P+VGVGACVSVQFGVNEAMKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 105 FHSRNGNSGPNE---TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH 161
           F   N + G      TL L QYY+CG  GG  NSFLASPIEHVRIRLQTQTG G   +F 
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 162 GPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLC 221
           GPLDCI+KL    SLMRGL P MLR  HG G YFLTYEALIANE+ KG  RSEI +WKLC
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240

Query: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGP 281
            +G+ SG  LWL IYPLDV+KS++QTD+L  P+   +M  V   +Y  +G+S+FFKGF P
Sbjct: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300

Query: 282 TMLRAAPANGATFATFELAMRVLG 305
           TMLRAAP NGATF TFEL MR+LG
Sbjct: 301 TMLRAAPVNGATFVTFELVMRLLG 324

>Kwal_33.12988
          Length = 303

 Score =  405 bits (1040), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/304 (62%), Positives = 227/304 (74%), Gaps = 2/304 (0%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           M++EL  P ++DDL    D  R  KD+ AGT GG++QVL+GQPFD TKVRLQTSS PTTA
Sbjct: 1   MSDELTMPQVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA 60

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           L VV+ LVKNEG RGFYKGT  PL+GVG CVS QFG NEAMKR+FH RN     + +L L
Sbjct: 61  LRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQ--STSLRL 118

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180
            +YY CGF  G AN+FLA+PIEHVRI LQ QT + A A++ G +DCIKKL     LMRG 
Sbjct: 119 PEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLMRGF 178

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240
           TPT+LR SHG GVYF +YEA+I +E  KG++R +IP WKLCL+GA SG+ LW M+YP DV
Sbjct: 179 TPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDV 238

Query: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           IKSVMQ+D L  P  G N+ QVAK IY+ RG  +F KGFGPTMLR+ P NGATF  FE+A
Sbjct: 239 IKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMA 298

Query: 301 MRVL 304
           MR+L
Sbjct: 299 MRIL 302

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 196/327 (59%), Positives = 234/327 (71%), Gaps = 22/327 (6%)

Query: 1   MTEELPTPLIIDDLDGAH-----------DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKV 49
           M+EE PTP ++D+L+               S RV KD+ AGT GG++QVL+GQPFDTTKV
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 50  RLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN 109
           RLQT++  TT L+V++ LVKNEG   FYKG LTPL+GVG CVSVQFGVNEAMKRFF + N
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 110 GNSGPN-----------ETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAA 158
            +  PN            TL L QYY+CG  GG  NSFLASPIE +RIRLQTQT  G   
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 159 QFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTW 218
           +F GP DCIKKL A   LMRGL PTM+R  HG G YFL YEAL+A E+  G++R+EIP W
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240

Query: 219 KLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKG 278
           KLCLFGA SGT LWL +YPLDV+KS++Q D L +PK   ++  VAKTIY+  G+ +FFKG
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 279 FGPTMLRAAPANGATFATFELAMRVLG 305
           FGPTM+R+AP NGATF TFEL MR LG
Sbjct: 301 FGPTMVRSAPVNGATFLTFELVMRFLG 327

>Kwal_56.23011
          Length = 303

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 187/304 (61%), Positives = 223/304 (73%), Gaps = 2/304 (0%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           M+EEL +P ++DDL   HD  +  KD+  GT GGV+QVL+GQPFD TKVRLQTS VPTTA
Sbjct: 1   MSEELTSPQVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTA 60

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
             V+K LVKNEG   FYKGTL PL GVGACVS QFGVNEA+K++F  ++GN   ++ L L
Sbjct: 61  AQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNF--DQPLAL 118

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180
            QYY CGF  GTAN+FLA+PIEHVRIRLQ QT + +AA++HG LDC +KL    +LMRG 
Sbjct: 119 RQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGF 178

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240
           T T LR SHG G+YFLTYE LIAN+ H GV R  IP WK+C++GA SG   W M YP DV
Sbjct: 179 TATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDV 238

Query: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           +KSVMQ D L  P  G+N L VAK IY  RG  +F KGF PTMLR+ P NGATFA FE+ 
Sbjct: 239 VKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEIT 298

Query: 301 MRVL 304
           MR++
Sbjct: 299 MRLI 302

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  398 bits (1023), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 231/304 (75%), Gaps = 2/304 (0%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           M++EL TP ++DDL  A +  +  KD+++GT+GG++QVL+GQPFD TKVR+QTSS   TA
Sbjct: 1   MSDELTTPQVVDDLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA 60

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           ++V+K LVKNEG   FYKGTL PL+GVGACVS QFGVNEAMKR+F   NG    ++ L L
Sbjct: 61  IEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYK--DQHLSL 118

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180
           LQYY CGF  G+AN+FLA+PIEHVRIRLQ QT   A A++ G LDC+KKL    +LMRG 
Sbjct: 119 LQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGF 178

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240
           T T++R SHG GVYFLTYEALI N+   GV R +IP WK+C+FGA SG   W M YP DV
Sbjct: 179 TATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDV 238

Query: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           +KS+MQ D L+ P  GKN+ QVAK+I++TRG  +F KGF PTMLR+ P NGATFATFE+ 
Sbjct: 239 VKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVT 298

Query: 301 MRVL 304
           MR+L
Sbjct: 299 MRLL 302

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  396 bits (1017), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 184/304 (60%), Positives = 230/304 (75%), Gaps = 2/304 (0%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           M++EL  P ++DDL  + D  R  KD+L+GTAGG++QVL+GQPFD TKVR+QTS+   TA
Sbjct: 1   MSDELTAPQVVDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA 60

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           +DVV  L+KNEG  GFYKGTL PLVGVGACVS QFGVNEAMKR F   NG+  P++ L L
Sbjct: 61  VDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGD--PSKPLSL 118

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180
            QYY+CG A G AN+FLA+PIEHVRIRLQ QT + A A++ G LDC++KL    +LMRG 
Sbjct: 119 KQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRGF 178

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240
           T T++R  HG G+YF TYEALIAN+  KG+ R +I  WK+C+FGA SG   W M YP+DV
Sbjct: 179 TATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDV 238

Query: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           +KS+MQ+D L+ P  G N+ QVAK+IY+TRG  +F KGF P MLR+ P NGATFATFE+ 
Sbjct: 239 VKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMT 298

Query: 301 MRVL 304
           MR+L
Sbjct: 299 MRLL 302

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  387 bits (993), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 225/311 (72%), Gaps = 6/311 (1%)

Query: 1   MTEELPTPLIIDDLDGAHDST---RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP 57
           M+EE PTP ++++L+     T   RV KD+ AGT GGV+QVL+GQPFDTTKVRLQTS   
Sbjct: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60

Query: 58  TTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNS-GPNE 116
              ++VV+ L++NEG   FYKG LTPL+GVG CVSVQFGVNE+MKRFF + N +   P +
Sbjct: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120

Query: 117 --TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN 174
              L L QYYLCG  GG  NSFLA+PIEHVRIRLQTQT  G   QF GP DCIKKL    
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM 234
           +LMRGL PTM+R  HG G YF  YEAL+  E  KG  R++IP WKLC FGA SGT LWL 
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240

Query: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
           +YP+DV+KSV+QTDS+  PK   ++++  + +Y   G+ +FFKGF PTM+RAAPAN ATF
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300

Query: 295 ATFELAMRVLG 305
            +FE+ MRVLG
Sbjct: 301 VSFEMTMRVLG 311

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  362 bits (928), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 211/303 (69%), Gaps = 1/303 (0%)

Query: 3   EELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALD 62
           E L TP +++DL   H   +  KD+ +GT GGV+QVL+GQPFD  KVRLQT     TA +
Sbjct: 4   ELLITPQVVEDLTDLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWE 63

Query: 63  VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGP-NETLGLL 121
            +  LVK EGF GFYKGT+ PLVGVGACVS QFG+NEAMKR+F   N + G  + TL L 
Sbjct: 64  AITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLG 123

Query: 122 QYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLT 181
           QYY CGF  G+AN+ LA+PIEHVRIRLQ Q    A A++   LDC +KL    SLMRG T
Sbjct: 124 QYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLMRGFT 183

Query: 182 PTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVI 241
            T++R SHG G+YFLTYE LIA++L  G  R +I  WK C+FGA SG   W M YP DV+
Sbjct: 184 ATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVV 243

Query: 242 KSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAM 301
           KSVMQ D L+ P  G N++QVAK IY  RGL +F KGF PTMLR+ P NGATFA FE+ M
Sbjct: 244 KSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTM 303

Query: 302 RVL 304
           ++L
Sbjct: 304 QML 306

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  146 bits (368), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 144/287 (50%), Gaps = 28/287 (9%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEG---------FRG 75
           K L AG  GGV  VL G PFD  KVR Q++    T   V K LV+             RG
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRG 108

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135
           FYKG + PL+GV    +V F   +  K+   + N NSG    L   Q    GF      +
Sbjct: 109 FYKGVIPPLLGVTPIFAVSFWGYDVGKKLV-TWNDNSG---KLTTAQLATAGFISAIPTT 164

Query: 136 FLASPIEHVRIRLQTQTG--TGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGV 193
            + +P E V++ LQTQ+    G+AA+       I       SL RG   T+ R+  G  +
Sbjct: 165 LVMAPTERVKVVLQTQSNHSLGSAAKH------ILATGGVRSLFRGSLATLARDGPGSAL 218

Query: 194 YFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQP 253
           YF +YEA  A  L+     +E+    +CL G  +G ++W+ ++P+D IK+ +Q+ +  Q 
Sbjct: 219 YFASYEATKA-YLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTRQ- 276

Query: 254 KQGKNMLQVAKTIYSTR-GLSSFFKGFGPTMLRAAPANGATFATFEL 299
                M++  + IY+TR G+  FF G GP +LR+ PAN ATF   EL
Sbjct: 277 ----TMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  144 bits (364), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 153/314 (48%), Gaps = 28/314 (8%)

Query: 4   ELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDV 63
           EL T  + D        T   K L AG  GGV  VL G PFD  KVR Q++    +A+D 
Sbjct: 9   ELETSHVNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQA-RSAMDA 67

Query: 64  VKKLVKN----------EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS-----R 108
           V  +++              RGFYKG + PL+GV    +V F   +  K+   S      
Sbjct: 68  VSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAA 127

Query: 109 NGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK 168
           +G +     L L Q    GF      + + +P E V++ LQT  G    A F      I 
Sbjct: 128 SGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGK---ASFLDAAKQIV 184

Query: 169 KLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHK--GVSRSEIPTWKLCLFGAT 226
           +     SL +G   T+ R+  G  +YF +YE +    L+K  G +  E+    +C+ G  
Sbjct: 185 RTQGFQSLFKGSLATLSRDGPGSALYFASYE-ICKEYLNKASGHTSGELSITNVCISGGM 243

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTR-GLSSFFKGFGPTMLR 285
           +G ++W++++P+D +K+ +Q+ S  Q     +ML+V + IY+TR G+  FF G GP +LR
Sbjct: 244 AGVSMWVVVFPIDTVKTQLQSSSKRQ-----SMLEVTRMIYNTRGGIKGFFPGVGPAILR 298

Query: 286 AAPANGATFATFEL 299
           + PAN ATF   EL
Sbjct: 299 SFPANAATFLGVEL 312

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 78/205 (38%), Gaps = 33/205 (16%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGA----------AAQFHGPLDCIKKL 170
           L+    G  GG        P + V++R Q+     A          A Q  GP      L
Sbjct: 29  LKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTS----L 84

Query: 171 TANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVS----------RSEIPTWKL 220
            A     +G+ P +L  +    V F  Y+  +  +L   V             E+   ++
Sbjct: 85  NAVRGFYKGVVPPLLGVTPIFAVSFWGYD--VGKKLVTSVPSSAASGAAAVEPELTLSQM 142

Query: 221 CLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGK-NMLQVAKTIYSTRGLSSFFKGF 279
              G  S     L+  P + +K V+QT       QGK + L  AK I  T+G  S FKG 
Sbjct: 143 AAAGFISAIPTTLVTAPTERVKVVLQTT------QGKASFLDAAKQIVRTQGFQSLFKGS 196

Query: 280 GPTMLRAAPANGATFATFELAMRVL 304
             T+ R  P +   FA++E+    L
Sbjct: 197 LATLSRDGPGSALYFASYEICKEYL 221

>Scas_697.47
          Length = 328

 Score =  141 bits (356), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 146/292 (50%), Gaps = 26/292 (8%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKN-----------EG 72
            K L+AG  GGV  VL G PFD  KVR Q+    +T +  +K ++K+             
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASST-IHAIKIILKDARAIPTSNMLVNS 95

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
            +GFYKG + PL+GV    +V F   +  K+   +R+ +S    T+G  Q    GF    
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIV-TRSDSSSAQLTMG--QMAAAGFISAI 152

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCG 192
             + + +P E +++ LQT  G  +   F G    I K     SL +G   T+ R+  G  
Sbjct: 153 PTTLVTAPTERIKVVLQT-AGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSA 211

Query: 193 VYFLTYE---ALIANELHKGVSRS-EIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
           +YF +YE     + +      S++ E+    +CL G  +G ++WL+++P+D IK+ +Q+ 
Sbjct: 212 LYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSS 271

Query: 249 SLLQPKQGKNMLQVAKTIYSTR-GLSSFFKGFGPTMLRAAPANGATFATFEL 299
           S  Q     +M+   + IY  R G+  FF G GP +LR+ PAN ATF   EL
Sbjct: 272 SGSQ-----SMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 76/191 (39%), Gaps = 10/191 (5%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM--- 177
           L+  + G  GG        P + +++R Q+   +         L   + +  +N L+   
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 178 ----RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL 233
               +G+ P +L  +    V F  Y+           S +++   ++   G  S     L
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTTL 156

Query: 234 MIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGAT 293
           +  P + IK V+QT          + +  AK I    G+ S FKG   T+ R  P +   
Sbjct: 157 VTAPTERIKVVLQTAG---ANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALY 213

Query: 294 FATFELAMRVL 304
           FA++E++ + L
Sbjct: 214 FASYEISKKFL 224

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 134/292 (45%), Gaps = 28/292 (9%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDV----------VKKLVKNEGFR 74
           K  +AG  GGV  V  G PFD  KVR Q     +T   +          VK  +     +
Sbjct: 37  KSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVK 96

Query: 75  GFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
           GFYKG + PL+GV    +V F   +  K+     N   G NE L + Q    GF      
Sbjct: 97  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNE-LTMGQMAAAGFISAIPT 155

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVY 194
           + + +P E V++ LQT +       F      I K     SL +G   T+ R+  G  +Y
Sbjct: 156 TLVTAPTERVKVVLQTSS----KGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALY 211

Query: 195 FLTYEALIANELHKGVSRSE------IPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
           F +YE +  N L+    R +      +    +CL G  +G ++WL ++P+D IK+ +Q  
Sbjct: 212 FASYE-ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQAS 270

Query: 249 SLLQPKQGKNMLQVAKTIYSTRG-LSSFFKGFGPTMLRAAPANGATFATFEL 299
           S  Q     NML   K IY  RG +  FF G GP +LR+ PAN ATF   E+
Sbjct: 271 STRQ-----NMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEM 317

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 23/197 (11%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN------- 173
           ++ ++ G  GG    F   P + +++R Q      A +  H   + IK+           
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQ---ANSTVHAITNIIKEAKTQVKGTLFT 92

Query: 174 NSL---MRGLTPTMLRESHGCGVYFLTYEA---LIANELHKGVSRSEIPTWKLCLFGATS 227
           NS+    +G+ P +L  +    V F  Y+    L+     +G S +E+   ++   G  S
Sbjct: 93  NSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGS-NELTMGQMAAAGFIS 151

Query: 228 GTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAA 287
                L+  P + +K V+QT S        + +Q AKTI    G++S FKG   T+ R  
Sbjct: 152 AIPTTLVTAPTERVKVVLQTSS------KGSFIQAAKTIVKEGGIASLFKGSLATLARDG 205

Query: 288 PANGATFATFELAMRVL 304
           P +   FA++E++   L
Sbjct: 206 PGSALYFASYEISKNYL 222

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 16  GAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKL-VKNEGFR 74
           G  +   +    LAG   G+S  L   P DT K +LQ SS     L   K++ ++  G +
Sbjct: 232 GKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIK 291

Query: 75  GFYKG 79
           GF+ G
Sbjct: 292 GFFPG 296

>Kwal_23.2913
          Length = 320

 Score =  138 bits (347), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 144/306 (47%), Gaps = 28/306 (9%)

Query: 11  IDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKN 70
           I+    +H     F+ L AG  GGV  VL G PFD  KVR Q++    T LD + +++  
Sbjct: 16  IEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGT-LDAISRVLHE 74

Query: 71  ----------EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-------GNSG 113
                        +GFY+G + PL+GV    +V F   +  KR     +       G+S 
Sbjct: 75  AKSKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSS 134

Query: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN 173
               L   Q  L GF      + + +P E V++ LQT      +  F G    + +    
Sbjct: 135 KLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSE----SGSFLGAARTLIREGGV 190

Query: 174 NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL 233
            SL +G   T+ R+  G  +YF +YE +    L +      +    +C+ G  +G ++W+
Sbjct: 191 RSLFQGTLATLARDGPGSALYFASYE-VSKRFLSRNQDTDALSVVSICVAGGVAGMSMWI 249

Query: 234 MIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGAT 293
            ++P+D IK+ +Q+ S     + ++M+Q A+ IY+  GL  FF G GP ++R+ PAN AT
Sbjct: 250 GVFPIDTIKTKLQSSS-----RSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAAT 304

Query: 294 FATFEL 299
           F   E 
Sbjct: 305 FLGVEF 310

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 30/199 (15%)

Query: 126 CGFAGGTANSFLASPIEHVRIRLQTQTGTGA----------AAQFHGPLDCIKKLTANNS 175
            G  GG        P + +++R Q+   +G           A    GPL     L     
Sbjct: 34  AGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPL----PLNQIKG 89

Query: 176 LMRGLTPTMLRES---------HGCGVYFLTYEALIANELHKGVSR-SEIPTWKLCLFGA 225
             RG+ P +L  +         +  G   +T+ +    ++    S+ + + T +L L G 
Sbjct: 90  FYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGF 149

Query: 226 TSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLR 285
            S     L+  P + +K V+QT       +  + L  A+T+    G+ S F+G   T+ R
Sbjct: 150 FSAIPTTLITAPTERVKVVLQTS------ESGSFLGAARTLIREGGVRSLFQGTLATLAR 203

Query: 286 AAPANGATFATFELAMRVL 304
             P +   FA++E++ R L
Sbjct: 204 DGPGSALYFASYEVSKRFL 222

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  137 bits (346), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 152/320 (47%), Gaps = 43/320 (13%)

Query: 7   TPLIIDDLDGAHDSTRV-FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVK 65
           TP   + L+   D+ R   K L+AG  GGV  VL G PFD  KVR Q++   +T +D V 
Sbjct: 4   TPAETNILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKST-MDAVS 62

Query: 66  KLVKN------------------EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
            ++K                      +GFYKG + PL+GV    +V F   +  KR    
Sbjct: 63  IILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTW 122

Query: 108 RNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGP-LDC 166
           +  +  P   L   Q    GF      + + +P E +++ LQT +      +F G  +  
Sbjct: 123 KQASDAP---LTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNS------EFKGSFIKA 173

Query: 167 IKKLTAN---NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVS---RSEIPTWKL 220
            K + +     SL  G   T+ R+  G  +YF +YE L    L+K V+   + E+    +
Sbjct: 174 AKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYE-LSKAFLNKSVAKKDKDEVNLANV 232

Query: 221 CLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTR-GLSSFFKGF 279
           CL G  +G ++WL+++P+D IK+ +Q  +        +M+Q  K IY  R G+  FF G 
Sbjct: 233 CLAGGIAGMSMWLVVFPIDTIKTRLQVAT-----TPISMVQATKDIYIQRGGIKGFFPGL 287

Query: 280 GPTMLRAAPANGATFATFEL 299
           GP +LR+ PAN ATF   EL
Sbjct: 288 GPALLRSFPANAATFLGVEL 307

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 82/200 (41%), Gaps = 22/200 (11%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL-TANNSL--- 176
           ++  + G  GG        P + +++R Q+             L   + L T N SL   
Sbjct: 22  MKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTS 81

Query: 177 ----------MRGLTPTMLRESHGCGVYFLTYEALIANEL--HKGVSRSEIPTWKLCLFG 224
                      +G+ P ++  +    V F  Y+  I   L   K  S + + T ++   G
Sbjct: 82  LFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYD--IGKRLVTWKQASDAPLTTAQMATAG 139

Query: 225 ATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
             S     L+  P + IK V+QT+S  +     + ++ AK I ST G+ S F G   T+ 
Sbjct: 140 FISAIPTTLVTAPTERIKVVLQTNSEFK----GSFIKAAKHIVSTGGVKSLFNGSLATLA 195

Query: 285 RAAPANGATFATFELAMRVL 304
           R  P +   FA++EL+   L
Sbjct: 196 RDGPGSALYFASYELSKAFL 215

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  134 bits (337), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 141/281 (50%), Gaps = 22/281 (7%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---PTTALDVVKKLVKNEG-FRGFYKGT 80
           KD+L G+  G    +I  PFDT KVRLQT      PTT    +K    NEG +RGFY+G 
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTT-WSCIKFTYDNEGLWRGFYQGI 66

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
            +PL G     +V F      KR     +  S  ++T+     +   FAG  A SF+ +P
Sbjct: 67  GSPLAGAALENAVLFVSFNQAKRLLDVESLLSPLSKTV-----WAGAFAGACA-SFVLTP 120

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFLT 197
           +E ++ +LQ    +         L  IK + +      L +G + T +RES G   +F T
Sbjct: 121 VELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTT 180

Query: 198 YEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGK 257
           YE ++ N L       +  TW+L   GA++G      I+P D IKS MQTD +       
Sbjct: 181 YE-VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHI------- 232

Query: 258 NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           ++    + IY+ +G++ F++G G T++RA PAN A F T+E
Sbjct: 233 DLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 76/188 (40%), Gaps = 16/188 (8%)

Query: 125 LCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTM 184
           L G   G     +  P + V++RLQTQ     A  F     CIK    N  L RG    +
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQ----PAHMFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 185 LRESHGCG----VYFLTYEALIANELHKGVSRSEI--PTWKLCLFGATSGTTLWLMIYPL 238
                G      V F+++     N+  + +    +  P  K    GA +G     ++ P+
Sbjct: 67  GSPLAGAALENAVLFVSF-----NQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPV 121

Query: 239 DVIKSVMQTDSLLQPKQGK-NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           ++IK  +Q  +L   K     +L   K++ S RG    ++G   T +R +    A F T+
Sbjct: 122 ELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTY 181

Query: 298 ELAMRVLG 305
           E+    L 
Sbjct: 182 EVVKNYLA 189

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 73/187 (39%), Gaps = 23/187 (12%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA------LDVVKKLVKNEGFRGFYK 78
           K + AG   G     +  P +  K +LQ S++ TT       L  +K ++   GF G ++
Sbjct: 102 KTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQ 161

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G     +      +  F   E +K +  SR   +  N T  LL     G + G A +   
Sbjct: 162 GQSGTFIRESGGGAAWFTTYEVVKNYLASRR-QAEQNTTWELLA---SGASAGLAFNASI 217

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLD-CIKKLTANNSL---MRGLTPTMLRESHGCGVY 194
            P + ++  +QT          H  L    +K+ A   +    RGL  T++R        
Sbjct: 218 FPADTIKSTMQTD---------HIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAI 268

Query: 195 FLTYEAL 201
           F TYE L
Sbjct: 269 FYTYETL 275

>Kwal_33.15446
          Length = 305

 Score =  133 bits (335), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 144/290 (49%), Gaps = 23/290 (7%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---TTALDVVKKLVKNEGFRGFYKGTLTP 83
            ++G   G+++  +G PFDT KVRLQTS         LD V + ++ +G RGFY G   P
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81

Query: 84  LVGVGACVSVQFGV--NEAM--KRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
           LVG     SV  G   N  M  K++ +         E L L    L G   G + SF+A+
Sbjct: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHE------EKLPLSGCILSGVLAGWSVSFIAA 135

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFL 196
           P+E  + +LQ Q       ++ GPLD IKK+ A +    + +GL  T++  +H    ++ 
Sbjct: 136 PVELAKAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWG 193

Query: 197 TYEALIAN-ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255
           +YE L    + +  +S + I  W     G ++    W   YP DVIK V+  +       
Sbjct: 194 SYELLTRWFKANTNLSDTAINFWAG---GFSASFGFWTTAYPSDVIKQVILCNDKYDGSL 250

Query: 256 GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
            ++    A  I+ TRG+  FFKGF P+ LR+ PAN A  A+FE  +RV G
Sbjct: 251 -RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (45%), Gaps = 13/178 (7%)

Query: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN 173
           PNE    +  ++ G   G A + +  P + +++RLQT   TG   +F GPLDC+ +    
Sbjct: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQ 68

Query: 174 NSL---MRGLTPTM----LRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGAT 226
             +     G TP +    L +S   G     Y  L+   +++     ++P     L G  
Sbjct: 69  QGIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRMLLKKYVYQ--HEEKLPLSGCILSGVL 125

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
           +G ++  +  P+++ K+ +Q     Q  + +  L V K +Y+  G+   +KG   T++
Sbjct: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  130 bits (327), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 135/286 (47%), Gaps = 15/286 (5%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---ALDVVKKLVKNEGFRGFYKGTLTP 83
            +AG   GV++  +G PFDT KVRLQTS   T     LD V K  +N+G RGFY G   P
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86

Query: 84  LVGVGACVSVQFGVNEAMKRFFHSRNGNSGPN-ETLGLLQYYLCGFAGGTANSFLASPIE 142
           LVG     SV  G     +   H       PN E L L    + G   G + SF+A PIE
Sbjct: 87  LVGWILMDSVMLGCLHNYRMLMHKY---VYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 143 HVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFLTYE 199
             + +LQ Q       ++ GPLD IKK+ +      L +GL  T++  +H   VY+    
Sbjct: 144 LAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF--VYWWGSY 200

Query: 200 ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNM 259
            L+     +    SE         G ++    W   YP DV+K V+  +        K+ 
Sbjct: 201 ELLTRWFRENTKMSEAAI-NFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYD-GSFKSW 258

Query: 260 LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
               K IY ++G++ FFKGF P+ LR+ PAN A  A FE  +R  G
Sbjct: 259 RTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLRTSG 304

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 17/179 (9%)

Query: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN 174
           NET   +  ++ G   G A + +  P + +++RLQT        +F GPLDC+ K   N 
Sbjct: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQN---ETRFKGPLDCVYKTFRNQ 74

Query: 175 SL---MRGLTPTM----LRESHGCGVYFLTYEALIANELHKGV--SRSEIPTWKLCLFGA 225
            +     G TP +    L +S   G     Y  L    +HK V  +  ++P     + G 
Sbjct: 75  GIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRML----MHKYVYPNDEKLPLSGCIISGV 129

Query: 226 TSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
            +G ++  +  P+++ K+ +Q        + K  L V K IYS +G+   +KG   T++
Sbjct: 130 LAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188

>Kwal_55.21335
          Length = 317

 Score =  130 bits (327), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 139/289 (48%), Gaps = 20/289 (6%)

Query: 16  GAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT--SSVPTTALDVVKKLVKNEGF 73
           G  D     KD+L G+  G +  +I  P DT KVRLQT  + V  T+   +K   + EGF
Sbjct: 38  GIMDFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGF 97

Query: 74  -RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
            +GFY+G  +PLVG     +V F      + F       S  ++T+      L G   G 
Sbjct: 98  VKGFYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQTV------LSGAFAGA 151

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESH 189
             S++ +P+E ++  LQ     GA  +       +K +  +     L +G + T +RE  
Sbjct: 152 CTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECA 211

Query: 190 GCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
           G  V+F TYE+L  + L +  + +E  TW+L   GA++G      I+P D IKS  QT  
Sbjct: 212 GGAVWFTTYESL-KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQH 270

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           L        ++   K I +  G +  ++G G T++RAAPAN   F T+E
Sbjct: 271 L-------GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 21/186 (11%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP------TTALDVVKKLVKNEGFRGFYK 78
           + +L+G   G     +  P +  K  LQ S++       +     VK +V+++G  G ++
Sbjct: 141 QTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQ 200

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G  +  +   A  +V F   E++K +  +R  N   N T  LL     G + G A +   
Sbjct: 201 GQSSTFIRECAGGAVWFTTYESLKSYL-ARRRNDTENHTWELLA---SGASAGVAFNASI 256

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYF 195
            P + ++   QTQ          G +D  K++ A +    L RGL  T++R +    + F
Sbjct: 257 FPADTIKSTAQTQ--------HLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVF 308

Query: 196 LTYEAL 201
            TYE L
Sbjct: 309 YTYETL 314

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  123 bits (308), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 142/289 (49%), Gaps = 33/289 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQT--SSVPTTALDVVKKLVKNEGF-RGFYKGTLT 82
           D++ G+  G    +I  PFDT KVRLQT  S+V  T    +K   +NEG  RGF++G  +
Sbjct: 16  DIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIAS 75

Query: 83  PLVGVGACV---SVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
           PLVG  AC+   ++    N+  K  F  ++ N  P     L Q  + G   G+  S + +
Sbjct: 76  PLVG--ACLENATLFVSYNQCSK--FLEKHTNVFP-----LGQILISGGVAGSCASLVLT 126

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGP--LDCIKKLTANNSL---MRGLTPTMLRESHGCGVY 194
           P+E V+ +LQ      A+A+      L  IK +     L    +G + T +RES G   +
Sbjct: 127 PVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAW 186

Query: 195 FLTYEALIANELHKGVS-----RSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
           F TYE ++   L    S     R E   W+L + G ++G      I+P D +KSVMQT+ 
Sbjct: 187 FATYE-IVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEH 245

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           +       ++    K I+   GL  F++G G T+ RA PAN A F  FE
Sbjct: 246 I-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 83/188 (44%), Gaps = 20/188 (10%)

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLR 186
           G   G     +  P + V++RLQTQ    A+  F     CIK    N  + RG    +  
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQ----ASNVFPTTWSCIKFTYQNEGIARGFFQGIAS 75

Query: 187 ESHGC----GVYFLTYEALIANELHKGVSR--SEIPTWKLCLFGATSGTTLWLMIYPLDV 240
              G        F++Y     N+  K + +  +  P  ++ + G  +G+   L++ P+++
Sbjct: 76  PLVGACLENATLFVSY-----NQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPVEL 130

Query: 241 IKSVMQTDSLLQPKQGK----NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           +K  +Q  +L Q    K     +L   K I + RGL+  ++G   T +R +    A FAT
Sbjct: 131 VKCKLQVANL-QVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFAT 189

Query: 297 FELAMRVL 304
           +E+  + L
Sbjct: 190 YEIVKKSL 197

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  123 bits (309), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 143/290 (49%), Gaps = 23/290 (7%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---ALDVVKKLVKNEGFRGFYKGTLTP 83
            ++G   G+++  +G PFDT KVRLQTS   T     LD V K    +G RGFY G   P
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123

Query: 84  LVGVGACVSVQFGV--NEAM--KRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
           LVG     SV  G   N  M  K++ +         E L L    + G   G + SF+A+
Sbjct: 124 LVGWILMDSVMLGCLHNYRMLLKKYVYYNE------EKLPLSGCIISGVMAGWSVSFIAA 177

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFL 196
           P+E  + +LQ Q       ++ GP+D IKK+ ++N    L +GLT T++  ++    ++ 
Sbjct: 178 PVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV-FWWG 235

Query: 197 TYEALIAN-ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255
           +YE L    + H  +S + I  W     G ++    W   YP DVIK V+  +       
Sbjct: 236 SYELLTRWFKEHTNMSDTAINFWSG---GFSASFGFWTTAYPSDVIKQVVLCNDKYD-GT 291

Query: 256 GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
            ++    AK I+ TRG   FFKGF P+ LR+ PAN A  A FE  +R  G
Sbjct: 292 FRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRTSG 341

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 81/178 (45%), Gaps = 13/178 (7%)

Query: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN 173
           P+E    +  ++ G   G A + +  P + +++RLQT   +  + +F GPLDC+ K    
Sbjct: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDSTRFKGPLDCVYKTFTQ 110

Query: 174 NSL---MRGLTPTM----LRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGAT 226
             +     G TP +    L +S   G     Y  L+   ++   +  ++P     + G  
Sbjct: 111 QGIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRMLLKKYVY--YNEEKLPLSGCIISGVM 167

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
           +G ++  +  P+++ K+ +Q     +  +    + V K +YS+ G+   +KG   T++
Sbjct: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225

>Scas_714.18
          Length = 305

 Score =  122 bits (306), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 146/309 (47%), Gaps = 46/309 (14%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---PTTALDVVKKLVKNEG-FRGFYKGT 80
           +++LAG+  G     I  PFDT KVRLQT      P+T    +K   +NEG   GFY+G 
Sbjct: 14  REILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPST-WSCIKYTYENEGILEGFYQGI 72

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
            +PL+G     ++ F        F      N+    +  L+     GFAG  A SF+ +P
Sbjct: 73  ESPLIGAALENAILFLAYNQCSSFL-----NAFTEFSAFLIILISAGFAGSCA-SFVLTP 126

Query: 141 IEHVRIRLQTQT------------------------GTGAAAQFHGPLDCIKKLTANNSL 176
           +E ++ +LQ                           G G   +    +  I K      L
Sbjct: 127 VELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGL 186

Query: 177 MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEI-PTWKLCLFGATSGTTLWLMI 235
            +G + T +RES G  V+F TYE L+   L     +SE+  TW+L + GAT+G      +
Sbjct: 187 WQGQSSTFIRESIGSVVWFATYE-LMKQTLRD--PKSEVNTTWQLLISGATAGLAFNGSV 243

Query: 236 YPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
           +P D +KS+MQT+ L        +++  ++I    G++ F++G G T+LRA P+N A F 
Sbjct: 244 FPADTVKSIMQTEHL-------ALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFY 296

Query: 296 TFELAMRVL 304
           T+E   ++L
Sbjct: 297 TYEKLSKIL 305

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 89/212 (41%), Gaps = 37/212 (17%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM--- 177
           L+  L G   G    F+  P + V++RLQTQ     A  F     CIK    N  ++   
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQE----AYMFPSTWSCIKYTYENEGILEGF 68

Query: 178 -RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSR-SEIPTWKLCLFGA-TSGTTLWLM 234
            +G+   ++  +    + FL Y     N+    ++  +E   + + L  A  +G+    +
Sbjct: 69  YQGIESPLIGAALENAILFLAY-----NQCSSFLNAFTEFSAFLIILISAGFAGSCASFV 123

Query: 235 IYPLDVIKSVMQTDSL--------------------LQPKQGKN--MLQVAKTIYSTRGL 272
           + P+++IK  +Q  +L                    +   +G++  ++   K+I   +GL
Sbjct: 124 LTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGL 183

Query: 273 SSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
              ++G   T +R +  +   FAT+EL  + L
Sbjct: 184 FGLWQGQSSTFIRESIGSVVWFATYELMKQTL 215

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score =  120 bits (302), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 141/294 (47%), Gaps = 31/294 (10%)

Query: 17  AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---PTTALDVVKKLVKNEG- 72
           + D+ + +KDLL G   G    L+  PFDT KVRLQT S    PTT    V    K EG 
Sbjct: 2   SEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTT-WSCVSHTYKQEGL 60

Query: 73  FRGFYKGTLTPLVGV---GACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFA 129
           +RGFY+G  +P+ G     A + V F   +A+    +S     GP E +        G  
Sbjct: 61  WRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYS----CGPLEKV-----VFAGAI 111

Query: 130 GGTANSFLASPIEHVRIRLQTQTGTGAAA-QFHGPLDCIKKLTANN---SLMRGLTPTML 185
            G   S++ +P+E V+ +LQ    TG +  ++   L  ++ +   N    L +G + T +
Sbjct: 112 AGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFI 171

Query: 186 RESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVM 245
           RES G  V+F  YE L    L +    +E   W+L   GA +G      I+P D +KS M
Sbjct: 172 RESAGGAVWFTAYEVL-KGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTM 230

Query: 246 QTDSL-LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           QT+ L L P          +T+    G + F++G G T+LRA PAN   F  +E
Sbjct: 231 QTEHLGLGP--------AVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  118 bits (296), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 136/290 (46%), Gaps = 24/290 (8%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---PTTALDVVKKLVKNEG-FR 74
           D     KD+  G+  G    +I  PFDT KVRLQT      PTT    ++    +EG ++
Sbjct: 3   DLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTT-WSCIRSTYTDEGIWK 61

Query: 75  GFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
           GFY+G  +PL G     +V F        F           +T+     Y   FAG  A 
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKTI-----YSGAFAGACA- 115

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQ---FHGPLDCIKKLTANNSLM---RGLTPTMLRES 188
           SF+ +P+E V+ +LQ    + + +Q          IK +     L+   +G   T +RE 
Sbjct: 116 SFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVREC 175

Query: 189 HGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
            G  V+F TYE +         +  E  TW+L + GA++G      ++P D +KSV QT+
Sbjct: 176 LGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTE 235

Query: 249 SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
            +       +++   K +  T G++ F++G G T++RAAPAN   F T+E
Sbjct: 236 HV-------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 78/189 (41%), Gaps = 23/189 (12%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKLVKNEGFRG 75
           K + +G   G     I  P +  K +LQ S++          T+    +K ++K +G  G
Sbjct: 103 KTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLG 162

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135
            ++G L+  V      +V F   E MK  F S +     N T  LL   + G + G   +
Sbjct: 163 LWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELL---VSGASAGVLFN 219

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL---MRGLTPTMLRESHGCG 192
               P + V+   QT+  +         ++ +KK+   + +    RGL  T++R +    
Sbjct: 220 ASVFPADTVKSVCQTEHVS--------IVNALKKVLRTHGITGFYRGLGITLIRAAPANA 271

Query: 193 VYFLTYEAL 201
             F TYE L
Sbjct: 272 TVFYTYETL 280

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEG 72
            L  A      ++ L++G + GV       P DT K   QT  V  + ++ +KK+++  G
Sbjct: 194 SLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHV--SIVNALKKVLRTHG 251

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFF 105
             GFY+G    L+      +  F   E +K+ F
Sbjct: 252 ITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 73/181 (40%), Gaps = 15/181 (8%)

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLR 186
           G   G     +  P + V++RLQTQ     A  +     CI+    +  + +G    +  
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ----PAHLYPTTWSCIRSTYTDEGIWKGFYQGIAS 69

Query: 187 ESHGCG----VYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIK 242
              G      V F+++     N L +       P  K    GA +G     ++ P++++K
Sbjct: 70  PLFGAALENAVLFVSFNQC-TNFLDEFTQLK--PLTKTIYSGAFAGACASFILTPVELVK 126

Query: 243 SVMQ----TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
             +Q    ++SL Q  +  ++    K++   +GL   ++G   T +R        F T+E
Sbjct: 127 CKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYE 186

Query: 299 L 299
           +
Sbjct: 187 I 187

>Scas_632.9
          Length = 292

 Score =  115 bits (289), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 147/311 (47%), Gaps = 37/311 (11%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT--SSVPT 58
           M+E +  P+    +  A        D++ G+  G    +I  PFDT KVRLQT  S +  
Sbjct: 1   MSESIDHPIEKSSVQNA------LSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFP 54

Query: 59  TALDVVKKLVKNEG-FRGFYKGTLTPLVGVG---ACVSVQFG-VNEAMKRFFHSRNGNSG 113
           T    +K    NEG +RGF++G  +PL G     A + V +   +  +++F      N  
Sbjct: 55  TTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKF-----TNVS 109

Query: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQT---QTGTGAAAQFHGPLDCIKKL 170
           P     L    L G   G+  SF+ +P+E ++ +LQ    QT      +    +  +  +
Sbjct: 110 P-----LSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYV 164

Query: 171 TANNSLM---RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATS 227
                ++   +G + T +RES G   +F TYE +    L      +E  TW+L + GA++
Sbjct: 165 LREKGILGLWQGQSSTFIRESLGGVAWFATYEVM-KQGLKDRRKDTENKTWELLVSGASA 223

Query: 228 GTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAA 287
           G      I+P D +KS+MQT+ +        ++   K + +T G++ F++G G T++RA 
Sbjct: 224 GLAFNASIFPADTVKSMMQTEHI-------TLINAVKKVLTTYGITGFYRGLGITLIRAV 276

Query: 288 PANGATFATFE 298
           PAN   F  +E
Sbjct: 277 PANATVFYMYE 287

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 12/86 (13%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNML----QVAKTIYSTRGL-SSFFKG 278
           G+ +G    ++ YP D +K  +QT       QG ++        K  Y   G+   FF+G
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQT-------QGSHIFPTTWSCIKYTYHNEGVWRGFFQG 76

Query: 279 FGPTMLRAAPANGATFATFELAMRVL 304
            G  +  AA  N   F ++     VL
Sbjct: 77  IGSPLFGAALENATLFVSYNQCSNVL 102

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  115 bits (287), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 136/297 (45%), Gaps = 25/297 (8%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA-------LDVVKKLVKNEGFRGFYKG 79
            +AG   GV++  +G PFDT KVRLQTS V + A       LD V K +KN+G RG Y G
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
              PL G     S   G     +   H        ++ L L    + G   G   SF+A+
Sbjct: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE--HDKLPLSGCIISGVMAGWTVSFIAA 130

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL----TANN-------SLMRGLTPTMLRES 188
           P+E  + +LQ Q       ++ GP+D ++K+     A N       SL +GL  T++  S
Sbjct: 131 PVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS 189

Query: 189 HGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
           +    ++ +YE LI     K  + S  P       G ++    W   YP DV+K V+  +
Sbjct: 190 NFV-FWWGSYE-LITQWFQKNTNLSA-PAINFWAGGLSASFGFWTSAYPSDVVKQVVLCN 246

Query: 249 SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
                   K+       IY  RG+  FFKGF P+ LR+ PAN A  A FE  +R  G
Sbjct: 247 DKYD-GSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVLRTSG 302

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 73/188 (38%), Gaps = 28/188 (14%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT-----SSVPTTALDVVKKLVKN-- 70
           HD   +   +++G   G +   I  P +  K +LQ      ++  T  +DVV+K+ K   
Sbjct: 106 HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGM 165

Query: 71  ------EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYY 124
                  G R  YKG ++ L+     V   +G  E + ++F      S P          
Sbjct: 166 ATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAINF------ 218

Query: 125 LCGFAGGTANSF----LASPIEHVR-IRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRG 179
              +AGG + SF     A P + V+ + L      G+   +   +  I +    +   +G
Sbjct: 219 ---WAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKG 275

Query: 180 LTPTMLRE 187
             P+ LR 
Sbjct: 276 FLPSFLRS 283

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  117 bits (293), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 128/284 (45%), Gaps = 25/284 (8%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTS---SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           G+  G     I  P D  K R+Q     S    ++D   K++  EG RG Y G    L+G
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIG 609

Query: 87  VGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRI 146
           V    +++  VN+ M+     +NG       LGLL   + G + G       +P+E V+I
Sbjct: 610 VAPEKAIKLTVNDYMRNKLKDKNGK------LGLLSEIISGASAGACQVIFTNPLEIVKI 663

Query: 147 RLQTQ---TGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIA 203
           RLQ +       A       L  IK+L     L +G    +LR+     +YF TY  L  
Sbjct: 664 RLQVKGEYVAENAENAKLTALQIIKRLGLP-GLYKGAAACLLRDVPFSAIYFPTYAHLKR 722

Query: 204 N----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG--- 256
           +    + +    RS + TW+L   GA +G     +  P DVIK+ +Q D    PK+G   
Sbjct: 723 DLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQID----PKKGETI 778

Query: 257 -KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
            K ++  A+TI       SFFKG    +LR++P  G T A +EL
Sbjct: 779 YKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 42/190 (22%), Positives = 75/190 (39%), Gaps = 18/190 (9%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ---------TSSVPTTALDVVKKLVKNEGF 73
           +  ++++G + G  QV+   P +  K+RLQ           +   TAL ++K+L    G 
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GL 692

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKR-FFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
            G YKG    L+      ++ F     +KR  F+    +      L   +    G   G 
Sbjct: 693 PGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGM 752

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL---TANNSLMRGLTPTMLRESH 189
             ++L +P + ++ RLQ     G    + G +   + +    +  S  +G    +LR S 
Sbjct: 753 PAAYLTTPFDVIKTRLQIDPKKGETI-YKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

Query: 190 GCGVYFLTYE 199
             G     YE
Sbjct: 812 QFGFTLAAYE 821

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  111 bits (278), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/312 (28%), Positives = 139/312 (44%), Gaps = 43/312 (13%)

Query: 14  LDGAHDSTRV---FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTS--SVPTTALDVVKKLV 68
           + GA ++  +   F+D+L G+  G    +I  PFDT KVRLQT    V       +    
Sbjct: 1   MSGAEETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTY 60

Query: 69  KNEGF-RGFYKGTLTPLVGVGACVSVQF-GVNEAMKRFFHSRNGNSGPNETLGLLQYYLC 126
           KNEG  +GF++G  +PL G     +  F   N+  K   H  N +        L    + 
Sbjct: 61  KNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSD-------LTNILIS 113

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQT----------GTGAAAQFHGPLDCIKKLTANNS- 175
           G   G+  SF+ +P+E ++ +LQ             G     +    +  I+ +  N   
Sbjct: 114 GAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGF 173

Query: 176 --LMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIP-------TWKLCLFGAT 226
             L +G + T +RES G   +F TYE +   +  K     E P       TW+L   GA+
Sbjct: 174 IGLWQGQSGTFIRESFGGVAWFATYELM--KKYLKSRHNIEDPSLPNDNKTWELLASGAS 231

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRA 286
           +G      I+P D +KS+MQT+ L        +    K I+  +GL  F++G G T++RA
Sbjct: 232 AGLAFNASIFPADTVKSMMQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIRA 284

Query: 287 APANGATFATFE 298
            PAN   F  +E
Sbjct: 285 IPANATVFYVYE 296

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 84/211 (39%), Gaps = 25/211 (11%)

Query: 112 SGPNETLGLLQYY---LCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK 168
           SG  ET  L   +   L G   G     +  P + V++RLQTQ        F     CI 
Sbjct: 2   SGAEETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQ----GRHVFPDTWSCIT 57

Query: 169 KLTANNSLMRGLTPTMLRESHGCGV----YFLTYEALIANELHKGVSRSEIPTWKLCLFG 224
               N  +++G    +     G  +     FL+Y    +  L    + S++    + + G
Sbjct: 58  YTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYNQC-SKFLQHYTNVSDLT--NILISG 114

Query: 225 ATSGTTLWLMIYPLDVIKSVMQTDSLLQ-----------PKQGKNMLQVAKTIYSTRGLS 273
           A +G+    ++ P+++IK  +Q  +L              ++   ++   + +   RG  
Sbjct: 115 AFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFI 174

Query: 274 SFFKGFGPTMLRAAPANGATFATFELAMRVL 304
             ++G   T +R +    A FAT+EL  + L
Sbjct: 175 GLWQGQSGTFIRESFGGVAWFATYELMKKYL 205

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 3/103 (2%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           M + L +   I+D    +D+ + ++ L +G + G++      P DT K  +QT  +    
Sbjct: 201 MKKYLKSRHNIEDPSLPNDN-KTWELLASGASAGLAFNASIFPADTVKSMMQTEHLGLKT 259

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKR 103
              +KK+   +G RGFY+G    L+      +  F V E + +
Sbjct: 260 --AIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSK 300

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  111 bits (278), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 86/300 (28%), Positives = 142/300 (47%), Gaps = 33/300 (11%)

Query: 14  LDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ---TSSVPTTALDVVKKLVKN 70
            D  H+ T      L   AG +   ++  P D  K R+Q    S     ++D V K+ + 
Sbjct: 502 FDSIHNFT------LGSIAGCIGATVV-YPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQT 554

Query: 71  EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAG 130
           +G RG Y G    L+GV    +++  VN+ M+++F +++       T+   Q  L G   
Sbjct: 555 KGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKS------RTIKWYQEILSGATA 608

Query: 131 GTANSFLASPIEHVRIRLQTQT---GTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRE 187
           G       +P+E V+IRLQ ++   G  A  Q  G +  I++L     L +G    +LR+
Sbjct: 609 GACQVVFTNPLEIVKIRLQMRSDYVGENARPQL-GAVGIIRQLGLR-GLYKGAAACLLRD 666

Query: 188 SHGCGVYFLTYEALIAN----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKS 243
                +YF TY  L  +    + +    R+++ TW+L L G  +G     +  P DVIK+
Sbjct: 667 VPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKT 726

Query: 244 VMQTDSLLQPKQGKN----MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
            +Q D    P++G+     ++  A+TI     + SFFKG    +LR++P  G T A FE+
Sbjct: 727 RLQID----PRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEM 782

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  109 bits (272), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 132/284 (46%), Gaps = 26/284 (9%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTS---SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           G+  G    ++  P D  K R+Q     S    ++D + K++  EG RG Y G    L+G
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIG 590

Query: 87  VGACVSVQFGVNEAMKRFFHSRNGN-SGPNETLGLLQYYLCGFAGGTANSFLASPIEHVR 145
           V    +++  VN+ M+     R+G  S P E +        G   G       +P+E V+
Sbjct: 591 VAPEKAIKLTVNDHMRATLAGRDGKLSLPCEIIS-------GATAGACQVVFTNPLEIVK 643

Query: 146 IRLQTQTG--TGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIA 203
           IRLQ ++     AA      +  IK L     L RG    +LR+     +YF TY  + +
Sbjct: 644 IRLQVKSDYVADAARNSVNAISVIKNLGLI-GLYRGAGACLLRDIPFSAIYFPTYAHIKS 702

Query: 204 NELH----KGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKN- 258
           N  +        R+++ TW+L + G  +G     +  P DVIK+ +Q D    PK+G++ 
Sbjct: 703 NVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQID----PKKGESV 758

Query: 259 ---MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
              +   A+TI    G+ SFFKG    +LR++P  G T A +E+
Sbjct: 759 YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEI 802

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTS-----SVPTTALDVVKKLVKNEGFRGFYKGTL 81
           L++G   G+    +  PFD  K RLQ       SV     D  + ++K EG + F+KG  
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGP 783

Query: 82  TPLVGVGACVSVQFGVNEAMKRFFHS 107
             ++      S QFG   A    FH+
Sbjct: 784 ARVLR----SSPQFGFTLAAYEIFHN 805

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  107 bits (267), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 126/284 (44%), Gaps = 25/284 (8%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTS---SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           G+  G     +  P D  K R+Q     +    ++D + K++  EG +G Y G    L+G
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIG 596

Query: 87  VGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRI 146
           V    +++  VN+ M+     +NG       L L    + G + G       +P+E V+I
Sbjct: 597 VAPEKAIKLTVNDFMRNRLTDKNG------KLSLFPEIISGASAGACQVIFTNPLEIVKI 650

Query: 147 RLQTQT---GTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIA 203
           RLQ Q+   G             +KKL     L  G+   ++R+     +YF TY  L  
Sbjct: 651 RLQVQSDYVGENIQQANETATQIVKKLGLR-GLYNGVAACLMRDVPFSAIYFPTYAHLKK 709

Query: 204 N----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKN- 258
           +    + +    R+ + TW+L   GA +G     +  P DVIK+ +Q D    P++G+  
Sbjct: 710 DLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQID----PRKGETK 765

Query: 259 ---MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
              +    +TI       SFFKG G  +LR++P  G T A +EL
Sbjct: 766 YNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 76/190 (40%), Gaps = 18/190 (9%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSS---------VPTTALDVVKKLVKNEGF 73
           +F ++++G + G  QV+   P +  K+RLQ  S            TA  +VKKL    G 
Sbjct: 624 LFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL----GL 679

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKR-FFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
           RG Y G    L+      ++ F     +K+  F     +      L   +    G   G 
Sbjct: 680 RGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGM 739

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK---KLTANNSLMRGLTPTMLRESH 189
             +FL +P + ++ RLQ     G   +++G    I+   K  +  S  +G    +LR S 
Sbjct: 740 PAAFLTTPFDVIKTRLQIDPRKG-ETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSP 798

Query: 190 GCGVYFLTYE 199
             G     YE
Sbjct: 799 QFGFTLAAYE 808

>Kwal_26.8669
          Length = 296

 Score =  101 bits (251), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 28/288 (9%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV----PTT--ALDVVKKLVKNEGFRGFY 77
           F    AG   G+S++L+  P D  K R+Q        P     +D +K++V  EG    Y
Sbjct: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           KG  +P++      + +F  N+  ++ +    G     ++L +L     G + G   +F+
Sbjct: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS----GASAGCCEAFV 125

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194
             P E V+IRLQ       ++ + GP+D ++K+ A     ++  GL  T+ R     GV+
Sbjct: 126 VVPFELVKIRLQD-----VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRH----GVW 176

Query: 195 FLTYEALIANE---LHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251
              Y  +I      L +  S+S+  T    + G+  GT   LM  P DV+KS +Q  +++
Sbjct: 177 NAGYFGIIFQVRALLPEAKSKSQ-QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVV 235

Query: 252 QPKQGKNMLQVAK--TIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
                K         TIY   G  + +KGF P +LR  P  G     F
Sbjct: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 15  DGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP-------TTALDVVKKL 67
           +    S +   DL+AG+ GG    L+  PFD  K R+Q ++V          +   +  +
Sbjct: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252

Query: 68  VKNEGFRGFYKGTLTPLVGVG 88
            K EGFR  YKG +  ++ +G
Sbjct: 253 YKEEGFRALYKGFVPKVLRLG 273

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score =  100 bits (250), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 140/310 (45%), Gaps = 39/310 (12%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ---TSSVPTTALDVVKKLVKNEG--- 72
           D + V K++++G   G    +   P D  KVRLQ   T+  P    DVVK++VK+     
Sbjct: 4   DFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHS 63

Query: 73  -FRGFYKGTLTPLVGVGACVSVQFGV------------NEAMKRFFHSRNGNSGPNETLG 119
            FR  Y+G    L+G      + FG+            N  +KRF    N     ++ + 
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRF----NNTMNNDKEMT 119

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL--- 176
            L Y L     G A S L +PI  ++ R+ + +   + + +   +D IKKL     L   
Sbjct: 120 SLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRS-YRSTVDGIKKLYRIEGLAGF 178

Query: 177 MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMI- 235
            RGL P++   S G  +YF  Y+ L   + H   ++      KL      + T+L  M+ 
Sbjct: 179 WRGLVPSLFGVSQG-AIYFTVYDTL---KYHYFAAKHVDKKKKLSNLEYITITSLSKMVS 234

Query: 236 ----YPLDVIKSVMQT---DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAP 288
               YPL ++KS +Q+    +++ PK    + ++  TIY   G++  +KG    ++RA P
Sbjct: 235 VTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVP 294

Query: 289 ANGATFATFE 298
           +   TF  +E
Sbjct: 295 STCITFCVYE 304

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 131/291 (45%), Gaps = 31/291 (10%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTS-SVPTTA------------LDVVKKLVKNEG 72
             ++G   G+S++ +  P D  K R Q   + PT A            +D +KK+VK EG
Sbjct: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
           F   Y+G  +P++      + +F  N+  ++ F +    +   + + +      G + G 
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI----AAGASAGM 130

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESH 189
             + +  P E ++IR+Q        + + GP+DC+KK   N  +M   +G+  TM R + 
Sbjct: 131 TEAAVIVPFELIKIRMQD-----VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNAL 185

Query: 190 GCGVYF-LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQT- 247
             G YF + Y+  + N +    ++ +  T    + GA  GT   ++  P DV+KS +Q+ 
Sbjct: 186 WNGGYFGVIYQ--VRNSMPVAKTKGQ-KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 248 DSLLQPKQGKNM-LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           D++    +  N  L     IY   G  + +KGF P + R AP        F
Sbjct: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 89/202 (44%), Gaps = 19/202 (9%)

Query: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLV 68
           I  +L   +++T+    + AG + G+++  +  PF+  K+R+Q   S     +D +KK +
Sbjct: 106 IFKNLFNTNETTQKI-SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTI 164

Query: 69  KNEGFRGFYKGTLTPL----VGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYY 124
           KNEG  G YKG  + +    +  G    V + V  +M        G    N+ +      
Sbjct: 165 KNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMP--VAKTKGQKTRNDLIA----- 217

Query: 125 LCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHG----PLDCIKKLTANNSLMRGL 180
             G  GGT  + L +P + V+ R+Q+     +A + +      L  I +     +L +G 
Sbjct: 218 --GAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGF 275

Query: 181 TPTMLRESHGCGVYFLTYEALI 202
            P + R + G  +  + +  ++
Sbjct: 276 VPKVCRLAPGGSLMLVVFTGMM 297

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 13/92 (14%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKK----------LVKNEGFRG 75
           DL+AG  GG    ++  PFD  K R+Q+    ++A   VKK          + + EGFR 
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSA---VKKYNWCLPSLLVIYREEGFRA 270

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
            YKG +  +  +    S+   V   M  FF  
Sbjct: 271 LYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 32/288 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTS----SVP--TTALDVVKKLVKNEGFRGFYKG 79
              AG   GVS++L+  P D  K R+Q      + P  T  +D +KK+V  EG    YKG
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
             +P++      + +F  N+  ++ +    G    ++ L +    L G + G   +F+  
Sbjct: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAGCVEAFVVV 129

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYF- 195
           P E V+IRLQ      A++ + GP+D ++K+ A     ++  GL  T+ R +   G YF 
Sbjct: 130 PFELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184

Query: 196 --LTYEALI--ANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251
                 AL+  A+   + ++   I     C  G    T       P DV+KS +Q  +++
Sbjct: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVI 237

Query: 252 Q--PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
               ++    L    TIY   G  + +KGF P +LR  P  G     F
Sbjct: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 85/190 (44%), Gaps = 14/190 (7%)

Query: 111 NSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL 170
           +S   ++L  L  +  G   G +   +  P++ V+ R+Q Q   GA   + G +DC+KK+
Sbjct: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61

Query: 171 TANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHK---GVSRSEIPTWKLCLFG 224
            A      L +G++  +L E+      F   +     +L+K   GV +   P   L   G
Sbjct: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEF--QKLYKQAFGVEKLSQPLSMLA--G 117

Query: 225 ATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
           A++G     ++ P +++K  +Q  S       K  + V + I +  G+ + + G   T+ 
Sbjct: 118 ASAGCVEAFVVVPFELVKIRLQDAS----SSYKGPVDVVRKIVAREGVLAMYNGLESTLW 173

Query: 285 RAAPANGATF 294
           R A  NG  F
Sbjct: 174 RHALWNGGYF 183

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 82/192 (42%), Gaps = 14/192 (7%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPL 84
            +LAG + G  +  +  PF+  K+RLQ  SS     +DVV+K+V  EG    Y G  + L
Sbjct: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172

Query: 85  VGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYLCGFAGGTANSFLASPIEH 143
                     FG+       F +R    +  N+T  +    +    G +    L++P + 
Sbjct: 173 WRHALWNGGYFGI------IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226

Query: 144 VRIRLQ-TQTGTGAAAQFHGPLDC---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYE 199
           V+ R+Q T    G   +++  L     I +     +L +G  P +LR   G G+  + + 
Sbjct: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286

Query: 200 ALI--ANELHKG 209
            ++     +H G
Sbjct: 287 GVLDFCRAIHYG 298

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 14  LDGAHDSTR-VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVP------TTALDVVK 65
           L  AH+ T+ +  DL++ + G     ++  PFD  K R+Q T+ +P        +L  + 
Sbjct: 193 LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252

Query: 66  KLVKNEGFRGFYKGTLTPLVGVG 88
            + + EGFR  YKG +  ++ +G
Sbjct: 253 TIYREEGFRALYKGFVPKVLRLG 275

>Scas_709.9
          Length = 365

 Score =  100 bits (248), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 124/291 (42%), Gaps = 30/291 (10%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT-------ALDVVKKLVKNEGFRGFYKGT 80
           L+G   G    +I  P D TK RLQ   + +         L  +  +V +EG RG YKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
           +  ++G      + F V E  K  +     NS        + +       G A++ L +P
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSD------FISHSCSAITAGAASTVLTNP 182

Query: 141 IEHVRIRLQTQTGTGAA-AQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFL 196
           I  V+ RL  QT  G +   + G +D  KK+       +L  GL P+M    H   ++F 
Sbjct: 183 IWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-VAIHFP 241

Query: 197 TYEALIANELH-------KGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ--T 247
            YE L  N LH              +   +L +  + S     ++ YP +++++ MQ  +
Sbjct: 242 VYEKL-KNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKS 300

Query: 248 DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           D LL  K    +L + K  Y   GL  F+ GF   +LR  PA+  T  +FE
Sbjct: 301 DKLLISKH--KLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  100 bits (248), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 129/312 (41%), Gaps = 31/312 (9%)

Query: 12  DDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ------TSSVPTTALDVVK 65
           D+   +  ST    +L+AG   G+ + L   P DT KVR+Q        + P   L    
Sbjct: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105

Query: 66  KLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN------GNSGPNETLG 119
            +   EG   FYKG    ++G+   ++++F   E  +     R       GN+       
Sbjct: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNT------- 158

Query: 120 LLQYYLCGFAGGTANSFLA-SPIEHVRIRLQTQTGTGAAAQ--FHGPLDC---IKKLTAN 173
               +L G   G   + L  +P+E V+IRLQ Q   GAA Q  +   +     I K    
Sbjct: 159 ----FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGI 214

Query: 174 NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL 233
            +L RG++ T  R++   G  F  Y  L+   L +      +P+W+  L G  SG     
Sbjct: 215 GALYRGVSLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPF 273

Query: 234 MIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
              PLD IK+ +Q D S         +  + + +    G  + +KG  P ++R AP    
Sbjct: 274 SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333

Query: 293 TFATFELAMRVL 304
           TF  +E   R L
Sbjct: 334 TFTVYEFVRRHL 345

>Kwal_47.17321
          Length = 881

 Score =  102 bits (253), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 130/291 (44%), Gaps = 27/291 (9%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTS---SVPTTALDVVKKLVKNEGFRGFYKG 79
           ++  LL   AG +    +  P D  K R+Q     S    ++D   K+   EG RG Y G
Sbjct: 501 IYNFLLGSVAGCIGATAV-YPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSG 559

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
               LVGV    +++  VN+ +++     N        L L    + G A G       +
Sbjct: 560 LGPQLVGVAPEKAIKLTVNDYVRKLLMDENN------RLTLPLEIISGAAAGACQVIFTN 613

Query: 140 PIEHVRIRLQTQTGTGAA---AQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFL 196
           P+E V+IRLQ ++    +   +Q    L  +K L     L +GL   ++R+     +YF 
Sbjct: 614 PLEIVKIRLQVRSEYADSLPKSQLTA-LGVVKSLGLR-GLYKGLVACLMRDVPFSAIYFP 671

Query: 197 TYEALIAN----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ 252
           TY  L  +    +      R+ + TW+L   G  +G     +  P DVIK+ +Q D    
Sbjct: 672 TYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID---- 727

Query: 253 PKQGKN----MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
           P++G+     +L  A+TI       SFFKG G  +LR++P  G T A +E+
Sbjct: 728 PRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEI 778

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGP 281
           L G+ +G      +YP+D++K+ MQ        Q KN +     I+S  G+   + G GP
Sbjct: 505 LLGSVAGCIGATAVYPIDLVKTRMQAQRNFS--QYKNSIDCFVKIFSREGIRGIYSGLGP 562

Query: 282 TMLRAAPANGATFATFELAMRVL 304
            ++  AP         +   ++L
Sbjct: 563 QLVGVAPEKAIKLTVNDYVRKLL 585

>Scas_602.8
          Length = 885

 Score = 99.8 bits (247), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 127/287 (44%), Gaps = 18/287 (6%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT---TALDVVKKLVKNEGFRGFYKG 79
           +F   L   AG +   L+  P D  K R+Q     T    ++D + K+   EG RG Y G
Sbjct: 499 IFNFSLGSVAGCIGATLV-YPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSG 557

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
               L+GV    +++  VN+ M++    + GN      L L    L G   G       +
Sbjct: 558 LGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGN------LQLGAEVLSGATAGACQVVFTN 611

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPL---DCIKKLTANNSLMRGLTPTMLRESHGCGVYFL 196
           P+E V+IRLQ ++    A      L     IK+L     L +G+   +LR+     +YF 
Sbjct: 612 PLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLI-GLYKGVGACLLRDVPFSAIYFP 670

Query: 197 TYEALIAN----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ 252
           TY  L  N    + +    R  + TW+L   GA +G     +  P DVIK+ +Q +  + 
Sbjct: 671 TYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVG 730

Query: 253 PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
             +   +L   +TI       SFFKG    ++R++P  G T A +EL
Sbjct: 731 ETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYEL 777

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT-----SSVPTTALDVVKKLVKNEGF 73
           D  + ++ L AG   GV    +  PFD  K RLQ       +  T  L  V+ ++K E F
Sbjct: 691 DRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESF 750

Query: 74  RGFYKG 79
           R F+KG
Sbjct: 751 RSFFKG 756

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 97.1 bits (240), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 128/297 (43%), Gaps = 39/297 (13%)

Query: 29  AGTAGGVSQVLIGQPFDTTKVRLQ----TSSVP------------TTALDVVKKLVKNEG 72
           AG   GVS++L+  P D  K R+Q    T   P            T  +D + K+VK EG
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEG 76

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
           F   YKG  +P++      +++F  N+  + F+  +     PN  +        G + G 
Sbjct: 77  FSHLYKGITSPILMEAPKRAIKFSGNDTFQTFY--KKIFPTPNGEMTQKIAIYSGASAGA 134

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRE-- 187
             +F+ +P E V+IRLQ        +QF  P++ +K         SL  GL  T+ R   
Sbjct: 135 VEAFVVAPFELVKIRLQD-----VNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVL 189

Query: 188 --SHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVM 245
             +   G+ F   + L A +     +R+++      + GA  GT   L+  P DV+KS +
Sbjct: 190 WNAGYFGIIFQIRKLLPAAKTSTEKTRNDL------IAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 246 QTDSLLQPKQGKNM-LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAM 301
           Q  S   P +  N  L     +Y   G  + +KGF P ++R AP  G     F   M
Sbjct: 244 QRSS--GPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVM 298

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 5/71 (7%)

Query: 14  LDGAHDST-RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP----TTALDVVKKLV 68
           L  A  ST +   DL+AG  GG    L+  PFD  K R+Q SS P      +L  V  + 
Sbjct: 205 LPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPSVLLVY 264

Query: 69  KNEGFRGFYKG 79
           + EGF+  YKG
Sbjct: 265 REEGFKALYKG 275

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 79/200 (39%), Gaps = 30/200 (15%)

Query: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGA----------AAQFHGPL 164
           N  L  +  +  G   G +   +  P++ V+ R+Q Q  T               + G +
Sbjct: 6   NRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVM 65

Query: 165 DCIKKLTAN---NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIP----- 216
           DC+ K+      + L +G+T  +L E+    + F        N+  +   +   P     
Sbjct: 66  DCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFS------GNDTFQTFYKKIFPTPNGE 119

Query: 217 -TWKLCLF-GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSS 274
            T K+ ++ GA++G     ++ P +++K  +Q  +     Q K  ++V K      G+ S
Sbjct: 120 MTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVN----SQFKTPIEVVKNSVVKGGVLS 175

Query: 275 FFKGFGPTMLRAAPANGATF 294
            F G   T+ R    N   F
Sbjct: 176 LFNGLEATIWRHVLWNAGYF 195

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 75/174 (43%), Gaps = 7/174 (4%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85
           + +G + G  +  +  PF+  K+RLQ  +S   T ++VVK  V   G    + G    + 
Sbjct: 126 IYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIW 185

Query: 86  GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVR 145
                 +  FG+   +++   +    +   +T   L   + G  GGT    L +P + V+
Sbjct: 186 RHVLWNAGYFGIIFQIRKLLPA--AKTSTEKTRNDL---IAGAIGGTVGCLLNTPFDVVK 240

Query: 146 IRLQTQTGTGAAAQFHGP-LDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTY 198
            R+Q  +G      +  P +  + +     +L +G  P ++R + G G+  + +
Sbjct: 241 SRIQRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVF 294

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 99.4 bits (246), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 129/287 (44%), Gaps = 32/287 (11%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTS---SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           G+  G     +  P D  K R+Q     S    ++D   K+   EG RG Y G    L+G
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIG 584

Query: 87  VGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYY---LCGFAGGTANSFLASPIEH 143
           V    +++  VN+ M+     ++ N         L++Y   L G   G       +P+E 
Sbjct: 585 VAPEKAIKLTVNDYMRGRLMDKHAN---------LKWYFEILSGACAGACQVVFTNPLEV 635

Query: 144 VRIRLQTQT---GTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEA 200
           V+IRLQ ++   G    +Q    L  IK+L     L +G+   ++R+     +YF TY  
Sbjct: 636 VKIRLQVRSEYAGDVLKSQV-TALGVIKQLGIK-GLYKGIAACLMRDVPFSAIYFPTYAH 693

Query: 201 LIAN----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG 256
           L  +    +      R+++ TW+L + G  +G     +  P DVIK+ +Q D    P++G
Sbjct: 694 LKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID----PRKG 749

Query: 257 KN----MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
           +     +   A+TI       SFFKG    +LR++P  G T A +E+
Sbjct: 750 ETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEI 796

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 79/194 (40%), Gaps = 17/194 (8%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSS--------VPTTALDVVKKLVK 69
           H + + + ++L+G   G  QV+   P +  K+RLQ  S           TAL V+K+L  
Sbjct: 607 HANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL-- 664

Query: 70  NEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKR-FFHSRNGNSGPNETLGLLQYYLCGF 128
             G +G YKG    L+      ++ F     +K+  F     +      L   +  + G 
Sbjct: 665 --GIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGG 722

Query: 129 AGGTANSFLASPIEHVRIRLQTQTGTGAAAQ---FHGPLDCIKKLTANNSLMRGLTPTML 185
             G   ++L +P + ++ RLQ     G       FH     +K+  +  S  +G +  +L
Sbjct: 723 LAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKE-ESFKSFFKGGSARVL 781

Query: 186 RESHGCGVYFLTYE 199
           R S   G     YE
Sbjct: 782 RSSPQFGFTLAAYE 795

>Scas_691.4
          Length = 334

 Score = 97.1 bits (240), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 127/307 (41%), Gaps = 35/307 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV-----PTTALDVVKKLVKNEGFRGFYKGT 80
           +L+AG   G+ + L   P DT KVR+Q +       P   +   + +  +EGF   YKG 
Sbjct: 16  NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGL 75

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA-S 139
              ++G+   ++++F   E     F+          T+     +L G   G   + L  +
Sbjct: 76  GAVVIGIIPKMAIRFSSYE-----FYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVN 130

Query: 140 PIEHVRIRLQTQ--------------TGTGA-------AAQFHGPLDCIKKLTANNSLMR 178
           P+E V+IRLQ Q               GT A       A   H     +K+  A  +L R
Sbjct: 131 PMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAG-ALYR 189

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPL 238
           G++ T  R++   G  F  Y  L  + L K  +R  +P+W+    G  SG        PL
Sbjct: 190 GVSLTAARQATNQGANFTVYSYL-KDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPL 248

Query: 239 DVIKSVMQTDSLLQPKQG-KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           D IK+ +Q D  +      K +  +   +    G  + +KG  P ++R AP    TF  +
Sbjct: 249 DTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVY 308

Query: 298 ELAMRVL 304
           E   + L
Sbjct: 309 EFVRKHL 315

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 12/97 (12%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQ------TSSVPTTALDVVKKLVKNEGFRGFYKGT 80
           L++G  G  S      P DT K RLQ      ++S       +  +L+K EGFR  YKG 
Sbjct: 235 LISGAIGPFSNA----PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGI 290

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRN--GNSGPN 115
              ++ V    +V F V E +++   + N  G SGP+
Sbjct: 291 TPRVMRVAPGQAVTFTVYEFVRKHLETLNFFGGSGPS 327

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 95.9 bits (237), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 128/286 (44%), Gaps = 28/286 (9%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTK--VRLQTS--SVPTT--ALDVVKKLVKNEGFRGFYKG 79
             +AG   GVS++L+  P D  K  ++LQ S  S P      D +K++   EG    YKG
Sbjct: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
             +P++      + +F  N+  ++ +    G     + L +L     G + G   SF+  
Sbjct: 72  ISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSIL----SGASAGICESFVVV 127

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESHG---CGV 193
           P E V+IRLQ       +++F  P+  +K +     ++    GL  TM R  HG    G 
Sbjct: 128 PFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNAGY 180

Query: 194 YFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ- 252
           + + ++  +   L K  ++SE  T    L G   GT   L+  P DV+KS +Q  +++  
Sbjct: 181 FGIIFQ--VRALLPKASTKSE-QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237

Query: 253 -PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
            P++         TIY   G  + +KGF P +LR  P  G     F
Sbjct: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 91/198 (45%), Gaps = 11/198 (5%)

Query: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLV 68
           I  DL GA   T+    +L+G + G+ +  +  PF+  K+RLQ  SS  T+ + VVK +V
Sbjct: 96  IYKDLFGAEKLTQPL-SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIV 154

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128
           + EG    Y G  + +   G   +  FG+   ++      +  S   +T   L   L G 
Sbjct: 155 EKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKS--EQTRNDL---LAGT 209

Query: 129 AGGTANSFLASPIEHVRIRLQTQT---GTGAAAQFHGP-LDCIKKLTANNSLMRGLTPTM 184
            GGT +S L++P + V+ R+Q      G      +  P L  I K     +L +G  P +
Sbjct: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269

Query: 185 LRESHGCGVYFLTYEALI 202
           LR   G G+  + +  ++
Sbjct: 270 LRLGPGGGILLVVFTGVM 287

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 82/184 (44%), Gaps = 10/184 (5%)

Query: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN- 173
            + L  +  ++ G   G +   +  P++ V+  +Q Q   G+  Q+ G  DC+K++ A  
Sbjct: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63

Query: 174 --NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLF-GATSGTT 230
             + L +G++  +L E+      F   +     +++K +  +E  T  L +  GA++G  
Sbjct: 64  GPSRLYKGISSPILMEAPKRATKFACNDEF--QKIYKDLFGAEKLTQPLSILSGASAGIC 121

Query: 231 LWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPAN 290
              ++ P +++K  +Q  S     +  + + V K I    G+ + + G   TM R    N
Sbjct: 122 ESFVVVPFELVKIRLQDVS----SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177

Query: 291 GATF 294
              F
Sbjct: 178 AGYF 181

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 20  STRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVP------TTALDVVKKLVKNEG 72
           S +   DLLAGT GG    L+  PFD  K R+Q T+ +P        +   +  + K EG
Sbjct: 198 SEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEG 257

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           F+  YKG +  ++ +G    +   V   +  FF +
Sbjct: 258 FKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 128/295 (43%), Gaps = 25/295 (8%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---------ALDVVKKLVKNEGFRGFYK 78
           ++G   G+   ++  P D  K RLQ   + T          ++  +  +V++EG RG YK
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G +  ++G      + F V E  K    + + N         + +       G  ++ + 
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSN------WSFVSHSFSAITAGAVSTVVT 186

Query: 139 SPIEHVRIRLQTQTGTGA-AAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194
           +PI  V+ RL  QT  G+    + G  D  KK+       +L  GL P++L   H   ++
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLH-VAIH 245

Query: 195 FLTYEALIAN----ELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL 250
           F  YE L  +    +  +  + S+I   +L L  + S     ++ YP +++++ +Q  S 
Sbjct: 246 FPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSD 305

Query: 251 LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
           L P   + ++ + K  Y   G+  F+ GFG  + R  PA+  T  +FE     L 
Sbjct: 306 L-PSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLN 359

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 94.0 bits (232), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 124/293 (42%), Gaps = 29/293 (9%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVK---------KLVKNEGFRGF 76
           +L+AG   G+ + L   P DT KVR+Q      +AL+ +K          +   EG    
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYR--RSALEGIKPPGFIKTGRNIYTEEGLLAL 70

Query: 77  YKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSF 136
           YKG    ++G+   ++++F   E  +     +   S     +     +L G   GT  + 
Sbjct: 71  YKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGS-----VSTGNTFLAGVGAGTTEAV 125

Query: 137 LA-SPIEHVRIRLQTQ---TGTGAAAQFHGPLDC---IKKLTANNSLMRGLTPTMLRESH 189
           L  +P+E V+IRLQ Q     T A+ ++   L     I K     +L RG++ T  R++ 
Sbjct: 126 LVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQAT 185

Query: 190 GCGVYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQT 247
             G  F  Y  L     E HK      +P+W+    G  SG        PLD IK+ +Q 
Sbjct: 186 NQGANFTVYSKLKEFLQEHHK---TDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK 242

Query: 248 DSLLQPKQG-KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
           D       G   ++ + K +    G  + +KG  P ++R AP    TF  +E 
Sbjct: 243 DKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTS------SVPTTALDVVKKLVKNEGFRGFYKGT 80
           L++G  G  S      P DT K RLQ        S  +  + + K+L+K EGFR  YKG 
Sbjct: 220 LISGAIGPFSNA----PLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGI 275

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQ 122
              ++ V    +V F V E ++             ETLG+ +
Sbjct: 276 TPRVMRVAPGQAVTFTVYEFVREHL----------ETLGIFK 307

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 130/296 (43%), Gaps = 33/296 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT--------ALDVVKKLVKNEGFRGFY 77
             ++G A GVS++L+  P D  K R+Q      T         +D + ++VK EGF   Y
Sbjct: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLY 70

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           KG  +P++      + +F  N++ ++ F    G     + + +L     G   G   + +
Sbjct: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS----GSLAGVTEACV 126

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194
             P E V+IRLQ        ++F+GP++ + K        SL  GL  TM R +   G Y
Sbjct: 127 IVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181

Query: 195 F-LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYP-LDVIKSVMQT----- 247
           F + ++  I   L K  + +E  T  L + G   G   +   +  L V+KS +Q+     
Sbjct: 182 FGVIFQ--IRALLPKAKTNTEKTTNDL-IAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238

Query: 248 --DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAM 301
             D  + PK       + K IYS  G ++ +KGF P +LR  P  G     F   M
Sbjct: 239 LADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMM 293

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 88/183 (48%), Gaps = 12/183 (6%)

Query: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQ--TGTGAAAQFHGPLDCIKKLTAN-- 173
           L  +  ++ G A G +   +  P++ V+ R+Q Q  +GTG+   ++G +DC+ ++     
Sbjct: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREG 65

Query: 174 -NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLF-GATSGTTL 231
            + L +G++  ML E+      F   ++    ++ K +   +  T ++ +  G+ +G T 
Sbjct: 66  FSRLYKGISSPMLMEAPKRATKFACNDSY--QKMFKDLYGVDKLTQQISILSGSLAGVTE 123

Query: 232 WLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANG 291
             +I P +++K  +Q    +  K    M  V KTI  T G+ S + G   TM R A  NG
Sbjct: 124 ACVIVPFELVKIRLQD---VNSKFNGPMEVVFKTIRET-GILSLYNGLESTMWRNAFWNG 179

Query: 292 ATF 294
             F
Sbjct: 180 GYF 182

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 81/208 (38%), Gaps = 24/208 (11%)

Query: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLV 68
           +  DL G    T+    +L+G+  GV++  +  PF+  K+RLQ  +S     ++VV K +
Sbjct: 97  MFKDLYGVDKLTQQI-SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI 155

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128
           +  G    Y G  + +          FGV   ++        N+                
Sbjct: 156 RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTN---------DL 206

Query: 129 AGGTANSFLASPIEH-----VRIRLQTQTGTGAA-----AQFHGPLDCIKKLTANN---S 175
             GT   +     EH     V+ R+Q+   T  A      +++     + K+ +     +
Sbjct: 207 IAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTA 266

Query: 176 LMRGLTPTMLRESHGCGVYFLTYEALIA 203
           L +G  P +LR   G G+  + +  ++A
Sbjct: 267 LYKGFIPKILRLGPGGGIMLVVFNGMMA 294

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 39/101 (38%), Gaps = 12/101 (11%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQP-FDTTKVRLQTSSVPTTALDVVK-----------K 66
           ++ +   DL+AGT GG  +           K R+Q+ +  T A   V            K
Sbjct: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257

Query: 67  LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           +   EGF   YKG +  ++ +G    +   V   M  FF  
Sbjct: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 127/293 (43%), Gaps = 27/293 (9%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSS--------VPTTALDVVKKLVKNEGFRGFY 77
           +L+AG   G+ + L   P DT KVR+Q            P   +   + + + EGF   Y
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           KG    ++G+   ++++F   E  +      N  SG    +     ++ G   G   + L
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLL--VNKESG---IVSTGNTFVAGVGAGITEAVL 127

Query: 138 A-SPIEHVRIRLQTQTGT----GAAAQFHGPLDC---IKKLTANNSLMRGLTPTMLRESH 189
             +P+E V+IRLQ Q  T     A  +++  +     I K    ++L RG++ T  R++ 
Sbjct: 128 VVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQAT 187

Query: 190 GCGVYFLTYEALIANELHKGVSRSEI-PTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
             G  F  Y  L   E  +   + ++ P+W+    G  SG        PLD IK+ +Q D
Sbjct: 188 NQGANFTVYSKL--KEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 245

Query: 249 ---SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
              SL +    K ++ +   +    G  + +KG  P ++R AP    TF  +E
Sbjct: 246 KSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 3/79 (3%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQTDSL---LQPKQGKNMLQVAKTIYSTRGLSSFFKGFG 280
           G T+G    L  +PLD IK  MQ       ++  +    ++  +TIY   G  + +KG G
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLG 76

Query: 281 PTMLRAAPANGATFATFEL 299
             ++   P     F+++E 
Sbjct: 77  AVVIGIIPKMAIRFSSYEF 95

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 12/89 (13%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTS-SVPTTALDVVKKLV-------KNEGFRGFYK 78
           L++G  G  S      P DT K RLQ   S+       +KK++       K EGFR  YK
Sbjct: 222 LISGAIGPFSNA----PLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYK 277

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           G    ++ V    +V F V E ++    +
Sbjct: 278 GITPRVMRVAPGQAVTFTVYEYVREHLEN 306

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 122/282 (43%), Gaps = 24/282 (8%)

Query: 32  AGGVSQVLIGQPFDTTKVRLQTSSVPTT--------ALDVVKKLVKNEGFRGFYKGTLTP 83
           AG +S V +  P D  K RLQ   + T          +  +  +V++EG RG YKG +  
Sbjct: 87  AGFLSGVAVC-PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPI 145

Query: 84  LVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEH 143
           ++G      + F V E  K+FFH      G       +         G A++ L +PI  
Sbjct: 146 VLGYFPTWMIYFSVYEFSKKFFH------GIFPQFDFVAQSCAAITAGAASTTLTNPIWV 199

Query: 144 VRIRLQTQTGTGA-AAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYE 199
           V+ RL  Q+  G     + G  D  +KL       +L  GL P++L   H   ++F  YE
Sbjct: 200 VKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-VAIHFPIYE 258

Query: 200 ALIANELH---KGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG 256
            L     H   +  + + I   +L +  + S      + YP +++++ MQ  S +     
Sbjct: 259 DLKV-RFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQ 317

Query: 257 KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           + +  + K  Y+  GL  F+ GF   ++R  PA+  T  +FE
Sbjct: 318 RRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 88.2 bits (217), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 130/295 (44%), Gaps = 24/295 (8%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQT------SSVPTTA-LDVVKKLVKNEGFRGFYK 78
           +L+AG   G+ + L   P DT KVR+Q       S V     +    ++ +NEGF  FYK
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYLCGF-AGGTANSF 136
           G    ++G+   ++++F   E  +     +  G      T      ++ G  AG T    
Sbjct: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNT------FIAGVGAGITEAVV 126

Query: 137 LASPIEHVRIRLQTQ---TGTGAAAQFHGPLDC--IKKLTANNSLMRGLTPTMLRESHGC 191
           + +P+E V+IRLQ Q      GA    +    C  I K    ++L RG++ T  R++   
Sbjct: 127 VVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186

Query: 192 GVYFLTYEALIANELHKGVSRSE-IPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL 250
           G  F  Y  L   E  +G    E +P+W+  L G  SG        PLD IK+ +Q D  
Sbjct: 187 GANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244

Query: 251 LQPKQG-KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
            +   G K +  + K +    G  + +KG  P ++R AP    TF  +E   + L
Sbjct: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299

>Scas_640.25
          Length = 306

 Score = 85.1 bits (209), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 128/299 (42%), Gaps = 35/299 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTA------LDVVKKLVKNEGFRG 75
             +AG   G+S++++  P D  K R+Q    T +   +A      +D + ++VK EG   
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135
            YKG  +P++      +V+F  N+   + + S  G     + + +    L G + G   +
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV----LSGASAGITEA 131

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHG-- 190
            +  P E V+IRLQ        ++F GP++ +K +   +    L  G+  T+ R +    
Sbjct: 132 LVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186

Query: 191 --CGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
              GV F   E L   +  +  +R++     LC  G   GT   +   P DV+KS +Q+D
Sbjct: 187 GYFGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSRIQSD 240

Query: 249 --SLLQPKQGKNM-LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
              ++   +  N        IY   G  + +KGF P +LR  P        F   M V 
Sbjct: 241 GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 84/193 (43%), Gaps = 15/193 (7%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPL 84
            +L+G + G+++ L+  PF+  K+RLQ  +S     ++V+K ++K +G +G Y G  + +
Sbjct: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178

Query: 85  VGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLC-GFAGGTANSFLASPIEH 143
                  +  FGV       F  R             +  LC GF GGT      +P + 
Sbjct: 179 WRNAVWNAGYFGV------IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232

Query: 144 VRIRLQTQTG--TGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTY 198
           V+ R+Q+          +++     + K+       +L +G  P +LR   G  V  + +
Sbjct: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

Query: 199 EAL--IANELHKG 209
             +  +  E H+G
Sbjct: 293 TNVMNVFREFHEG 305

>Kwal_47.18216
          Length = 333

 Score = 85.5 bits (210), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 125/326 (38%), Gaps = 59/326 (18%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA-------LDVVKKLVKNEGFRGFYK 78
           +L+AG   G+ + L   P DT KVR+Q  S            +   + +   EGF   YK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRN------GNSGPNETLGLLQYYLCGF-AGG 131
           G    ++G+   ++++F   E  +     R       GN+           ++ G  AG 
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNT-----------FVAGVGAGI 121

Query: 132 TANSFLASPIEHVRIRLQTQ-----------------------------TGTGAAAQFHG 162
           T    + +P+E V+IRLQ Q                                 A  ++  
Sbjct: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRN 181

Query: 163 PLDC---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWK 219
            +     I K     +L RG++ T  R++   G  F  Y  L  + L +      +P+W+
Sbjct: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWE 240

Query: 220 LCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG-KNMLQVAKTIYSTRGLSSFFKG 278
             L G  SG        PLD IK+ +Q D       G   +L + + +    G  + +KG
Sbjct: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300

Query: 279 FGPTMLRAAPANGATFATFELAMRVL 304
             P ++R AP    TF  +EL  + L
Sbjct: 301 ITPRVMRVAPGQAVTFTVYELIRKKL 326

>Scas_589.10
          Length = 316

 Score = 83.2 bits (204), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 121/301 (40%), Gaps = 47/301 (15%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ---------TSSVP-------TTALDVVKKLVK 69
             ++G   G+S+ ++  P D  K R Q         TSSV        ++ L  + K++K
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 70  NEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFA 129
            EGF+  YKG   PL+      +V+F  NE  ++    +        T+ L    L G  
Sbjct: 76  EEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTL----LAGTF 131

Query: 130 GGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLR 186
            G   S +  P E V+IRLQ      A + +  P+ C + +  N  L     G   T+ R
Sbjct: 132 AGITESLIVVPFELVKIRLQ-----DAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWR 186

Query: 187 ESHGCGVYFLTYEALIANELHKGVSRSEIPT-----WKLCLFGATSGTTLWLMIYPLDVI 241
            +    ++  +Y  LI  ++ K + R++  T         L GA +G     +  P DV+
Sbjct: 187 NT----IWNASYFGLIF-QVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVV 241

Query: 242 KSVMQTDSLLQPKQGKNM-----LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           K+ MQ       K    M      Q    IY T G+   +KG  P + R  P  G     
Sbjct: 242 KTRMQGSK----KTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVV 297

Query: 297 F 297
           F
Sbjct: 298 F 298

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 84/186 (45%), Gaps = 9/186 (4%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85
           LLAGT  G+++ LI  PF+  K+RLQ + S   + +   + +++N+G  G Y G  + + 
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIW 185

Query: 86  GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVR 145
                 +  FG+   +K+F       +   +  G+   +L G   G  + FL+ P + V+
Sbjct: 186 RNTIWNASYFGLIFQVKKFIPRAKSTT---KFQGIRNDFLVGAIAGCMSCFLSVPFDVVK 242

Query: 146 IRLQTQTGTGAAAQFHGPLDC---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALI 202
            R+Q    T +   +         I +      + +G+ P + R   G G+  + +  + 
Sbjct: 243 TRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGV- 301

Query: 203 ANELHK 208
            NEL +
Sbjct: 302 -NELFR 306

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQ---------TDSLLQPKQGKN--MLQVAKTIYSTRGL 272
           GA +G +  +M+YPLDV+K+  Q         T S+  PKQ ++  +L     I    G 
Sbjct: 20  GAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGF 79

Query: 273 SSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
            + +KG  P +L   P     FA+ E   +++
Sbjct: 80  KNLYKGMSPPLLMEVPKRAVKFASNEQFQQIM 111

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 12/88 (13%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT------ALDVVKKLVKNEGFRGFYKG 79
           D L G   G     +  PFD  K R+Q S   ++      A   V  + + EG +G YKG
Sbjct: 220 DFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKG 279

Query: 80  TLTPLV-----GVGACVSVQFGVNEAMK 102
            L P++     G G  + V  GVNE  +
Sbjct: 280 IL-PIICRYGPGGGLLLVVFNGVNELFR 306

>Scas_662.12
          Length = 308

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 130/307 (42%), Gaps = 32/307 (10%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALD------VVKKLVKNE 71
           H+ T + K++++G + G    LI  P D  KVRLQ  +  TT         ++ +L+ N 
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 72  G-----------FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
                        +  Y+G    L+G     S+ F +  + K +    N     N T+ L
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFL 121

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQT---GTGAAAQFHGPLDCIKKLTANNSLM 177
                 G   G + + L +P+  ++ R+ + +        +  HG    + K     ++ 
Sbjct: 122 ----TSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTK-EGPKAIW 176

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIAN---ELHKGVSRSEIPTWKLCLFGATSGTTLWLM 234
            GL P++L  S G  +YF+ Y+ L  +    L+K    +     K+ L  + S     + 
Sbjct: 177 MGLLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMS 235

Query: 235 IYPLDVIKSVMQTDSLLQ---PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANG 291
           +YP  ++KS +QT   +    P+   + + + + IY   G+   +KG    +LRA P+  
Sbjct: 236 VYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTC 295

Query: 292 ATFATFE 298
            TF  +E
Sbjct: 296 ITFCIYE 302

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 135/296 (45%), Gaps = 30/296 (10%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---PTTALDVVKKLVKN-----EGFRGF 76
           K++++G   G    ++  P D  K+RLQ +++   P++  + V++++K+     +  +  
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 77  YKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSG------PNETLGLLQYYLCGFAG 130
           Y+G    ++G      + FG+    K   +S +           +  +    Y +   A 
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 131 GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL---MRGLTPTMLRE 187
           G A + L +P+  ++ R+ +   T ++  +   L+ I ++     L    RGL P++   
Sbjct: 134 GLATALLTNPMWVIKTRIMS---TKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLFGV 190

Query: 188 SHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMI-----YPLDVIK 242
           + G  +YF  Y+ L    LH    R++I   +L         +L  MI     YPL ++K
Sbjct: 191 TQGA-LYFAIYDTLKLKYLH---DRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLK 246

Query: 243 SVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           + +QT    +  +   M  + ++I+ T G++ F+KG    ++RA P+   TF  +E
Sbjct: 247 TNLQTFRT-EHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 7/94 (7%)

Query: 216 PTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL-LQPKQGKNMLQVAKTIYSTRG--- 271
           P  K  + G T+GT   ++ +PLD+IK  +Q  ++ L+P    N  QV + I    G   
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYN--QVQRIIKDGSGTQQ 68

Query: 272 -LSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
            L   ++G G  ++  A A G  F  +  +  V+
Sbjct: 69  LLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVV 102

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 24/66 (36%), Gaps = 4/66 (6%)

Query: 43  PFDTTKVRLQTSSVPTTALDVVKKLVKN----EGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           P    K  LQT          +  L+++     G  GFYKG    LV       + FGV 
Sbjct: 241 PLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

Query: 99  EAMKRF 104
           E  K  
Sbjct: 301 EHFKHI 306

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 126/320 (39%), Gaps = 54/320 (16%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSS---------VPTTALDV 63
           D +   ++  +   L AG   G+ +  I  P D  K R+Q  S         +P+  L  
Sbjct: 7   DYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQ 66

Query: 64  VKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQY 123
           + K+   EG    +KG  + ++G G   +V F   E  K    SR  +    +T   L+ 
Sbjct: 67  IAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCK----SRLIDPEDRQTHQPLKT 122

Query: 124 YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPT 183
            L G     A   L +P + ++ RLQ             P D + K              
Sbjct: 123 ALSGTLATVAADALMNPFDTIKQRLQLH-----------PSDSMTKCAVR---------- 161

Query: 184 MLRESHGCGVYFLTYEALIANEL---------HKGVSRSEIPT-----WKLCLFGATSGT 229
            + +  G   +F +Y   IA  +         ++  ++   P+     W  CL G  SG 
Sbjct: 162 -MYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNPWIHCLCGGISGA 220

Query: 230 TLWLMIYPLDVIKSVMQ---TDSLLQP--KQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
           T   +  PLD +K+V+Q    DS+     K+     + A  I+ T G S FF+G  P ++
Sbjct: 221 TCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRII 280

Query: 285 RAAPANGATFATFELAMRVL 304
              PA   ++ ++E A  +L
Sbjct: 281 SNMPATAISWTSYEFAKHLL 300

>Kwal_23.4731
          Length = 314

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 136/308 (44%), Gaps = 32/308 (10%)

Query: 17  AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---LDVVKKLVKNEG- 72
           A D T + ++++AG A G    +   P D  K+RLQ     T +    +V+K ++++   
Sbjct: 7   ASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKA 66

Query: 73  ----FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR---------NGNSGPNETLG 119
               FR  Y+G    L+G      + FG+    K   +             +   ++ +G
Sbjct: 67  DSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMG 126

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSL 176
              Y       G   + L +PI  ++ R+ + T + A+ ++    D I+K+ A+   +  
Sbjct: 127 PSLYLASAALSGLGTAILTNPIWVIKTRIMS-TSSQASERYKTTWDGIRKVYAHEGFSGF 185

Query: 177 MRGLTPTMLRESHGCGVYFLTYEALIANEL-HKGVSRSEIPTWKLCLFGATSGTTLWLM- 234
            RGL P++   + G  +YF  Y++L       +G++  E    K+      + T++  M 
Sbjct: 186 WRGLVPSLFGVAQGA-IYFTIYDSLRHQYFARRGITEDE----KMGNLENIAITSVSKML 240

Query: 235 ----IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPAN 290
               +YP  ++KS +Q+ + ++ +       + K+I+   GL   +KG    +LRA P+ 
Sbjct: 241 SVTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPST 300

Query: 291 GATFATFE 298
             TF  +E
Sbjct: 301 CITFCIYE 308

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 128/309 (41%), Gaps = 35/309 (11%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALD-----VVKKLVKNEG 72
           H  T + K++++G + G    L+  P D  KVRLQ S+            V+K+++++  
Sbjct: 4   HQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSA 63

Query: 73  FRG------FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL------ 120
             G       Y+G    L G      V FG+    K   +      G  +  G+      
Sbjct: 64  NSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKM 123

Query: 121 --LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---S 175
             L Y   G + G   + L +PI  ++ R+ + T  GA   +    + +++L   +    
Sbjct: 124 NSLIYLSAGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 176 LMRGLTPTMLRESHGCGVYFLTYEALIANELHK------GVSRSEIPTWKLCLFGATSGT 229
           L +GL P +   S G  +YF  Y+ L   +L +       +  + + T ++   G     
Sbjct: 183 LWKGLVPALFGVSQGA-LYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSV 241

Query: 230 TLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPA 289
           TL   +YP  ++KS +Q  S    +Q   +  + K I +  G    +KG    ++RA P+
Sbjct: 242 TL---VYPFQLLKSNLQ--SFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPS 296

Query: 290 NGATFATFE 298
              TF  +E
Sbjct: 297 TCITFCVYE 305

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 33  GGVSQVLIGQPFDTTKVRLQTSSVPTTALDV---VKKLVKNEGFRGFYKGTLTPLVGVGA 89
           G +  V +  PF   K  LQ+         +   +K ++ N+GF G YKG    LV    
Sbjct: 236 GKMVSVTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIP 295

Query: 90  CVSVQFGVNEAMK 102
              + F V E +K
Sbjct: 296 STCITFCVYENLK 308

>Kwal_55.20868
          Length = 380

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 131/312 (41%), Gaps = 39/312 (12%)

Query: 22  RVFKDL-LAGTAGGVSQVLIGQ---PFDTTKVRLQTSSVPTTALDVVK-------KLVKN 70
           R F D  +   +G ++  L G    P D  K RLQ   + +   +  K        ++++
Sbjct: 70  RSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRD 129

Query: 71  EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPN--ETLGLLQYYLCGF 128
           EG RG YKG +  ++G      + F V E  K+ +        P    +   + +     
Sbjct: 130 EGARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLY--------PRIFPSFDFISHSASAL 181

Query: 129 AGGTANSFLASPIEHVRIRLQTQTGTGA-AAQFHGPLDCIKKLTANNSL---MRGLTPTM 184
             GT ++ L +P+  V+ RL  QT     +  +    D   K+     L     GL P++
Sbjct: 182 TAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSL 241

Query: 185 LRESHGCGVYFLTYEALIANELH--KGVSRSE---IPTWKLCLFGATSGTTLWLMIYPLD 239
           L   H   ++F  YE L    LH    +SR+E   +   +L +  + S      + YP +
Sbjct: 242 LGLFH-VAIHFPIYEKLKV-WLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHE 299

Query: 240 VIKSVMQ-----TDSL--LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           ++++ MQ     TD L  LQ      ++++ K  Y + GL  F+ GF   + R  PA+  
Sbjct: 300 ILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAI 359

Query: 293 TFATFELAMRVL 304
           T  +FE   + L
Sbjct: 360 TLVSFEYFRKYL 371

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 12/97 (12%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL------------DVVKKLVKNEGFR 74
           ++A +A  +    +  P +  + R+Q  + PT  L             ++K   K+EG R
Sbjct: 281 IIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLR 340

Query: 75  GFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN 111
           GFY G    L       ++     E  +++    N N
Sbjct: 341 GFYSGFTANLARTLPASAITLVSFEYFRKYLTKLNDN 377

>Scas_716.29
          Length = 316

 Score = 79.3 bits (194), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 140/321 (43%), Gaps = 43/321 (13%)

Query: 15  DGAHDS--------TRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-----TSSVPTTAL 61
           DG H++         +V + L+AG+  G+    +  P DT K+RLQ     T   P+  L
Sbjct: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLL 65

Query: 62  DVVKKLVKNE-GFRGFYKGTLTPLVGVGACVSVQFGVNE-AMKRFFHSRNGNSGPNETLG 119
            ++K ++ NE G R F+KG +      G  + V +G  + +   F+++  G +  ++  G
Sbjct: 66  KMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGET--SDMNG 118

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRG 179
            LQ  + G   G  +SF++ P + +R R         ++  HG  + I  +       RG
Sbjct: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRG 177

Query: 180 LTPTMLRESHGCGVYFLTYEA--LIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYP 237
            T +M   +    + F TYE+  +  +E  K    S+   +      + SG T  ++ YP
Sbjct: 178 CTASMFTITLSASILFGTYESIKIYCDEYSK---ESDYTNYLRYSASSISGVTSKMVTYP 234

Query: 238 LDVIKSVMQTDS---------------LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPT 282
           LD I+  +Q  +               + Q  +G + +++   I    GL S ++G   +
Sbjct: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294

Query: 283 MLRAAPANGATFATFELAMRV 303
           + +  P+   +   +E  MR+
Sbjct: 295 LCKTVPSTVVSLWAYETVMRL 315

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 79.7 bits (195), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 131/320 (40%), Gaps = 34/320 (10%)

Query: 5   LPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT----A 60
           L  P  I D     DS   F  L  G AG VS+ ++  PF+  K+ LQ  S  T+     
Sbjct: 8   LEQPNSIKDFL-KQDSNIAF--LAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSYNRGI 63

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
              ++++   EG +G ++G     + +    +VQF V EA K+     NGN+G  E L  
Sbjct: 64  FSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNG-QEQLTN 122

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT------GAAAQFHGPLDCIKKLTAN- 173
            Q    G   G  +     P++ ++ RL  QT          A     P    + L+   
Sbjct: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETY 182

Query: 174 ------NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEI-PTWKLCLF--- 223
                   L RG+ PT L       + F  YE L       GV+ S+  P+WK  L+   
Sbjct: 183 RLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQL----REFGVNSSDAQPSWKSNLYKLT 238

Query: 224 -GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAK---TIYSTRGLSSFFKGF 279
            GA SG     + YP D+++   Q  ++   + G     V     TI    G+S ++KG 
Sbjct: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298

Query: 280 GPTMLRAAPANGATFATFEL 299
              + +  P+   ++  +E+
Sbjct: 299 AANLFKVVPSTAVSWLVYEV 318

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 121/282 (42%), Gaps = 16/282 (5%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQ---TSSVPTTALDVVKKLVKNEGF--RGFYKG 79
           K++++G   G    LI  P D  KVRLQ   TS+      ++  ++V ++    R  Y+G
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
               LVG      + F      K +  + N     ++ L    Y     + G   + L +
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTN 129

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFL 196
           P+  ++ R+ ++  +   +     +  ++ L  N+    L +GL P ++  S G  ++F 
Sbjct: 130 PLWVIKTRMMSKANSDLTS-----MKVLRDLIKNDGVQGLWKGLVPALVGVSQG-ALHFT 183

Query: 197 TYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG 256
            Y+ L    + K     EI   +     + S       +YP  ++KS +Q  S    +  
Sbjct: 184 CYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQ--SFQASEND 241

Query: 257 KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
             +L ++K IYS  GL  F+KG    +LR+ P+   TF  +E
Sbjct: 242 FKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

>Scas_379.2
          Length = 301

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 127/318 (39%), Gaps = 36/318 (11%)

Query: 2   TEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA- 60
           T E+ T   ID  +   DS  +   LLAG   G+ +  +  P D  K R+Q++S  +T+ 
Sbjct: 3   TSEISTAEEID-YEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSN 61

Query: 61  -LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG 119
            L  + K+   EG    +KG  + ++G G   +V F   E  K++           +T  
Sbjct: 62  MLSQMAKISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKD----MQTHQ 117

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN--SLM 177
            L+  L G     A   L +P + ++ R+Q  T T          +  K++  N   S  
Sbjct: 118 PLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTTV-------WNVTKQIYKNEGFSAF 170

Query: 178 RGLTPTMLRESHGCGVY-FLTYEALI-----ANELHKGVSRSEIPTWKLCLFGATSGTTL 231
               PT L  +     + F+ YE+        N+ +  V          CL G  SG T 
Sbjct: 171 YYSYPTTLAMNIPFAAFNFMIYESATKFFNPTNDYNPLVH---------CLSGGLSGATC 221

Query: 232 WLMIYPLDVIKSVMQTD-----SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRA 286
             +  PLD IK+V+Q       SL   K+     +  K IY   G   F++G  P +   
Sbjct: 222 AAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFAN 281

Query: 287 APANGATFATFELAMRVL 304
            PA    +  +E A   L
Sbjct: 282 MPATAIAWTAYECAKHFL 299

>Kwal_0.232
          Length = 274

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 112/285 (39%), Gaps = 33/285 (11%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYK 78
           D +     LLAG A G S  L   P DT K RLQ +               N G+ G Y+
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAG----------GFFANGGYLGVYR 51

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN--SGPNETLGLLQYYLCGFAGGTANSF 136
           G  + +V      S+ F   + MK +      N  +  ++      +     AG  A   
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 137 LASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN-------SLMRGLTPTMLRESH 189
           +  P E ++ R QT     +       L  +KKL  N        +L RG + T++RE  
Sbjct: 112 VRVPAEVIKQRTQTHKSDSS-------LQTLKKLLQNENGEGIRRNLYRGWSTTVMREIP 164

Query: 190 GCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
              + F  YE L       G  R ++  W+    G  +G        PLDV+K+ +    
Sbjct: 165 FTCIQFPLYEFLKKQWAISG-GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSH 223

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
              P     +L +A+ IY+T G   FF G GP  +  + A GA F
Sbjct: 224 TSVP-----VLHLARQIYATEGWKVFFSGVGPRTVWIS-AGGAIF 262

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 34/88 (38%)

Query: 14  LDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGF 73
           + G  +    ++    G   G        P D  K RL  S      L + +++   EG+
Sbjct: 182 ISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPVLHLARQIYATEGW 241

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAM 101
           + F+ G     V + A  ++  GV E +
Sbjct: 242 KVFFSGVGPRTVWISAGGAIFLGVYETV 269

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 15/77 (19%)

Query: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGP 281
           L GA +GT+  L  +P+D +K+                LQ A   ++  G    ++G G 
Sbjct: 11  LAGAAAGTSTDLFFFPIDTLKT---------------RLQAAGGFFANGGYLGVYRGLGS 55

Query: 282 TMLRAAPANGATFATFE 298
            ++ +AP+    F T++
Sbjct: 56  AVVASAPSASLFFVTYD 72

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 76.6 bits (187), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 132/318 (41%), Gaps = 32/318 (10%)

Query: 2   TEELPT-PLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           T  +P  P+ + D +       ++  L+AG   G+ +  +  P D  K R+Q+++  + +
Sbjct: 11  TRPIPAIPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLS 70

Query: 61  ----LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNE 116
               L  +  +  +EG    +KG  + ++G G   +V FG  E  K+       +S   +
Sbjct: 71  AKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNL----IDSSDTQ 126

Query: 117 TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL 176
           T    +  + G    TA+  L +P + ++ R+Q  T    +A        I +     + 
Sbjct: 127 THHPFKTAISGACATTASDALMNPFDTIKQRIQLNT----SASVWQTTKQIYQSEGLAAF 182

Query: 177 MRGLTPTMLRESHGCGVYFLTYEALI-----ANELHKGVSRSEIPTWKLCLFGATSGTTL 231
                 T++         F+ YE+       +NE +  +          CL G+ SG+T 
Sbjct: 183 YYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIH---------CLCGSISGSTC 233

Query: 232 WLMIYPLDVIKSVM-----QTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRA 286
             +  PLD IK+V+     QT SL   ++     + A  IY   G   F++G+ P ++  
Sbjct: 234 AAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVAN 293

Query: 287 APANGATFATFELAMRVL 304
            PA   ++  +E A   L
Sbjct: 294 MPATAISWTAYECAKHFL 311

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 138/325 (42%), Gaps = 29/325 (8%)

Query: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60
           + + LP P  +  +   +DS   F  L  G AG VS+ ++  PF+  K+ LQ  +  TTA
Sbjct: 4   LAQVLPQPSYVKSIL-KNDSNVAF--LAGGLAGAVSRTVV-SPFERVKILLQVQN-STTA 58

Query: 61  LD-----VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPN 115
            +      V+++ + EG  G ++G     + +    +VQF V EA K+ F   +G+ G  
Sbjct: 59  YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKG-R 117

Query: 116 ETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT------GAAAQFHGP-----L 164
           E L   Q    G   G  +     P++ VR RL  QT          A     P     L
Sbjct: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177

Query: 165 DC--IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCL 222
            C   K+      L RG+ PT L       + F  YE      + +G   +    +KL +
Sbjct: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKLSI 236

Query: 223 FGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG---KNMLQVAKTIYSTRGLSSFFKGF 279
            GA SG     + YP D+++   Q  ++   + G   K+++    TI  T G   ++KG 
Sbjct: 237 -GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGL 295

Query: 280 GPTMLRAAPANGATFATFELAMRVL 304
              + +  P+   ++  +E+   ++
Sbjct: 296 TANLFKVIPSTAVSWLVYEVVCDLM 320

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--------PTTALDVVKKLVKNEGFRG 75
           +K  +   +GGV+Q  +  PFD  + R Q  ++          + +D +  + K EGFRG
Sbjct: 232 YKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFH 106
           +YKG    L  V    +V + V E +    H
Sbjct: 291 YYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 130/294 (44%), Gaps = 22/294 (7%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSS---VPTTALDVVKKLVKNEGF- 73
           H+ T + +++++G   G    +   P D  K+RLQ S+     TT   +++ + + + + 
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWG 62

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGP----NETLGLLQYYLCGFA 129
           R  Y+G    L+G     ++ FG     K       GN       +  L    Y L   +
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 130 GGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLR 186
            G A + L +PI  ++ R+     T  A  +    D + KL     ++   RG+ P++L 
Sbjct: 123 SGIATAVLTNPIWVIKTRIM---ATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLG 179

Query: 187 ESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM--IYPLDVIKSV 244
            S G  +YF  Y+ L  + LH    ++E       + G T  + +  +  +YP  ++KS 
Sbjct: 180 VSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSK 238

Query: 245 MQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           +Q      P     + Q+ +T+YS  G+  F++G    +LRA PA   TF  +E
Sbjct: 239 LQ--DFGAPS---GITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 43  PFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           PF   K +LQ    P+    +V+ +   EG RGFY+G    L+       + F V E +K
Sbjct: 231 PFQLLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 123/326 (37%), Gaps = 55/326 (16%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ--------------------------------- 52
           +L+AG   G+ + L   P DT KVR+Q                                 
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 53  TSSV-PTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN 111
           T+++ P   +   + +   EGF   YKG    ++G+   ++++F   E  +     +   
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQTG 133

Query: 112 SGPNETLGLLQYYLCGFAGGTANSFLA-SPIEHVRIRLQTQ----TGTGAAAQFHGPLDC 166
                 +     ++ G   G   + L  +P+E V+IRLQ Q        A  ++   +  
Sbjct: 134 -----VVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQA 188

Query: 167 ---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEAL--IANELHKGVSRSEIPTWKLC 221
              I K    ++L RG++ T  R++   G  F  Y  L     E H       +P+W+  
Sbjct: 189 GYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYH---GTETLPSWETS 245

Query: 222 LFGATSGTTLWLMIYPLDVIKSVMQTD---SLLQPKQGKNMLQVAKTIYSTRGLSSFFKG 278
             G  SG        PLD IK+ +Q D   S       K +  +   +    G  + +KG
Sbjct: 246 CIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKG 305

Query: 279 FGPTMLRAAPANGATFATFELAMRVL 304
             P ++R AP    TF  +E   R L
Sbjct: 306 ITPRVMRVAPGQAVTFTVYEFVRRHL 331

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 81/208 (38%), Gaps = 25/208 (12%)

Query: 9   LIIDDLDGAHDSTRVFKDLLAGTAGGVSQ-VLIGQPFDTTKVRLQTSSVP---------- 57
           L+ D   G   ++  F   +AG   GV++ VL+  P +  K+RLQ   +           
Sbjct: 126 LLADKQTGVVSTSNTF---IAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKY 182

Query: 58  TTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNET 117
           T A+     ++K EG    Y+G               F V   ++ F    +G     ET
Sbjct: 183 TNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGT----ET 238

Query: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT------GAAAQFHGPLDCIKKLT 171
           L   +    G   G    F  +P++ ++ RLQ    T      G     H     +K+  
Sbjct: 239 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKE-E 297

Query: 172 ANNSLMRGLTPTMLRESHGCGVYFLTYE 199
              +L +G+TP ++R + G  V F  YE
Sbjct: 298 GFRALYKGITPRVMRVAPGQAVTFTVYE 325

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 12/89 (13%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT--------TALDVVKKLVKNEGFRGFYK 78
           L++G  G  S      P DT K RLQ     +            +  +L+K EGFR  YK
Sbjct: 249 LISGAIGPFSNA----PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYK 304

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           G    ++ V    +V F V E ++R   +
Sbjct: 305 GITPRVMRVAPGQAVTFTVYEFVRRHLEN 333

>Kwal_27.12081
          Length = 369

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 122/303 (40%), Gaps = 49/303 (16%)

Query: 43  PFDTTKVRLQTSSVPTTALD----------------------VVKKLVKNEGFRGFYKGT 80
           PFD  K RLQ+    +T  +                      ++  L K EGFR  +KG 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
              LVGV    S+ F      K+ +     N      + L+     G+A  TA     +P
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTA----TNP 187

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLT 197
           I  ++ RLQ     G   Q+    DC+K +        L +GL+ + L    G  + +L 
Sbjct: 188 IWLIKTRLQLDKA-GHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGI-LQWLL 245

Query: 198 YEALIANELHKGVSR------------SEIPTWKLCLFGATSGTTLWL---MIYPLDVIK 242
           YE +      + + +             +I  W  C    ++G   +L   + YP +V++
Sbjct: 246 YEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEW--CQRSGSAGLAKFLASIVTYPHEVVR 303

Query: 243 SVMQTDSLLQPK-QGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAM 301
           + ++   L   K +   ++Q  + I    GL+S + G  P +LR  P +   F T+EL +
Sbjct: 304 TRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVI 363

Query: 302 RVL 304
           ++L
Sbjct: 364 KLL 366

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 74.3 bits (181), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 123/298 (41%), Gaps = 31/298 (10%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYK 78
           ++G   G    ++  PFD  K RLQ   +                   + K+EG  G YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G    ++G    + + F V +  +++    + +  P+     L         G  ++   
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKY----SVDIFPHSPF--LSNASSAITAGAISTVAT 156

Query: 139 SPIEHVRIRLQTQTGTGA-AAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194
           +PI  V+ RL  QTG G  +  + G +D  +K+       +L  GL P +L   +   + 
Sbjct: 157 NPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLN-VAIQ 215

Query: 195 FLTYEALIANELHKGVSRS-EIPT-------WKLCLFGATSGTTLWLMIYPLDVIKSVMQ 246
           F  YE L   ++  G S S ++ T        KL L    S      + YP +++++ MQ
Sbjct: 216 FPLYENL---KIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQ 272

Query: 247 TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
             S L     +++L + K  Y   G + F+ GF   ++R  PA   T  +FE + + L
Sbjct: 273 LKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYL 330

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 127/307 (41%), Gaps = 54/307 (17%)

Query: 43  PFDTTKVRLQT------------SSVPTTA-------------LDVVKKLVKNEGFRGFY 77
           PFD  K RLQ+            S  P  A               ++  + +NEGFR  +
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           KG    LVGV    S+ F      K  + S+  N+G      +  + +     G A S  
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIY-SKTLNNGQE---AVWIHLMAAATAGWATSTA 187

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESHGCGVY 194
            +PI  V+ RLQ     G   ++    DC+K +     ++   +GL+ + L    G  + 
Sbjct: 188 TNPIWLVKTRLQLDKA-GTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGI-LQ 245

Query: 195 FLTYEALI-------------ANELHKGVSRSEIPTWKLCLFGATSGTTLW---LMIYPL 238
           ++ YE +               +E+ K  S  +I  W  C    ++G   +   ++ YP 
Sbjct: 246 WVLYEQMKHIIKQRSMEKFGNISEVEKSTS-DKIKEW--CQRSGSAGLAKFVASIITYPH 302

Query: 239 DVIKSVMQTDSLLQPK-QGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           +V+++ ++   L   K +   ++Q  + I    GL+S + G  P +LR  P +   F T+
Sbjct: 303 EVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTW 362

Query: 298 ELAMRVL 304
           EL +R+L
Sbjct: 363 ELVIRLL 369

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 133/303 (43%), Gaps = 38/303 (12%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALD-----VVKKLVKNEGFRGFYK 78
           F   +AG  GG     +  P +  K+ LQ  S  TTA +      VK++ K EG +G ++
Sbjct: 17  FIAFVAGGVGGAVSRTVVSPVERVKILLQVQS-STTAYNGGLVHAVKQVYKEEGVKGLFR 75

Query: 79  GTLTPLVGVGACVSVQFGVNEAMK-RFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           G     + +    +VQ+ V E  K R FH   G SG +E L   +  + G  GG A+  +
Sbjct: 76  GNGINCLRIFPYSAVQYAVYEFCKTRVFHV--GQSG-HEQLRSWERLVGGALGGGASVLV 132

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFH-----------GPLDCIKKLTANN----SLMRGLTP 182
             P++ VR RL  QT     A+ H           G ++ ++++           RG+ P
Sbjct: 133 TYPLDLVRTRLSIQTAN--LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 183 TMLRESHGCGVYFLTYE---ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLD 239
           T L       + F  YE   ALI ++   G     +   KL + GA SG     ++YP D
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFD 245

Query: 240 VIKSVMQTDSLLQPKQGKNMLQVAKTIYST---RGLSSFFKGFGPTMLRAAPANGATFAT 296
           +++   Q  ++ Q + G     VA  +++     GL  ++KG    +++  PA    +  
Sbjct: 246 LLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFV 305

Query: 297 FEL 299
           +EL
Sbjct: 306 YEL 308

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 9   LIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL------- 61
           LI  D D    S    K  +   +GG++Q ++  PFD  + R Q  ++  + L       
Sbjct: 212 LIPHDYDAG--SVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASV 268

Query: 62  -DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFH 106
            D +  + + EG RG+YKG    LV V   ++VQ+ V E +    H
Sbjct: 269 ADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELISENMH 314

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 87/212 (41%), Gaps = 29/212 (13%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---------------PTTALD 62
           H+  R ++ L+ G  GG + VL+  P D  + RL   +                P   ++
Sbjct: 110 HEQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVE 169

Query: 63  VVKKLVKNE-GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFF-HSRNGNSGPNETLGL 120
           +++++ + E G RG+Y+G     +GV   V++ F + E +K    H  +  S     L  
Sbjct: 170 LLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA- 228

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH-----GPLDCIKKLTANNS 175
               +   +GG A + +  P + +R R Q  T   +   F        L  I +      
Sbjct: 229 ----IGAVSGGIAQT-VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRG 283

Query: 176 LMRGLTPTMLRESHGCGVYFLTYEALIANELH 207
             +GLT  +++      V +  YE LI+  +H
Sbjct: 284 YYKGLTANLVKVVPAMAVQWFVYE-LISENMH 314

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 110/274 (40%), Gaps = 20/274 (7%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTP 83
           F  LL+G A G S  L+  P DT K RLQ                 N G++G Y+G  + 
Sbjct: 5   FLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKG----------GFFANGGYKGIYRGLGSA 54

Query: 84  LVGVGACVSVQFGVNEAMK---RFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
           +V      S+ F   + MK   R + S+  + G  + +    + L    G      +  P
Sbjct: 55  VVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVP 114

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEA 200
            E V+ R Q  +   +       L    K     +L RG + T++RE     + F  YE 
Sbjct: 115 AEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEY 174

Query: 201 LIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNML 260
           L      K   +S++  WK  + G+ +G        PLD +K+      L+  K   ++ 
Sbjct: 175 L-KKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKT-----RLMLNKTTASLG 228

Query: 261 QVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
            V   IY   G + FF G GP  +  + A GA F
Sbjct: 229 SVIIRIYREEGPAVFFSGVGPRTMWIS-AGGAIF 261

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 15/77 (19%)

Query: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGP 281
           L GA +GT+  L+ +P+D IK+       LQ K G          ++  G    ++G G 
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKT------RLQAKGG---------FFANGGYKGIYRGLGS 53

Query: 282 TMLRAAPANGATFATFE 298
            ++ +AP     F +++
Sbjct: 54  AVVASAPGASLFFISYD 70

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 117/296 (39%), Gaps = 27/296 (9%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLVKNEGFRGFYKGTLT 82
           L  G AG +S+ ++  PF+  K+ LQ  S  T       D + ++ K E  +G ++G   
Sbjct: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86

Query: 83  PLVGVGACVSVQFGVNEAMKR-FFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPI 141
             + V    +VQF V E  K+  FH      G  E L   Q    G   G  +     P+
Sbjct: 87  NCIRVFPYSAVQFVVFEGCKKHIFHV--DTKGKGEQLNNWQRLFSGALCGGCSVVATYPL 144

Query: 142 EHVRIRLQTQTGT------GAAAQFHGPLDCIKKLTANNS-------LMRGLTPTMLRES 188
           + VR RL  QT          A+    P    K L+   +       L RG+ PT L   
Sbjct: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204

Query: 189 HGCGVYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ 246
               + F  YE L         G S      +KL + GA SG     + YP D+++   Q
Sbjct: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFDLLRRRFQ 263

Query: 247 TDSLLQPKQG---KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
             ++   + G    ++     TI  T G   ++KG    + +  P+   ++  +EL
Sbjct: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 85/209 (40%), Gaps = 25/209 (11%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRL--QTSSV----PTTALDVVK- 65
           D  G  +    ++ L +G   G   V+   P D  + RL  QT+++     + A D+ K 
Sbjct: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172

Query: 66  ----KLVKNE-----GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS-RNGNSGPN 115
               KL+        G  G Y+G     +G+   V++ F V E +K F  S  NGNS   
Sbjct: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232

Query: 116 ETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH-----GPLDCIKKL 170
           ++L  L   +   +GG A + +  P + +R R Q     G    FH       L  I K 
Sbjct: 233 DSLYKLS--MGAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT 289

Query: 171 TANNSLMRGLTPTMLRESHGCGVYFLTYE 199
                  +GLT  + +      V +L YE
Sbjct: 290 EGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 70.5 bits (171), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 110/277 (39%), Gaps = 19/277 (6%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYK 78
           DST     L++G A G S  ++  P DT K RLQ                 N G+RG Y+
Sbjct: 2   DST-FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG----------GFFHNGGYRGIYR 50

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG-LLQYYLCGFAGGTANSFL 137
           G  + +V      S+ F   ++MK+      G    +E L  +L + L    G  +   +
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLV 110

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLT 197
             P E ++ R QT     +       L           L RG   T++RE     + F  
Sbjct: 111 RVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPL 170

Query: 198 YEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGK 257
           YE L   +         +  W+  + G+ +G        PLDV+K+ M       P    
Sbjct: 171 YEYL-KKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP---- 225

Query: 258 NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
            ML +A+T++   G   FF+G GP  +  + A GA F
Sbjct: 226 -MLHLARTLFREEGARVFFRGIGPRTMWIS-AGGAIF 260

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 28/63 (44%)

Query: 43  PFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           P D  K R+         L + + L + EG R F++G     + + A  ++  GV EA+ 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVH 268

Query: 103 RFF 105
             F
Sbjct: 269 SLF 271

>Scas_717.20
          Length = 356

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 123/327 (37%), Gaps = 56/327 (17%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL--------DVVKKLVKNEGFRGFYK 78
           L  G +G  ++ LI  P D  K+  QTS+   T          +  K +  N+G RGF++
Sbjct: 37  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQ 95

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G    L+ +    +V+F   E +      RN      E     +  + G   G  + F  
Sbjct: 96  GHSVTLMRIFPYAAVKFVAYEQI------RNTLIPSKEYESHWRRLMSGSLAGLCSVFTT 149

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL----------------MRGLTP 182
            P++ +R+RL   T     +   G +  I K  A+ +L                 RG TP
Sbjct: 150 YPLDLIRVRLAYVTEHKRISLL-GLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 183 TMLRESHGCGVYFLTYEALI--------------------ANELHKGVSRSEIPTWKLCL 222
           T+L      GV F  ++ L                       E H    R  + TW   L
Sbjct: 209 TVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELL 268

Query: 223 FGATSGTTLWLMIYPLDVIKSVMQTDSL----LQPKQGKNMLQVAKTIYSTRGLSSFFKG 278
            G  +G       YP ++I+  +Q  +L    +   + +++ ++AK IY  RG   FF G
Sbjct: 269 SGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVG 328

Query: 279 FGPTMLRAAPANGATFATFELAMRVLG 305
                ++  P    +F  +E     LG
Sbjct: 329 LSIGYIKVTPMVACSFFVYERMKWHLG 355

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 92/222 (41%), Gaps = 30/222 (13%)

Query: 107 SRNGNSGPNETLGLLQYYLCGFAGGTANSF---LASPIEHVRIRLQTQTG--TGAAAQFH 161
           +R  N  P +   L      G AGG + S    L +P++ ++I  QT     T  A    
Sbjct: 16  TRKRNQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLV 75

Query: 162 GPLDCIKKLTANNSL---MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTW 218
           G  +  K +  N+ +    +G + T++R      V F+ YE  I N L    S+     W
Sbjct: 76  GLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQ-IRNTLIP--SKEYESHW 132

Query: 219 KLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRG------- 271
           +  + G+ +G       YPLD+I+  +   + +   +  ++L + KTIY           
Sbjct: 133 RRLMSGSLAGLCSVFTTYPLDLIRVRL---AYVTEHKRISLLGLVKTIYKEPASTTLEAK 189

Query: 272 ---------LSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
                      +F++G+ PT+L   P  G +F   +L   VL
Sbjct: 190 GYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVL 231

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 22  RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL---------DVVKKLVKNEG 72
           R + +LL+G   G++      PF+  + RLQ S++  + +         ++ K + K  G
Sbjct: 262 RTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           +RGF+ G     + V   V+  F V E MK
Sbjct: 322 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

>Scas_721.27
          Length = 374

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 115/261 (44%), Gaps = 27/261 (10%)

Query: 63  VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQ 122
           ++  + K EGFR  +KG    LVGV    S+ F      K  +     N      + L+ 
Sbjct: 121 ILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMS 180

Query: 123 YYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRG 179
               G+A  TA     +PI  ++ R+Q     G   ++    DC+K +  +     L RG
Sbjct: 181 AATAGWATSTA----TNPIWMIKTRVQLDKA-GTTRKYKNSWDCLKTVLKSEGIYGLYRG 235

Query: 180 LTPTMLRESHGCGVYFLTYEAL--------IANELHKG---VSRSE-IPTWKLCLFGATS 227
           L+ + L    G  + +L YE +        I    H+G    SR+E I  W  C    ++
Sbjct: 236 LSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQRSGSA 292

Query: 228 GTTLWL---MIYPLDVIKSVMQTDSLLQPK-QGKNMLQVAKTIYSTRGLSSFFKGFGPTM 283
           G   ++   + YP +V+++ ++   +   K +   ++Q  + I    GL+S + G  P +
Sbjct: 293 GVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHL 352

Query: 284 LRAAPANGATFATFELAMRVL 304
           +R  P +   F T+EL +R+L
Sbjct: 353 MRTVPNSIIMFGTWELVIRLL 373

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 82/195 (42%), Gaps = 21/195 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT-----ALDVVKKLVKNEGFRGFYKGTL 81
           L++    G +      P    K R+Q     TT     + D +K ++K+EG  G Y+G  
Sbjct: 178 LMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLS 237

Query: 82  TPLVGVGACVSVQFGVNEAMKRFFHSRN----GNSG---PNETLGLLQYYLCGFAGGTAN 134
              +G    + +Q+ + E MK     R+    G+ G    + T  + ++     + G A 
Sbjct: 238 ASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAK 296

Query: 135 SFLAS----PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRE 187
            F+AS    P E VR RL+         ++ G +   + +       S+  GLTP ++R 
Sbjct: 297 -FIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRT 355

Query: 188 SHGCGVYFLTYEALI 202
                + F T+E +I
Sbjct: 356 VPNSIIMFGTWELVI 370

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 32/85 (37%), Gaps = 24/85 (28%)

Query: 237 PLDVIKSVMQTD-----------------------SLLQP-KQGKNMLQVAKTIYSTRGL 272
           P D++K+ +Q+D                       SL+Q     K    +   +Y   G 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 273 SSFFKGFGPTMLRAAPANGATFATF 297
            S FKG GP ++   PA    F T+
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTY 156

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 65/175 (37%), Gaps = 35/175 (20%)

Query: 140 PIEHVRIRLQT---------------------------QTGTGAAAQFHGPLDCIKKLTA 172
           P + V+ RLQ+                           Q GT     F G L  + K   
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETF-GILGNVYKREG 130

Query: 173 NNSLMRGLTPTMLRESHGCGVYFLTY---EALIANELHKGVSRSEIPTWKLCLFGATSGT 229
             SL +GL P ++       + F TY   + + +   + G    E P   L +  AT+G 
Sbjct: 131 FRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNG---QETPLIHL-MSAATAGW 186

Query: 230 TLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
                  P+ +IK+ +Q D     ++ KN     KT+  + G+   ++G   + L
Sbjct: 187 ATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYL 241

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 124/306 (40%), Gaps = 52/306 (16%)

Query: 43  PFDTTKVRLQTSSVPT--------------------------TALDVVKKLVKNEGFRGF 76
           PFD  K RLQ+    T                              ++  + + EGFR  
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 77  YKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSF 136
           +KG    LVGV    S+ F +     +  +SR  N+G       L   L     G A S 
Sbjct: 130 FKGLGPNLVGVIPARSINF-LTYGTTKDIYSRTLNNGQEAPWIHL---LAAATAGWATST 185

Query: 137 LASPIEHVRIRLQ-TQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCG 192
           + +PI  V+ RLQ  + GT     +   LDCIK +  N     L +GL+ + L    G  
Sbjct: 186 VTNPIWLVKTRLQLDKAGTKT---YKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGI- 241

Query: 193 VYFLTYEAL--IANE--------LHKGVSRSEIPTWKLCLFGATSGTTLW---LMIYPLD 239
           + ++ YE +  I  E        +H+    +     + C    ++G   +   ++ YP +
Sbjct: 242 LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHE 301

Query: 240 VIKSVMQTDSLLQPK-QGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           V+++ ++       K +   ++Q  + I    GL S + G  P +LR  P +   F T+E
Sbjct: 302 VVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWE 361

Query: 299 LAMRVL 304
           L +++L
Sbjct: 362 LVIKLL 367

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 75/193 (38%), Gaps = 18/193 (9%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT----TALDVVKKLVKNEGFRGFYKGTLT 82
           LLA    G +   +  P    K RLQ     T     +LD +K +VKNEG  G YKG   
Sbjct: 173 LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

Query: 83  PLVGVGACVSVQFGVNEAMKRFFHSR----------NGNSGPNETLGLLQYYLCGFAGGT 132
             +G    + +Q+ + E MKR    R          +  S  ++     Q          
Sbjct: 233 SYLGSVEGI-LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKF 291

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESH 189
             S +  P E VR RL+         ++ G +   + +       S+  GLTP +LR   
Sbjct: 292 VASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVP 351

Query: 190 GCGVYFLTYEALI 202
              + F T+E +I
Sbjct: 352 NSIIMFGTWELVI 364

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 119/314 (37%), Gaps = 37/314 (11%)

Query: 11  IDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT---------SSVPTTAL 61
           + D +   D   +   L+AG   G+++  +  P D  K RLQ            +P+T L
Sbjct: 6   VIDYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTML 65

Query: 62  DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLL 121
             +  +   EG    +KG  + L+G G   +V F   E +K F      ++         
Sbjct: 66  RQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSK------Y 119

Query: 122 QYYLCGFAGGTAN---SFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
            ++   F+G TA      L +P + ++ R+Q  T            D  K++ +      
Sbjct: 120 HFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNISV-------WDTAKRIYSKEGFQA 172

Query: 179 GLT--PTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPT-WKLCLFGATSGTTLWLMI 235
             +  PT L       + F  +   I +   +  + S +   +  CL G  SG     + 
Sbjct: 173 FYSSYPTTL----AINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAGLT 228

Query: 236 YPLDVIKSVMQTD-----SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPAN 290
            PLD IK+ +Q       S+   KQ     +  + IY   G   F+ G  P +L   PA 
Sbjct: 229 TPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPAT 288

Query: 291 GATFATFELAMRVL 304
             ++  +E A   L
Sbjct: 289 AISWTAYEFAKHFL 302

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 117/294 (39%), Gaps = 34/294 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVK---NEGFRGFYKGTLT 82
            LLAG   G+ +  +  P D  K R+Q+SS       ++K++ K    EG    +KG  +
Sbjct: 19  QLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 83  PLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIE 142
            ++G G   +V F   E    F  S+  +     T   ++  + G A  T    L +P +
Sbjct: 79  VILGAGPAHAVYFATYE----FSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPFD 134

Query: 143 HVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLT------PTMLRESHGCGVYFL 196
            ++ R+Q  T            + +  +T N     G        PT L       + F 
Sbjct: 135 VIKQRMQLNTR-----------ESVWHVTKNIYHKEGFAAFYYSYPTTLV----MNIPFA 179

Query: 197 TYEALIANELHKGVSRS-EIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ-----TDSL 250
            +   I     K ++ S E   +  C+ G  SG T   +  PLD IK+V+Q     T S 
Sbjct: 180 AFNFAIYESATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSN 239

Query: 251 LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
              KQ     + A  IY   G   F +G  P ++   PA   ++ ++E A   L
Sbjct: 240 EIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 84/182 (46%), Gaps = 14/182 (7%)

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPT 183
            FAG   +S L  P++ ++ R+Q+ + +GAA Q  G +  I K+T      +L +G+   
Sbjct: 24  AFAGIMEHSVLF-PVDAIKTRIQS-SSSGAATQ--GLIKQISKITTAEGSLALWKGVQSV 79

Query: 184 MLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKS 243
           +L       VYF TYE   +  +      +  P  K  + G  + T    ++ P DVIK 
Sbjct: 80  ILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPI-KTAISGMAATTVADALMNPFDVIKQ 138

Query: 244 VMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRV 303
            MQ ++       +++  V K IY   G ++F+  +  T++   P     FA +E A + 
Sbjct: 139 RMQLNT------RESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKF 192

Query: 304 LG 305
           + 
Sbjct: 193 MN 194

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 77/205 (37%), Gaps = 17/205 (8%)

Query: 2   TEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL 61
           T E     +ID  D    + +  K  ++G A       +  PFD  K R+Q ++   +  
Sbjct: 93  TYEFSKSKLIDPQD--MHTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTR-ESVW 149

Query: 62  DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLL 121
            V K +   EGF  FY    T LV      +  F + E+  +F         P+      
Sbjct: 150 HVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFM-------NPSNEYNPF 202

Query: 122 QYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQ-------FHGPLDCIKKLTANN 174
            + + G   G   + + +P++ ++  LQ +     + +       F      I K+    
Sbjct: 203 IHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWK 262

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYE 199
             +RGL P ++       + + +YE
Sbjct: 263 GFLRGLKPRVIANMPATAISWTSYE 287

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 110/279 (39%), Gaps = 21/279 (7%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYK 78
           DS+     L +G A G S  L   P DT K RLQ                 N G++G Y+
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFH---SRNGNSGPNETLGLLQYYLCGFAGGTANS 135
           G  + ++      S+ F   ++MK +     S+   S  N+    L +      G  +  
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSN-NQMADTLSHMFSSSIGEVSAC 110

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYF 195
            +  P E ++ R QT     +   F   L          +L RG   T++RE     + F
Sbjct: 111 LVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQF 170

Query: 196 LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255
             YE  +     K   +  +  W+  + G+ +G        PLDV+K+      L+   +
Sbjct: 171 PLYE-FLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKT-----RLMLSHK 224

Query: 256 GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
              + Q+AK IY+  G   FF G GP  +  + A GA F
Sbjct: 225 SIPVAQLAKNIYAEEGFKVFFSGVGPRTMWIS-AGGAIF 262

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 16/80 (20%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTM 283
           GA +GT+  L  +P+D +K+       LQ K G          ++  G    ++G G  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKT------RLQAKGG---------FFANGGYKGVYRGLGSAV 57

Query: 284 LRAAPANGATFATFELAMRV 303
           + +AP+    F +++ +M+V
Sbjct: 58  IASAPSASLFFVSYD-SMKV 76

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 25/59 (42%)

Query: 43  PFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101
           P D  K RL  S        + K +   EGF+ F+ G     + + A  ++  GV E +
Sbjct: 211 PLDVLKTRLMLSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

>Kwal_33.14050
          Length = 314

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 118/308 (38%), Gaps = 54/308 (17%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSS-----------VPTTALDVVKKLVKNEGFRG 75
           L AG   G+ +  I  P D  K R+Q  S           +P+  +  + ++   EG   
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135
            +KG  + ++G G   +V F   E  K +           +T   L+    G A   A  
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDF----QTHQPLKTAASGIAATVAAD 135

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYF 195
            L +P + ++ R+Q +T +                      M  +   + R + G   +F
Sbjct: 136 LLMNPFDTIKQRMQLRTFS-------------------KDRMWSVASRIYR-NEGLAAFF 175

Query: 196 LTYEALIANEL---------HKGVSRSEIPTWKL-----CLFGATSGTTLWLMIYPLDVI 241
            +Y   IA  +         ++  ++   P         CL G  SG T   +  PLD I
Sbjct: 176 YSYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIHCLCGGISGATCAAITTPLDCI 235

Query: 242 KSVMQ---TDSLLQP--KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           K+V+Q   ++S++ P  +Q     + A  I    G S F++G  P ++   PA   ++  
Sbjct: 236 KTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTA 295

Query: 297 FELAMRVL 304
           +E A   L
Sbjct: 296 YECAKHTL 303

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 82/206 (39%), Gaps = 17/206 (8%)

Query: 2   TEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL 61
           T E+    +ID  D    + +  K   +G A  V+  L+  PFDT K R+Q  +     +
Sbjct: 101 TYEMCKSYLIDPQD--FQTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRM 158

Query: 62  -DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
             V  ++ +NEG   F+    T +       +  F + E+  +FF+       P  T   
Sbjct: 159 WSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFFN-------PENTYNP 211

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGA-------AAQFHGPLDCIKKLTAN 173
           L + LCG   G   + + +P++ ++  LQ +            A  F      I K+   
Sbjct: 212 LIHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGW 271

Query: 174 NSLMRGLTPTMLRESHGCGVYFLTYE 199
           +   RGL P ++       + +  YE
Sbjct: 272 SGFWRGLKPRIISNMPATAISWTAYE 297

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 126/319 (39%), Gaps = 37/319 (11%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSS----------------- 55
           D +   D+  +   L+AG   G+ +  I  P D  K R+Q  S                 
Sbjct: 10  DYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAA 69

Query: 56  ----VPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK-RFFHSRNG 110
                  T L  + ++   EG    ++G  + ++G G   +V F   E  K +   +++ 
Sbjct: 70  SGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDF 129

Query: 111 NSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL 170
           N     T   L+  + G A   A   L +P + ++ RLQ Q+ +  ++ +    + I K 
Sbjct: 130 N-----THQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN-IYKN 183

Query: 171 TANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTT 230
               +       T+        + F+ YE+  + +     +      W  CL G  +G T
Sbjct: 184 EGPMAFFYSYPTTLAMNIPFAALNFVIYES--STKFFNPTNAYN--PWIHCLCGGIAGAT 239

Query: 231 LWLMIYPLDVIKSVMQ-----TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLR 285
              +  PLD IK+V+Q     T  +   K      + A+ I+ + G   F++G  P ++ 
Sbjct: 240 CAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVIS 299

Query: 286 AAPANGATFATFELAMRVL 304
             PA   ++ ++E A  +L
Sbjct: 300 NIPATAISWTSYEFAKHLL 318

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 123/320 (38%), Gaps = 64/320 (20%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTS-------------SVPTT--------ALDVVKK 66
           L+G   G    +I  P D  K RLQ               SV TT            +  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 67  LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK----RFFHSRNGNSGPNETLGLLQ 122
           +V++E  RG YKG +  ++G      + F V E  K    R+F++             L 
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSE----------FLS 217

Query: 123 YYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH--GPLDC---IKKLTANNSLM 177
           + +     G  ++ L +PI  V+ RL  Q+G       H    LD    I K+    S  
Sbjct: 218 HSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFY 277

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIA----------NELHKGVSRSEIPTW--------- 218
            GL P++    H   ++F  YE L            N+    V+ +  P           
Sbjct: 278 SGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLG 336

Query: 219 KLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKG 278
           +L +    S      + YP +++++ +Q  S ++P    ++  + +T Y+  G+  F+ G
Sbjct: 337 RLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKP----SIKSIIRTTYAKEGIRGFYSG 392

Query: 279 FGPTMLRAAPANGATFATFE 298
           F   M R  PA+  T  +FE
Sbjct: 393 FLTNMFRTVPASAITLVSFE 412

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 124/320 (38%), Gaps = 56/320 (17%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA--------LDVVKKLVKNEGFRGFYK 78
           L  G +G  ++ LI  P D  K+  QTS+   T         ++  K +  N+G RGF++
Sbjct: 38  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G    L+ +    +V+F   E +      RN      E     +  + G   G  + F+ 
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQI------RNTLIPSKEFESHWRRLVSGSLAGLCSVFIT 150

Query: 139 SPIEHVRIRLQTQT-------GTGAAAQFHGPLDC--IKKLTANN------SLMRGLTPT 183
            P++ VR+RL  +T       G      +  P     IK     N      +  RG  PT
Sbjct: 151 YPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 184 MLRESHGCGVYFLTYEALIA------------------NELHKGVSRSEIP--TWKLCLF 223
           +L      GV F  ++ L                    +EL +   +   P  TW   + 
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELIS 270

Query: 224 GATSGTTLWLMIYPLDVIKSVMQTDSLLQPK-----QGKNMLQVAKTIYSTRGLSSFFKG 278
           G  +G       YP ++I+  +Q  S L PK     + +++ ++A  I+  RG+  FF G
Sbjct: 271 GGLAGMASQTAAYPFEIIRRRLQV-SALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVG 329

Query: 279 FGPTMLRAAPANGATFATFE 298
                ++  P    +F  +E
Sbjct: 330 LSIGYIKVTPMVACSFFVYE 349

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 89/203 (43%), Gaps = 32/203 (15%)

Query: 127 GFAGGTANSF---LASPIEHVRIRLQTQTG--TGAAAQFHGPLDCIKKLTANNSL---MR 178
           G AGG + S    L +P++ ++I  QT     T       G ++  K +  N+ +    +
Sbjct: 37  GLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPT-WKLCLFGATSGTTLWLMIYP 237
           G + T+LR      V F+ YE  I N L   +   E  + W+  + G+ +G     + YP
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQ-IRNTL---IPSKEFESHWRRLVSGSLAGLCSVFITYP 152

Query: 238 LDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRG----------------LSSFFKGFGP 281
           LD+++  +  ++  + K+ K + ++ K IY                      +F++G+ P
Sbjct: 153 LDLVRVRLAYET--EHKRVK-LGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVP 209

Query: 282 TMLRAAPANGATFATFELAMRVL 304
           T+L   P  G +F   +L   VL
Sbjct: 210 TVLGMIPYAGVSFFAHDLLHDVL 232

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 22  RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV-PTTALD--------VVKKLVKNEG 72
           R + +L++G   G++      PF+  + RLQ S++ P T  D        +   + K  G
Sbjct: 263 RTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERG 322

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFF 105
            RGF+ G     + V   V+  F V E MK  F
Sbjct: 323 VRGFFVGLSIGYIKVTPMVACSFFVYERMKWNF 355

>Kwal_23.4354
          Length = 343

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 122/293 (41%), Gaps = 25/293 (8%)

Query: 31  TAGGVSQVLIGQPFDTTKVRLQTSSVP-TTALDVVKKLVKNEGFRGFYKGTLTPLVGVGA 89
           T+   S+ +  Q      VR +TS V   +  D   K+ K EG +  ++G    L+    
Sbjct: 57  TSRASSKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAP 116

Query: 90  CVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQ 149
              V F   E+++    SR  +  P      L   +CG       +   +P+E  R RLQ
Sbjct: 117 ANMVYFIGYESLRD--KSRLQDKYPT-----LNPLMCGALARVLAATTVAPLELFRTRLQ 169

Query: 150 TQTGTGAAAQFHGPL-DCIKK------LTANNSLMRGLTPTMLRESHGCGVYFLTYEALI 202
           +   +   +     + D IK+           +L RGL  T+ R+     +Y+  YE   
Sbjct: 170 SIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYK 229

Query: 203 AN---ELHKGVSRSEIPTWKLCLF----GATSGTTLWLMIYPLDVIKSVMQT---DSLLQ 252
           +N   +  K +  S    W   +     G+  G    ++ +P DV K+ MQ    +S L+
Sbjct: 230 SNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLE 289

Query: 253 PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
            K  KNM +    +  + GL++ + G  P +++ AP+     +T+E+  R+  
Sbjct: 290 KKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 38/89 (42%), Gaps = 8/89 (8%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT--------ALDVVKKLVKNEGFRGFYK 78
            + G+ GG    ++  PFD  K R+Q + + +T            + ++ K+EG    Y 
Sbjct: 255 FVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYT 314

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           G +  ++ +    ++     E  KR F +
Sbjct: 315 GLVPRVIKIAPSCAIMISTYEVCKRLFST 343

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 123/325 (37%), Gaps = 52/325 (16%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL--------DVVKKLVKNEGFRGFYK 78
           L  G +G  ++ LI  P D  K+  QTS+   +          +  K +  N+G RGF++
Sbjct: 23  LAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQ 81

Query: 79  GTLTPLVGVGACVSVQFGVNEAMK------RFFHSRNGNSGPNETLGLLQYYLCGFAGGT 132
           G    L+ +    +V+F   E ++      R + S           GL   ++  +    
Sbjct: 82  GHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFIT-YPLDL 140

Query: 133 ANSFLASPIEHVRIRLQTQTGTGAAAQFHGP--------LDCIKKLTANNSLMRGLTPTM 184
               LA   EH R++L+    T     +H P        L   K      +  RG  PT+
Sbjct: 141 TRVRLAYVTEHKRVKLRDIVKT----IYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTV 196

Query: 185 LRESHGCGVYFLTYE--------ALIA----------NELHKGVSRSEIP--TWKLCLFG 224
           L      GV F  ++        +L+A           EL +   R + P  TW   + G
Sbjct: 197 LGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAG 256

Query: 225 ATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQ----VAKTIYSTRGLSSFFKGFG 280
             SG       YPL++I+  +Q  +L   K   +  Q    +A+ IY  +G   FF G  
Sbjct: 257 GLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLS 316

Query: 281 PTMLRAAPANGATFATFELAMRVLG 305
              ++  P    +F  +E     LG
Sbjct: 317 IGYIKVTPMVACSFFVYERMKWHLG 341

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 91/202 (45%), Gaps = 30/202 (14%)

Query: 127 GFAGGTANSF---LASPIEHVRIRLQTQTG--TGAAAQFHGPLDCIKKLTANNSL---MR 178
           G AGG + S    L +P++ ++I  QT     +  A    G  +  K +  N+ +    +
Sbjct: 22  GLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQ 81

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPL 238
           G + T+LR      V F+ YE + +  +    SR     W+    G+ +G     + YPL
Sbjct: 82  GHSVTLLRIFPYAAVKFVAYEQIRSILI---PSREYESHWRRLASGSLAGLCSVFITYPL 138

Query: 239 DVIKSVMQTDSLLQPKQGKNMLQVAKTIY---STRGLSS-------------FFKGFGPT 282
           D+ +  ++   + + K+ K +  + KTIY   ++ GL+S             F++G+ PT
Sbjct: 139 DLTR--VRLAYVTEHKRVK-LRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPT 195

Query: 283 MLRAAPANGATFATFELAMRVL 304
           +L   P  G +F   +L   ++
Sbjct: 196 VLGMIPYAGVSFFAHDLIHDIM 217

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 22  RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV-PTTALD--------VVKKLVKNEG 72
           R + +L+AG   G+       P +  + RLQ S++ P    D        + + + + +G
Sbjct: 248 RTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           +RGF+ G     + V   V+  F V E MK
Sbjct: 308 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 118/285 (41%), Gaps = 31/285 (10%)

Query: 32  AGGVSQVLIGQPFDTTKVRLQTSSVPTTA------LDVVKKLVKNEGFRGFYKGTLTPLV 85
           AG VS +++  P D  K RLQ     +        +  +  ++++EG  G YKG    ++
Sbjct: 94  AGFVSGIMVC-PLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVL 152

Query: 86  GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVR 145
           G      + F V E  K+ + S           G + +       G  ++ L +PI  V+
Sbjct: 153 GYFPTWMLYFSVYEKCKQRYPSYLPG-------GFVSHAASALTAGAISTALTNPIWVVK 205

Query: 146 IRLQTQTGTGA-AAQFHGPLDCIKKLTANNSL---MRGLTPTMLRESHGCGVYFLTYEAL 201
            RL  Q+     +  +   LD  +K+  +  L     GL P++    H   ++F  YE L
Sbjct: 206 TRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFH-VAIHFPVYEKL 264

Query: 202 IANELHKG--------VSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQP 253
               LH+         +  +++   +L +    S     ++ YP +++++ MQ      P
Sbjct: 265 -KIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVP 323

Query: 254 KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
               N+L     I ++ G   F+ GF   ++R  PA+  T  +FE
Sbjct: 324 PSLLNLL---GRIRASEGYVGFYSGFATNLVRTVPASVITLVSFE 365

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT--SSVPTTALDVVKKLVKNEGFRG 75
           H+  ++ + ++A     V   +I  P +  + R+Q   S VP + L+++ ++  +EG+ G
Sbjct: 282 HNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVG 341

Query: 76  FYKGTLTPLV 85
           FY G  T LV
Sbjct: 342 FYSGFATNLV 351

>Scas_558.2
          Length = 289

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 112/283 (39%), Gaps = 38/283 (13%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85
            LL+G A G S  L+  P DT K RLQ                +N G+ G Y+G  + +V
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFQNGGYHGIYRGLGSAVV 58

Query: 86  GVGACVSVQFGVNEAMK--------RFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
                 S+ F   ++MK        R  +S +G   P+ ++  + + +    G  A   +
Sbjct: 59  ASAPSASLFFVTYDSMKVRVRPHVERVINS-SGTRSPH-SVDTIVHMIASSMGELAACLV 116

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLT 197
             P E ++ R Q  +   +   F   L    +     +L RG + T++RE     + F  
Sbjct: 117 RVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPL 176

Query: 198 YE------ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251
           YE      AL  NE+        +  WK  + G+ +G        PLD +K+      L+
Sbjct: 177 YEFMKKEWALYDNEV------GHLKPWKGAICGSIAGGIAAATTTPLDFLKT-----RLM 225

Query: 252 QPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
             K    +  + + IY   G   FF G  P  +  + A GA F
Sbjct: 226 LNKDSIPIKSLIRNIYKEEGFKIFFSGIYPRTMWIS-AGGAIF 267

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRL--QTSSVPTTALDVVKKLVKNEGFRGFYKGTL 81
           +K  + G+  G        P D  K RL     S+P  +L  ++ + K EGF+ F+ G  
Sbjct: 197 WKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIPIKSL--IRNIYKEEGFKIFFSGIY 254

Query: 82  TPLVGVGACVSVQFGVNEAMKRFFHS 107
              + + A  ++  GV E M     S
Sbjct: 255 PRTMWISAGGAIFLGVYETMHFMLQS 280

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 16/82 (19%)

Query: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGP 281
           L GA +GT+  L+ +P+D +K+       LQ K G          +   G    ++G G 
Sbjct: 11  LSGAAAGTSTDLVFFPIDTLKT------RLQAKGG---------FFQNGGYHGIYRGLGS 55

Query: 282 TMLRAAPANGATFATFELAMRV 303
            ++ +AP+    F T++ +M+V
Sbjct: 56  AVVASAPSASLFFVTYD-SMKV 76

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 119/305 (39%), Gaps = 34/305 (11%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP------TTALDVVKKLVKNEGFRGFY 77
           +K LLAG   G+    I  P DT K+RLQ +         +  ++V + ++KNEG R F+
Sbjct: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           KG +   +      S QF       R+         P      L   + G   G  +S +
Sbjct: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYL-------TPFGLEARLHSLVVGAFAGITSSIV 129

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLT 197
           + P + +R RL       + +      D I KL       +G   +M   +    + F T
Sbjct: 130 SYPFDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTASIMFGT 188

Query: 198 YEA--LIANELHKGVSRSEIPTWKLCLFGATSGT----TLWLMIYPLDVIKSVMQ----- 246
           YE   +  +E  K  +  +   W+L     ++GT       ++ +PL+ I+  MQ     
Sbjct: 189 YETIRIYCDENEKTTAAHK--KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246

Query: 247 -------TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
                    S+    +G    ++   I    G+SS ++G    + +  P    +F  +E 
Sbjct: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYET 306

Query: 300 AMRVL 304
           A+  L
Sbjct: 307 AIHYL 311

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 204 NELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL--LQPKQGKNMLQ 261
           + L KG     +  WK  L GA SG     +  P+D IK  +Q      L+P  G  +++
Sbjct: 6   DSLRKG---QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP-FGSQVME 61

Query: 262 VAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           VA+++    G+ SF+KG  P  L       A F+++ L  R L
Sbjct: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104

>Kwal_14.2210
          Length = 315

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 123/293 (41%), Gaps = 35/293 (11%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALD-----VVKKLVKNEGFRGFYKGTLTPL 84
           G AG VS+ ++  PF+  K+ LQ  S  T A +      VK++   EG  G  +G     
Sbjct: 25  GIAGAVSRTVV-SPFERVKILLQVQS-STHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNC 82

Query: 85  VGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS-PIEH 143
           + +    +VQF V E  K+ +  +N ++       L+   LCG       S LA+ P++ 
Sbjct: 83  IRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCG-----GCSVLATYPLDL 137

Query: 144 VRIRLQTQTGTGAAAQFH-----------GPLDCIKKLTANNS----LMRGLTPTMLRES 188
           VR RL  QT     A+ H           G  + ++K          L RG+ PT +   
Sbjct: 138 VRTRLSIQTAN--LARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVV 195

Query: 189 HGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
               + F  YE L    +      +    +KL + GA SG     + YP D+++   Q  
Sbjct: 196 PYVALNFAVYEQL-REYIPASFDPASASLYKLSI-GAISGGVAQTITYPFDLLRRRFQVL 253

Query: 249 SLLQPKQG---KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           ++ Q + G   K++     TI  T G   ++KG    + +  P+   ++  +E
Sbjct: 254 AMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 9/95 (9%)

Query: 20  STRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL--------DVVKKLVKNE 71
           S  ++K  +   +GGV+Q  I  PFD  + R Q  ++  + L        D +  + + E
Sbjct: 220 SASLYKLSIGAISGGVAQT-ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTE 278

Query: 72  GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFH 106
           GF+G+YKG    L  V    +V + V E ++ +  
Sbjct: 279 GFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQ 313

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 78/199 (39%), Gaps = 26/199 (13%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRL--QTSSV-------------PTTALDVVKKLV 68
           +  L++G   G   VL   P D  + RL  QT+++             P    ++++K  
Sbjct: 115 WHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTY 174

Query: 69  KNEG-FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCG 127
             EG   G Y+G     +GV   V++ F V E ++ +  +    S    +  L +  +  
Sbjct: 175 TQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPA----SFDPASASLYKLSIGA 230

Query: 128 FAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH-----GPLDCIKKLTANNSLMRGLTP 182
            +GG A + +  P + +R R Q      +   FH       L  I +        +GLT 
Sbjct: 231 ISGGVAQT-ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTA 289

Query: 183 TMLRESHGCGVYFLTYEAL 201
            + +      V ++ YE +
Sbjct: 290 NLFKVVPSTAVSWVVYETV 308

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 122/303 (40%), Gaps = 38/303 (12%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           L+AG+  G+       P DT K++LQ +     A +V+  ++K EG RGF+KG +   + 
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77

Query: 87  VGACVSVQFGVNEAMKRFFHSRNG---NSGPNETLGLLQYYLC--GFAGGTANSFLASPI 141
                  QFG    +  F   R G   N  P       Q Y C  G   G  +S  + P 
Sbjct: 78  YIIYGGAQFGSYTYIGSFL--RGGLDLNISP-------QLYSCLVGSLAGMTSSLASYPF 128

Query: 142 EHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESHGCGVYFLTY 198
           + +R R        +  Q     D I  + ++  LM    G   +M+       + F  Y
Sbjct: 129 DVLRTRF----AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184

Query: 199 EAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ---------- 246
           E++     E  K   R +  T    L G  SG T  L  +PLD ++  +Q          
Sbjct: 185 ESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERH 244

Query: 247 ----TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMR 302
               T  + +  + +  L V  ++    G  S ++G   +++++ P+   +  ++EL M 
Sbjct: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFMN 304

Query: 303 VLG 305
            LG
Sbjct: 305 KLG 307

>Kwal_23.3042
          Length = 542

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 91/207 (43%), Gaps = 15/207 (7%)

Query: 10  IIDDLDGAHDSTRV--FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA------L 61
           ++  L+G  D+  +  F   LAG  GGV   L   P DT K R+Q + + T +      +
Sbjct: 329 LMAQLEGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLI 388

Query: 62  DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN-SGPNE---T 117
              K + K  G R FY+G    ++G+    ++  G   A+K+++ +R    +G  E   T
Sbjct: 389 STAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVT 448

Query: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---N 174
           +  +   L G   GT  +    P+  +R RLQ Q       +++G  D + K        
Sbjct: 449 MSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQ 508

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYEAL 201
            L +GL P + +      + +L YE L
Sbjct: 509 GLFKGLVPNLAKVCPAVSISYLCYENL 535

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 117/323 (36%), Gaps = 40/323 (12%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKV----RLQTSSV------------ 56
           D+   +D  R F   +AG   GV       PFD  KV    R   SS             
Sbjct: 214 DVTLINDFIRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKN 273

Query: 57  PTTALDVVKK--------LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR 108
           P   L  +K         L +  G R FY G     + V    +++FG  E  KR     
Sbjct: 274 PNADLSKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQL 333

Query: 109 NGNSGPNETLGLLQY--YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDC 166
               G  +T GL ++  YL G  GG        PI+ ++ R+Q       +      +  
Sbjct: 334 E---GVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLIST 390

Query: 167 IKKLTANNSL---MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLC-- 221
            K +     L    RG+T  ++       +   T+ AL    + +    + +P  ++   
Sbjct: 391 AKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMS 450

Query: 222 -----LFGATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAKTIYSTRGLSSF 275
                L GA SGT     +YP++++++ +Q   +   P +      V        G    
Sbjct: 451 NMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGL 510

Query: 276 FKGFGPTMLRAAPANGATFATFE 298
           FKG  P + +  PA   ++  +E
Sbjct: 511 FKGLVPNLAKVCPAVSISYLCYE 533

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%)

Query: 259 MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
           +++ A T+Y   G+ +F+ G G   ++  P +   F +FELA R++ 
Sbjct: 285 LVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMA 331

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 62  DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKR 103
           DV+ K V+ EG++G +KG +  L  V   VS+ +   E +KR
Sbjct: 496 DVLLKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKR 537

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 114/280 (40%), Gaps = 26/280 (9%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPT-TALDVVKKLVKNEGFRGFYKGTLTPLVGVG 88
           G  GG+   +   P D  KVRLQT+  P  T + +  ++++NEG  G Y G    ++   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 89  ACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYL-CGFAGGTANSFLASPIEHVRIR 147
              + +FGV + +K  +        P E L  + Y L C    G     + +P + V IR
Sbjct: 75  TYTTARFGVYDFVKERYI-------PKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIR 127

Query: 148 LQTQTGTGAAAQ--FHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALI 202
           +Q  +   A  +  +    D + K+ +      L  G  P ++R         +TY+ + 
Sbjct: 128 MQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYD-IA 186

Query: 203 ANEL--HKGVSRSEIPT-WKLCLFGATSGTTLWLMIYPLDVIKS-VMQTDSLLQPKQGKN 258
            N L  + G+ +    T +   L      TT+     P DVIK+ VM           + 
Sbjct: 187 KNYLVQNVGLDKDNKSTHFASSLLAGLVATTV---CSPADVIKTRVMNAHKHSHDSAVRI 243

Query: 259 MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           +L   K      G S  F+G+ P+ +R  P     F T E
Sbjct: 244 LLDAVK----QEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 111/282 (39%), Gaps = 42/282 (14%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85
            LL+G A G S  L+  P DT K RLQ                +N G+RG Y+G  + +V
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFRNGGYRGVYRGLGSAVV 57

Query: 86  GVGACVSVQFGVNEAMKR----FFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPI 141
                 S+ F   +  K     FF    G    +    ++ +      G  A   +  P 
Sbjct: 58  ASAPGASLFFITYDTCKAETRGFFR---GLLPSSNVADVVTHMFSSSMGEIAACMVRVPA 114

Query: 142 EHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN-------SLMRGLTPTMLRESHGCGVY 194
           E V+ R QT          H   + ++++  N        +L RG + T++RE     + 
Sbjct: 115 EVVKQRSQTHAS-------HSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQ 167

Query: 195 FLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ 252
           F  YE +  +  EL +      +  WK  + G+ +G        PLD +K+      L+ 
Sbjct: 168 FPLYEYMKKVWAELDES---DRVEPWKGAVCGSIAGGIAAATTTPLDFLKT-----RLML 219

Query: 253 PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
            K+   +  +  TIY   G   FF G GP  +  + A GA F
Sbjct: 220 CKKSIPLGTLVSTIYKEEGFKVFFSGVGPRTMWIS-AGGAIF 260

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 79/191 (41%), Gaps = 23/191 (12%)

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
           G L   L G A GT+   +  PI+ ++ RLQ + G      + G             + R
Sbjct: 4   GFLISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNGGYRG-------------VYR 50

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLC-----LFGATSGTTLWL 233
           GL   ++  + G  ++F+TY+   A    +G  R  +P+  +      +F ++ G     
Sbjct: 51  GLGSAVVASAPGASLFFITYDTCKAET--RGFFRGLLPSSNVADVVTHMFSSSMGEIAAC 108

Query: 234 MI-YPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           M+  P +V+K   QT +       + + ++ K         + ++G+  T++R  P    
Sbjct: 109 MVRVPAEVVKQRSQTHA--SHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCI 166

Query: 293 TFATFELAMRV 303
            F  +E   +V
Sbjct: 167 QFPLYEYMKKV 177

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 5/94 (5%)

Query: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ--TSSVPTTALDVVKKL 67
           +  +LD + D    +K  + G+  G        P D  K RL     S+P   L  V  +
Sbjct: 177 VWAELDES-DRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTL--VSTI 233

Query: 68  VKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101
            K EGF+ F+ G     + + A  ++  G+ E +
Sbjct: 234 YKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETV 267

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 109/279 (39%), Gaps = 20/279 (7%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYK 78
           DS      L++G A G S  L   P DT K RLQ                 N G++G Y+
Sbjct: 2   DSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN---SGPNETLGLLQYYLCGFAGGTANS 135
           G  + +V      S+ F   ++MK +     G     G ++T   L + +    G  +  
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISAC 111

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYF 195
            +  P E ++ R QT     +       L          +L RG + T++RE     + F
Sbjct: 112 MVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQF 171

Query: 196 LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255
             YE  +     +   +     W+  + G  +G        PLDV+K+      ++   +
Sbjct: 172 PLYE-YMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKT-----RIMLHHK 225

Query: 256 GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
             + L +AKT+    G+  FF G GP  +  + A GA F
Sbjct: 226 SVSALHLAKTMLQEEGVKVFFSGVGPRTMWIS-AGGAIF 263

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%)

Query: 43  PFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           P D  K R+       +AL + K +++ EG + F+ G     + + A  ++  GV E + 
Sbjct: 212 PLDVLKTRIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 103 RFF 105
             F
Sbjct: 272 SLF 274

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 117/304 (38%), Gaps = 27/304 (8%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLV 68
           D +       +   LLAG   G+ +  +  P D  K R+Q + +   A    +  + K+ 
Sbjct: 13  DYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKIS 72

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128
             EG    +KG  + ++G G   +V FG  E    F  +R  +    +T   ++  L G 
Sbjct: 73  TMEGSMALWKGVQSVILGAGPAHAVYFGTYE----FCKARLISPEDMQTHQPMKTALSGT 128

Query: 129 AGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLT--PTMLR 186
               A   L +P + V+ RLQ  T            +  K++  N          PT L 
Sbjct: 129 IATIAADALMNPFDTVKQRLQLDTNLRV-------WNVTKQIYQNEGFAAFYYSYPTTL- 180

Query: 187 ESHGCGVYFLTYEALIANELHKGVS-RSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVM 245
                 + F  +  +I     K  + ++       CL G  SG T   +  PLD IK+V+
Sbjct: 181 ---AMNIPFAAFNFMIYESASKFFNPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVL 237

Query: 246 Q-----TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
           Q     T S+   K      + ++ I    G   F++G  P ++   PA   ++  +E A
Sbjct: 238 QVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECA 297

Query: 301 MRVL 304
              L
Sbjct: 298 KHFL 301

>Kwal_26.7967
          Length = 297

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 27/295 (9%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLVKNEGFRGFYKGTLT 82
            LAG+  G  +  I  PF+  K RLQ     +TA    L ++ +  K +G    Y G   
Sbjct: 13  FLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPA 72

Query: 83  PLVGVGACVSVQFGVNEAMKRFFHSRNGN--SGPNETLGLLQYYLCGFAGGTANSFLA-S 139
            +VG  A   V+F   +A+K           SGP   +        G   G   S +A +
Sbjct: 73  FIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIV-------AGLGAGLLESVVAVT 125

Query: 140 PIEHVRIRLQTQTGTGAAAQFH----GPLDCIKKLTAN---NSLMRGLTPTMLRESHGCG 192
           P E ++  L       A+ ++H    G L     L  +   + L RG+ P  +R++    
Sbjct: 126 PFEAIKTAL-IDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQA 184

Query: 193 VYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL 250
           V    Y  +  +  +         + +    + GA SG        P+D +K+ MQ+   
Sbjct: 185 VRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQS--- 241

Query: 251 LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
           L   +  + +    T++   GL +F+KG  P + R   + G  F  +E  + VLG
Sbjct: 242 LDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLG 296

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 78/180 (43%), Gaps = 13/180 (7%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCI---KKLTANNSLM 177
           L  +L G   G   + +  P E  + RLQ    +  A++   PL  I    K+    ++ 
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASR--NPLTLIYRTAKVQGLGAVY 67

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM-IY 236
            G    ++  +   GV FL ++A+    + +  +  E+   +  + G  +G    ++ + 
Sbjct: 68  VGCPAFIVGNTAKAGVRFLGFDAI--KNILRDPTTGELSGPRGIVAGLGAGLLESVVAVT 125

Query: 237 PLDVIKSVMQTDSL-LQPK---QGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           P + IK+ +  D     PK    G+ ML+   ++   +G S  ++G  P  +R A AN A
Sbjct: 126 PFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQA-ANQA 184

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 80/187 (42%), Gaps = 13/187 (6%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA------LDVVKKLVKNEGFRGFYKGTL 81
           +AG  GG+       P DT K R+Q + + T        +   K + +  G R FY+G  
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 82  TPLVGVGACVSVQFGVNEAMKRFFHSRNGNS---GPNE-TLGLLQYYLCGFAGGTANSFL 137
             ++GV    ++  G   A+KR++ +R  N+     NE  +  L     G   GT  + +
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATV 419

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194
             PI  +R RLQ Q       ++ G  D  +K         L +GL PT+ +      + 
Sbjct: 420 VYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAIS 479

Query: 195 FLTYEAL 201
           +L YE L
Sbjct: 480 YLCYENL 486

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 108/282 (38%), Gaps = 44/282 (15%)

Query: 50  RLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN 109
           R   + + +  +     L +  G R FY G    ++ V    +++FG  E  KR      
Sbjct: 226 RADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLE 285

Query: 110 GNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKK 169
           G  G    L  L  Y+ G  GG    F   PI+ ++ R+Q             PLD   +
Sbjct: 286 G-CGETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQC-----------APLDTRCR 333

Query: 170 LTANNSLMRGLTPTMLRES------HGCGVYFL-----------TYEALI-------ANE 205
                 L+      M RE        G GV  L           T+ AL        AN 
Sbjct: 334 ---GLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANA 390

Query: 206 LHKGVSRSEIPTWKLCLF--GATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQV 262
           L  G+S +E+    L +   GA SGT    ++YP++++++ +Q   +   P +      V
Sbjct: 391 L--GISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDV 448

Query: 263 AKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
            +      GL   +KG  PT+ +  PA   ++  +E   R +
Sbjct: 449 FRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLKRAM 490

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 116/281 (41%), Gaps = 24/281 (8%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPT-TALDVVKKLVKNEGFRGFYKGTLTPLVGVG 88
           G A G+  V+   P D TKVRLQ + +P  T + +++ ++KNEG  G Y G    L+   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 89  ACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRL 148
              + +FG+ +A+K     R+  +     LG     + G  GG A +F     + + IR+
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLTNMWYLLG--ASMVSGALGGLAGNF----ADLINIRM 126

Query: 149 QTQTG--TGAAAQFHGPLDCIKKLT----ANNSLMRGLTPTMLRESHGCGVYFLTYEA-- 200
           Q  +         +   +D + K+     A +  + G  P M+R         +TY+   
Sbjct: 127 QNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFK 186

Query: 201 ---LIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGK 257
              +    +    + + + +  L  F AT+  +      P DVIK+++            
Sbjct: 187 NFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCS------PADVIKTIVMNAHKKPGHNHD 240

Query: 258 NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           +  ++     +  G S  F+G+ P+  R AP     F   E
Sbjct: 241 SSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 20/180 (11%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGF 76
           +L +G A G   +L     D  + RL   S  +           +DV KK +K++G  G 
Sbjct: 130 NLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 77  YKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSF 136
           Y+G L  +VG+     + FG+ +++K         +G  E    L  +L G+   T  S 
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLL-----TGSLEG-SFLASFLLGWVVTTGAST 243

Query: 137 LASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGV 193
            + P++ VR R+   +G   A ++ G  DC++K+ A     SL +G    +LR   G GV
Sbjct: 244 CSYPLDTVRRRMMMTSGQ--AVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 24/182 (13%)

Query: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGF 76
           +L +G A G   +L     D  + RL   +  +            DV KK +K++G  G 
Sbjct: 119 NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGL 178

Query: 77  YKGTLTPLVGVGACVSVQFGVNEAMKRFF--HSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
           Y+G +  +VG+     + FG+ +++K      S +G+         L  +L G+   T  
Sbjct: 179 YRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGS--------FLASFLLGWVVTTGA 230

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGC 191
           S  + P++ VR R+   +G   A +++G +DC+KK+ A+    SL +G    +LR   G 
Sbjct: 231 STCSYPLDTVRRRMMMTSGQ--AVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGA 288

Query: 192 GV 193
           GV
Sbjct: 289 GV 290

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 128/309 (41%), Gaps = 58/309 (18%)

Query: 43  PFDTTKVRLQTS----SVPTTA-----------------LDVVKKLVKNEGFRGFYKGTL 81
           PFD  K RLQ+     +  T A                 + +++ +   EGFR  +KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 82  TPLVGVGACVSVQF---GV-NEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
             LVGV    S+ F   GV  +   R  +  +G   P        ++L G   G A S  
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLN--DGQEAP------WIHFLAGATAGWATSTA 180

Query: 138 ASPIEHVRIRLQ-TQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTML--RESHGC 191
            +PI  V+ RLQ  +   G + ++    DC+K +  N  ++   +GL+ + L   ES   
Sbjct: 181 TNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQ 240

Query: 192 GVYFLTYEALIAN---ELHKGVSRSEIPTW----KLCLFGATSGTTLW---LMIYPLDVI 241
            V +   + +I     E    +S     T+    + C    ++G       ++ YP +V+
Sbjct: 241 WVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVV 300

Query: 242 KSVMQTDSLLQPKQ-GK----NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           ++ ++      PK+ GK     + Q    I    G +S + G  P ++R  P +   F T
Sbjct: 301 RTRLRQ----APKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 356

Query: 297 FELAMRVLG 305
           +EL +++L 
Sbjct: 357 WELVIKLLA 365

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 77/196 (39%), Gaps = 21/196 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQ-------TSSVPTTALDVVKKLVKNEGFRGFYKG 79
            LAG   G +      P    K RLQ        S     + D +K +++NEG  G YKG
Sbjct: 167 FLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKG 226

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN-----SGPNETLGLLQYYLCGFAG--GT 132
                +G    + +Q+ + E MK     R+       S  N+T  +     C  +G  G 
Sbjct: 227 LSASYLGSVESI-LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGA 285

Query: 133 AN---SFLASPIEHVRIRLQTQTGTGAAAQFHG---PLDCIKKLTANNSLMRGLTPTMLR 186
           A    S L  P E VR RL+         ++ G       I K     S+  GLTP ++R
Sbjct: 286 AKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMR 345

Query: 187 ESHGCGVYFLTYEALI 202
                 + F T+E +I
Sbjct: 346 TVPNSIIMFGTWELVI 361

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 128/311 (41%), Gaps = 39/311 (12%)

Query: 21  TRVFKDLLAGTAGGVSQVLIGQPFDTTKVR-----LQTSSVPTTALDVVKKLVKNEGFRG 75
           TR+  D+        ++ L+    +TT+ R     LQ ++     + ++  + + EGFR 
Sbjct: 82  TRLQSDIYQNMYKSQAEALM---MNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRS 138

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS--RNGNSGPNETLGLLQYYLCGFAGGTA 133
            +KG    LVGV    S+ F      K  +     NG   P        + +     G A
Sbjct: 139 LFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAP------WIHLMAAATAGWA 192

Query: 134 NSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHG 190
            +   +PI  V+ R+Q     G    +    DC+K +  N     L RGL+ + L    G
Sbjct: 193 TATATNPIWMVKTRVQLDKA-GKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEG 251

Query: 191 CGVYFLTYEALI------------ANELHKGVSRSEIPTWKLCLFGATSGTTLWL---MI 235
             + +L YE L             A++     +  +I  W  C     +G   ++   + 
Sbjct: 252 I-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQW--CQRSGGAGLAKFMASIVT 308

Query: 236 YPLDVIKSVMQTDSLLQPK-QGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
           YP +V+++ ++   L   K +   ++Q  + I    GL+S + G  P ++R  P +   F
Sbjct: 309 YPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMF 368

Query: 295 ATFELAMRVLG 305
            T+E+ +++L 
Sbjct: 369 GTWEVVIKLLS 379

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 112/266 (42%), Gaps = 31/266 (11%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS--RNGNSGPNETL 118
           L ++  + K EGFR  +KG    LVGV    S+ F      K  +     NG   P    
Sbjct: 120 LGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETP---- 175

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQ-TQTGTGAAAQFHGPLDCIKKLTANN--- 174
             + + +     G A +   +PI  ++ R+Q  + G  +  Q+    DC+K +  N    
Sbjct: 176 --MIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFT 233

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSR------------SEIPTWKLCL 222
            L +GL+ + L    G  + +L YE +      + + +             ++  W  C 
Sbjct: 234 GLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEW--CQ 290

Query: 223 FGATSGTTLW---LMIYPLDVIKSVM-QTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKG 278
              ++G   +   +  YP +V+++ + QT      ++   ++Q  K I    GL S + G
Sbjct: 291 RSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSG 350

Query: 279 FGPTMLRAAPANGATFATFELAMRVL 304
             P ++R  P +   F T+E+ +R+L
Sbjct: 351 LTPHLMRTVPNSIIMFGTWEIVIRLL 376

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 33/86 (38%), Gaps = 25/86 (29%)

Query: 237 PLDVIKSVMQTDSLLQ---------------PK----------QGKNMLQVAKTIYSTRG 271
           P D++K+ +Q+D  L+               PK            K  L +   +Y   G
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 272 LSSFFKGFGPTMLRAAPANGATFATF 297
             S FKG GP ++   PA    F T+
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTY 157

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 111/281 (39%), Gaps = 28/281 (9%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPT-TALDVVKKLVKNEGFRGFYKGTLTPLVGVG 88
           G A G+   ++  P D  KVRLQ + +P  T   +++ ++ NEG  G Y G    ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 89  ACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYL-CGFAGGTANSFLASPIEHVRIR 147
              +V+FG  + +K        N  P E L  + Y L C    G       +  + V IR
Sbjct: 80  TYTTVRFGAYDLLKE-------NVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIR 132

Query: 148 LQTQTGTGAAAQ--FHGPLDCIKKLTANN----SLMRGLTPTMLRESHGCGVYFLTYEAL 201
           +Q  +   AA +  +   +D + K+        +L  G  P M+R         +TY+  
Sbjct: 133 MQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVF 192

Query: 202 ---IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKS-VMQTDSLLQPKQGK 257
              +  +L    S++        L G  + T    +  P DV+K+ +M      QP    
Sbjct: 193 KNYLVTKLDFDASKNYTHLTASLLAGLVATT----VCSPADVMKTRIMNGSGDHQPA--- 245

Query: 258 NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
             L++        G S  F+G+ P+  R  P     F   E
Sbjct: 246 --LKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 73/186 (39%), Gaps = 21/186 (11%)

Query: 124 YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGP--LDCIKKLTANNS---LMR 178
           +  G A G   + +  P++  ++RLQ       AA    P     ++ + AN     L  
Sbjct: 17  WWYGGAAGIFATMVTHPLDLAKVRLQ-------AAPMPKPTLFRMLESILANEGVVGLYS 69

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCL-FGATSGTTLWLMIYP 237
           GL+  +LR+     V F  Y+ L  N     + R ++      L     SG    L    
Sbjct: 70  GLSAAVLRQCTYTTVRFGAYDLLKENV----IPREQLTNMAYLLPCSMFSGAIGGLAGNF 125

Query: 238 LDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTR----GLSSFFKGFGPTMLRAAPANGAT 293
            DV+   MQ DS L+  + +N       +Y       GL + F G+ P M+R      + 
Sbjct: 126 ADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQ 185

Query: 294 FATFEL 299
             T+++
Sbjct: 186 VVTYDV 191

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 114/296 (38%), Gaps = 25/296 (8%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTALDVVKKLVKNEGFRGFYKGT 80
           K  +AG   G  +  +  PF+  K RLQ     S      L ++    K +G    Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHS-RNGN-SGPNETLGLLQYYLCGFAGGTANSFLA 138
              +VG  A   V+F   + +K      + G  SGP   +        G   G   S +A
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVI-------AGLGAGLLESVVA 123

Query: 139 -SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN------NSLMRGLTPTMLRESHGC 191
            +P E ++  L     +      +     ++  TA       + L RG+ P  +R++   
Sbjct: 124 VTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQ 183

Query: 192 GVYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
            V    Y  +  +  +         + +    + GA SG        P+D +K+ MQ+  
Sbjct: 184 AVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQS-- 241

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
            L  K+  + +    TI+   GL +F+KG  P + R   + G  F  +E  + VLG
Sbjct: 242 -LDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVLG 296

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 106/251 (42%), Gaps = 13/251 (5%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           +D  ++  + EG   F++G    ++      ++ F   + +K  F  +          G 
Sbjct: 59  VDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGN 118

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT---GAAAQFHGPLDCIKKLTANNS-- 175
           L     G AGG +  F+ S +++ R RL     +   G   QF+G +D  KK  A++   
Sbjct: 119 LAS--GGIAGGLSLMFVYS-LDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVA 175

Query: 176 -LMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM 234
            L RG  P+++      G+YF  Y++     L   +  S I ++ L     T  +T    
Sbjct: 176 GLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVTTGAST---A 232

Query: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
            YPLD ++  M   S  Q  + K  +   + I +  G+SS FKG G  +LR     G   
Sbjct: 233 SYPLDTVRRRMMMTSG-QAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVIS 291

Query: 295 ATFELAMRVLG 305
              +L M + G
Sbjct: 292 LYDQLQMILFG 302

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 21/176 (11%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYKGT 80
           G AGG+S + +    D  + RL   +  +           +DV KK + ++G  G Y+G 
Sbjct: 123 GIAGGLSLMFV-YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
           L  ++G+     + FG+ ++ K         +G  E    +  +L G+   T  S  + P
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLL-----TGSLEG-SFIASFLLGWVVTTGASTASYP 235

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGV 193
           ++ VR R+   +G   A ++ G +DC++K+ A    +SL +G    +LR   G GV
Sbjct: 236 LDTVRRRMMMTSGQ--AVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV 289

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 123/338 (36%), Gaps = 58/338 (17%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKV----RLQTSSV------------ 56
           D+   +D  + F   +AG   GV       PFD  KV    R   SS             
Sbjct: 189 DVTLINDFIKGFGFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKN 248

Query: 57  PTTALDVVKK--------LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR 108
           P   L  +K         L +  G R FY G    +V V    +++FG  E  KR   +R
Sbjct: 249 PNADLSKIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIM-AR 307

Query: 109 NGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDC-I 167
             N      L  L  Y+ G  GG A  F   PI+ ++ R+Q             PL+  +
Sbjct: 308 LENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQC-----------APLNTNL 356

Query: 168 KK-----LTANNSLMRGLTPTMLRESHGCGVYFLTYEAL------------IANELHK-G 209
           KK      TA     +G      R  H   +    Y AL            I  E  K G
Sbjct: 357 KKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTG 416

Query: 210 VSRSEIPTWKLCLF--GATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAKTI 266
           +   E+    L +   GA SGT    ++YP++++++ +Q   +   P        V K  
Sbjct: 417 LPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKT 476

Query: 267 YSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
               G    FKG  P + +  PA   ++  +E   R++
Sbjct: 477 IQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKRLM 514

>Scas_718.24
          Length = 337

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 81/176 (46%), Gaps = 21/176 (11%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYKGT 80
           G AGG+S + +    D  + RL   S  +           +DV KK +K++G  G Y+G 
Sbjct: 154 GAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
           L  +VG+     + FG+ +++K         +G  E    L  +L G+   T  S  + P
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLL-----TGSLEG-SFLASFLLGWVVTTGASTCSYP 266

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGV 193
           ++ VR ++   +G   A ++ G  DC KK+ A     SL +G    +LR   G GV
Sbjct: 267 LDTVRRKMMMTSGQ--AVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 89/210 (42%), Gaps = 15/210 (7%)

Query: 7   TPLIIDDLDGAHDSTRV--FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---- 60
           T  I+  L+G  D+  +  F   +AG   G++      P DT K R+Q + + T      
Sbjct: 329 TKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNN 388

Query: 61  --LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN--SGPNE 116
                 K + +  G R FY+G    +VG+    ++  G   A+K+++ ++     + P +
Sbjct: 389 LLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQD 448

Query: 117 --TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN 174
             TL  L     G   GT  + +  PI  +R RLQ Q        ++G  D + K     
Sbjct: 449 QVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLERE 508

Query: 175 ---SLMRGLTPTMLRESHGCGVYFLTYEAL 201
               L +GL PT+ +      + +L YE L
Sbjct: 509 GYQGLFKGLVPTLAKVCPAVSISYLCYENL 538

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 121/336 (36%), Gaps = 66/336 (19%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKV----RLQTSSV------------ 56
           D+   +D  R F   +AG   GV       PFD  KV    R   SS+            
Sbjct: 217 DVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKN 276

Query: 57  PTTALD--------VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR 108
           P   ++         VK L +  G + FY G    ++ V    S++FG  E  K+     
Sbjct: 277 PNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKL 336

Query: 109 NGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK 168
            G     + L     Y+ G   G A  F   PI+ ++ R+Q             PLD   
Sbjct: 337 EG-CRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQC-----------APLDT-- 382

Query: 169 KLTANNSLMRGLTPTMLRESHGCGVYFL------------------TYEALIANELHKGV 210
           KL  NN L +     M RE  G  +++                   T+ AL    + K  
Sbjct: 383 KLKGNNLLFQ-TAKDMFREG-GLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQA 440

Query: 211 SRSEIPTWKLCL-------FGATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQV 262
               +P  ++ L        GA SGT    ++YP++++++ +Q   +   P        V
Sbjct: 441 KTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDV 500

Query: 263 AKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
                   G    FKG  PT+ +  PA   ++  +E
Sbjct: 501 LLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYE 536

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 43  PFDTTKVRLQTSS------VPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFG 96
           P +  + RLQ         V     DV+ K ++ EG++G +KG +  L  V   VS+ + 
Sbjct: 474 PINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVSISYL 533

Query: 97  VNEAMKRFFH 106
             E +K+F +
Sbjct: 534 CYENLKKFMN 543

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 122/307 (39%), Gaps = 32/307 (10%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTALDVVKKLV 68
           D+D  H         LAG+  G ++  I  PF+  K RLQ     S      L ++ K  
Sbjct: 9   DVDPLHS-------FLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTA 61

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGP-NETLGLLQYYLCG 127
           K +G    Y G    ++G  A   ++F   + +K     R+  +G  + T G++     G
Sbjct: 62  KTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDML--RDSETGELSGTRGVI----AG 115

Query: 128 FAGGTANSFLA-SPIEHVRIRLQTQTGTGAAAQFH----GPLDCIKKLTAN---NSLMRG 179
              G   S  A +P E ++  L       A  ++H    G +     L  +   + L RG
Sbjct: 116 LGAGLLESVAAVTPFEAIKTAL-IDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRG 174

Query: 180 LTPTMLRESHGCGVYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYP 237
           + P  +R++    V    Y  +  +  +         + +    L GA SG        P
Sbjct: 175 VLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMP 234

Query: 238 LDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           LD +K+ MQ+   L   +  + +    TI+   GL +F+KG  P + R   + G  F  +
Sbjct: 235 LDTVKTRMQS---LDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIY 291

Query: 298 ELAMRVL 304
           E  + +L
Sbjct: 292 EKVLVML 298

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 21/176 (11%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYKGT 80
           G AGG+S + +    D  + RL   S              +DV KK + ++G  G Y+G 
Sbjct: 122 GAAGGLSLLFV-YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
           L  +VG+     + FG+ +++K    + N  S        +  +L G+A  T  S  + P
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLTGNLES------SFIASFLLGWAVTTGASTASYP 234

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGV 193
           ++ VR R+   +G   A ++ G  D  +K+ A     SL +G    +LR   G GV
Sbjct: 235 LDTVRRRMMMTSGQ--AVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

>Scas_582.7
          Length = 329

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 106/291 (36%), Gaps = 25/291 (8%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQ------TSSVPTTALDVVKKLVKNEGFRGFYKGT 80
           LLAG   G+ +     P D  K R+Q      T    T+ +  + K+   EG    +KG 
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
            + ++G G   +V F   E    F  +        ET   ++  + G     A+ F  +P
Sbjct: 100 QSVILGAGPAHAVYFATYE----FTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNP 155

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEA 200
            + ++ R+Q         + +     I  L   ++       T+          F+ YE+
Sbjct: 156 FDTIKQRMQI--SDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYES 213

Query: 201 L--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD-----SLLQP 253
                N LH             CL G  SG     +  PLD IK+V+Q       SL   
Sbjct: 214 ASKFFNPLHHYNPLIH------CLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVM 267

Query: 254 KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           K+     +    I    G   F++G  P +L   PA   ++  +E A   L
Sbjct: 268 KKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 83/210 (39%), Gaps = 24/210 (11%)

Query: 15  DGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL-DVVKKLVKNEGF 73
           D   ++ +  K  ++G    V+      PFDT K R+Q S +    + +V KK+   EG 
Sbjct: 127 DSQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGL 186

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTA 133
             FY    T +       +  F + E+  +FF        P      L + LCG   G  
Sbjct: 187 SAFYYSYPTTIAMNIPFAAFNFMIYESASKFF-------NPLHHYNPLIHCLCGGISGAI 239

Query: 134 NSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN-------NSLMRGLTPTMLR 186
            + + +P++ ++  +Q +  +  + +     +  KK T+            RGL P +L 
Sbjct: 240 AAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILA 299

Query: 187 E---------SHGCGVYFLTYEALIANELH 207
                     ++ C  +FL    L+ N+ H
Sbjct: 300 NMPATAISWTAYECAKHFLFSTRLLKNDEH 329

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 117/296 (39%), Gaps = 23/296 (7%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTALDVVKKLVKNEGFRGFYKG 79
           F   LAG+  G  +  I  PF+  K RLQ     S      L ++    KN G    Y G
Sbjct: 91  FHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVG 150

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA- 138
               +VG  A   ++F   + +K     R+  +G    L   +  + G   G   S +A 
Sbjct: 151 CPAFIVGNTAKAGIRFLGFDTIKNLL--RDKKTGE---LSGFRGVVAGLGAGLLESVVAV 205

Query: 139 SPIEHVRIRLQTQTGTGAAAQFH----GPLDCIKKLTAN---NSLMRGLTPTMLRESHGC 191
           +P E ++  L       A  ++     G +    KL ++   + L RG+ P  +R++   
Sbjct: 206 TPFEAIKTAL-IDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQ 264

Query: 192 GVYFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
            V    Y  +  +  +         + +    + GA SG        P+D +K+ MQ+  
Sbjct: 265 AVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQS-- 322

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
            L   Q  + +    TI+   GL +F+KG  P + R   + G  F  +E  + VL 
Sbjct: 323 -LNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTVLA 377

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 90/185 (48%), Gaps = 24/185 (12%)

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLR 186
           GFAGG +++    P++ ++ R Q QT  G   Q       +K L     L RG  P+ +R
Sbjct: 11  GFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQ------TVKSLDTPWQLWRGTLPSAIR 63

Query: 187 ESHGCGVYF----LTYEAL-------IANELHKGVSRS--EIPTWKLCLFGATSGTTLWL 233
            S G  +Y     L   AL        A+ +  G S +  ++  ++  + GA +  T+  
Sbjct: 64  TSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGY 123

Query: 234 MIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGAT 293
           +  P+ +IK  ++ +S L     K++ + AK+I +  G+  FF+GFGPT LR AP +G  
Sbjct: 124 ITMPITIIK--VRYESTLY--NYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLY 179

Query: 294 FATFE 298
              +E
Sbjct: 180 VLLYE 184

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 111/296 (37%), Gaps = 37/296 (12%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           L+ G AGG+S  +  QP D  K R Q +   T    V       + +RG     +   VG
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTSVG 67

Query: 87  VGACVSVQFGVNEAM---KRFFHSRNGNSGPNETLGLLQYY----LCGFAGGTANSFLAS 139
               +S    +  A+   K+F  + +  +G +  L  L  Y       FA GT   ++  
Sbjct: 68  SALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVG-YITM 126

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL---MRGLTPTMLRESHGCGVYFL 196
           PI  +++R ++         +    +  K + A   +    RG  PT LR++   G+Y L
Sbjct: 127 PITIIKVRYES-----TLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVL 181

Query: 197 TYEAL--------------IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIK 242
            YE L              + +E       S        +  A+  TT+     P D IK
Sbjct: 182 LYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTV---TAPFDTIK 238

Query: 243 SVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           + MQ    L+P + K       TI +       F G    + R A + G  +  +E
Sbjct: 239 TRMQ----LEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYE 290

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 14  LDGAHDSTRV--FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA------LDVVK 65
           L+G H ++ +  F   +AG  GGV       P DT K R+Q + + T        +   +
Sbjct: 304 LEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTAR 363

Query: 66  KLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSG--PNETLGLLQY 123
           ++ ++ G + FY+G    ++G+    ++  G   A+K+++ +R       P + + +  +
Sbjct: 364 QMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNF 423

Query: 124 YLC--GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMR 178
            +   G   GT  + +  PI  +R RLQ Q        + G  D + K         L +
Sbjct: 424 IVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFK 483

Query: 179 GLTPTMLRESHGCGVYFLTYE 199
           GL P + +      + +L YE
Sbjct: 484 GLVPNLAKVCPAVSISYLCYE 504

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 119/327 (36%), Gaps = 36/327 (11%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRL--------------------- 51
           D+   +D  R F   +AG   GV       PFD  KV L                     
Sbjct: 185 DVTLINDFIRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKN 244

Query: 52  ---QTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR 108
                S + +  +     L +  G R FY G    ++ V    +++FG  E  K+     
Sbjct: 245 PNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHL 304

Query: 109 NGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK 168
            G    +E L     Y+ G  GG    F   PI+ ++ R+Q      A       +   +
Sbjct: 305 EGVHHTSE-LSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTAR 363

Query: 169 KLTANNSL---MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCL--- 222
           ++  +  L    RG+T  ++       +   T+ AL    + +    + +P  ++ +   
Sbjct: 364 QMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNF 423

Query: 223 ----FGATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAKTIYSTRGLSSFFK 277
                GA SGT    ++YP++++++ +Q   +   P        V        G    FK
Sbjct: 424 IVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFK 483

Query: 278 GFGPTMLRAAPANGATFATFELAMRVL 304
           G  P + +  PA   ++  +E   R++
Sbjct: 484 GLVPNLAKVCPAVSISYLCYENFKRLM 510

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 116/275 (42%), Gaps = 36/275 (13%)

Query: 59  TALDVVKKLVKNEGFRGFYKG-TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNET 117
           +  +   K+ + EG    ++G ++T L+ + A V V F   E  +   HS   +S P+  
Sbjct: 99  STWEAFTKISEVEGLATLWRGLSITLLMAIPANV-VYFSGYEMFRD--HSPMRDSYPS-- 153

Query: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN--- 174
              L    CG       +   +P+E ++ RLQ+   +            + K T N    
Sbjct: 154 ---LNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRS 210

Query: 175 ----SLMRGLTPTMLRESHGCGVYFLTYEALIAN---ELHKGVSRSEI-PTWKLCLF--- 223
                L +GL  T+ R+     +Y+ +YE    N   +  +   R  + P W   +    
Sbjct: 211 GGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFI 270

Query: 224 -GATSGTTLWLMIYPLDVIKSVMQT---------DSLLQPKQ---GKNMLQVAKTIYSTR 270
            G+ SG++  L+ +P DV K+ MQ          ++L+ PK+    + M +    I  T 
Sbjct: 271 GGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTE 330

Query: 271 GLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
           G  + + G  P +++ AP+     +T+EL+ R+  
Sbjct: 331 GYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 84/230 (36%), Gaps = 60/230 (26%)

Query: 125 LCGFAGGTANSFLASPIEHVRIRLQTQT-----GTGAAAQFHGPLD-------------- 165
           L   AG    SF  +P++ VRIRLQ Q        GAA++  G +               
Sbjct: 16  LSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVGTEVIYDHVVANKNS 75

Query: 166 --------CIKKLTANNS----------------------LMRGLTPTMLRESHGCGVYF 195
                   C + +   NS                      L RGL+ T+L       VYF
Sbjct: 76  PKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYF 135

Query: 196 LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQT------DS 249
             YE       H  + R   P+      GAT+       + PL++IK+ +Q+      D+
Sbjct: 136 SGYEMF---RDHSPM-RDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDT 191

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
             Q    K++L+  +    + G    FKG   T+ R  P +   + ++E 
Sbjct: 192 TTQ-MMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEF 240

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 37/96 (38%), Gaps = 17/96 (17%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVV---KKLV-------------K 69
            + G+  G S  L+  PFD  K R+Q T  +     + +   KK V             +
Sbjct: 269 FIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQ 328

Query: 70  NEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFF 105
            EG+   Y G +  ++ +    ++     E  KR F
Sbjct: 329 TEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 122/313 (38%), Gaps = 50/313 (15%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFY 77
           L  G AG  ++ L+  P D  K+  QTS+ P  A         +   K ++ ++G RGF+
Sbjct: 24  LAGGIAGSCAKTLVA-PLDRIKILFQTSN-PQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           +G    L+ +    +++F   E ++        +      L      L G   G  + F+
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL------LSGSLAGLCSVFV 135

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL---------------MRGLTP 182
             P++ VR+RL   T     A+    + CI     + +L                RG TP
Sbjct: 136 TYPLDLVRVRLAYVT-ERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTP 194

Query: 183 TMLRESHGCGVYFLTYE--------------ALIANELHKGVSRS-EIPTWKLCLFGATS 227
           T++      GV F  ++              ++++        R+  + TW   + G  +
Sbjct: 195 TVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLA 254

Query: 228 GTTLWLMIYPLDVIKSVMQTDSLLQP--KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLR 285
           G       YP ++I+  +Q  ++  P  +    + ++AK IY+  G   FF G     ++
Sbjct: 255 GMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIK 314

Query: 286 AAPANGATFATFE 298
             P    +F  +E
Sbjct: 315 VTPMVACSFFIYE 327

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 94/222 (42%), Gaps = 33/222 (14%)

Query: 108 RNGNSGPNETLGLLQYYLCGFAGGTANSF---LASPIEHVRIRLQTQTGTGAAAQFHGPL 164
           R   SGP +   +      G AGG A S    L +P++  RI++  QT     AQF G +
Sbjct: 4   RQRGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVAPLD--RIKILFQTSNPQFAQFAGSM 61

Query: 165 DCI----KKLTANNS---LMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPT 217
             +    K + A++      +G + T+LR      + F+ YE + +  +      S    
Sbjct: 62  GGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESH--- 118

Query: 218 WKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTR------- 270
           W+  L G+ +G     + YPLD+++  +   + +  +    + ++   IY+ R       
Sbjct: 119 WRRLLSGSLAGLCSVFVTYPLDLVRVRL---AYVTERHDAKVRKIMACIYNERPSEALRK 175

Query: 271 --------GLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
                     S+F++G+ PT++   P  G +F   +L   + 
Sbjct: 176 WYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIF 217

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 17  AHDST---RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PT----TALDVVKKL 67
           A+D T   + +  L+AG   G++      PF+  + RLQ S++  PT      ++ + K+
Sbjct: 235 AYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKI 294

Query: 68  VKNE-GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFH 106
           +  E G+RGF+ G     + V   V+  F + E  K +  
Sbjct: 295 IYTEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYLQ 334

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 73/192 (38%), Gaps = 31/192 (16%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA-LDVVKKLVKNE----- 71
           H+S   ++ LL+G+  G+  V +  P D  +VRL   +    A +  +   + NE     
Sbjct: 115 HESH--WRRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEA 172

Query: 72  -----------GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFH----------SRNG 110
                       +  FY+G    ++G+     V F  ++  +  F           S  G
Sbjct: 173 LRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGG 232

Query: 111 NSGPNETLGLLQY--YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK 168
           +S  + T+ L  +   + G   G A+   A P E +R RLQ    T    +    ++ I 
Sbjct: 233 SSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIA 292

Query: 169 KLTANNSLMRGL 180
           K+       RG 
Sbjct: 293 KIIYTEGGWRGF 304

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 119/302 (39%), Gaps = 33/302 (10%)

Query: 17  AHDSTRV--FKDLLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTALDVVKKLVKN 70
           + DS +V   K  +AG   G  +  I  PF+  K RLQ    +S      L ++    K 
Sbjct: 2   SKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKT 61

Query: 71  EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGN--SGPNETLGLLQYYLCGF 128
           +G    Y G    +VG  A  + +F   + ++     +     SGP   L        G 
Sbjct: 62  QGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVL-------AGL 114

Query: 129 AGGTANSFLA-SPIEHVR---------IRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
             G   S +A +P E ++         +R + Q    + A+ +  L    K      L  
Sbjct: 115 GAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISL---VKDEGFRGLYG 171

Query: 179 GLTPTMLRESHGCGVYFLTYEAL-IANELHKGVSRSEIPTWKLC-LFGATSGTTLWLMIY 236
           G+ P  +R++    V    Y  + +  + + G  + +  T  L  + GA SG        
Sbjct: 172 GVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATM 231

Query: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           P+D +K+ MQ+   L   +  + L    TIY   GL +F+KG  P + R   + G  F  
Sbjct: 232 PIDTVKTRMQS---LTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTI 288

Query: 297 FE 298
           +E
Sbjct: 289 YE 290

>Kwal_26.7972
          Length = 358

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 120/318 (37%), Gaps = 62/318 (19%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSS-----VPTTALDVVK---KLVKNEGFRGFYK 78
           L  G AG  ++ LI  P D  K+  QTS+        + + +++    +  ++G RGFY+
Sbjct: 32  LAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G    L+ +    +++F   E ++ F             L        G   G  + F+ 
Sbjct: 91  GHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLA------SGSMAGLCSVFMT 144

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL---TANNSL----------------MRG 179
            P++ +R+RL   T           L  IK++    A+ SL                 RG
Sbjct: 145 YPLDLIRVRLAYVTDRSRIKM----LPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRG 200

Query: 180 LTPTMLRESHGCGVYFLTYE---------AL-------IANE----LHKGVSRSEIPTWK 219
            TPT+L      GV F  ++         AL       I++E      K  S   + TW 
Sbjct: 201 FTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWA 260

Query: 220 LCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVA---KTIYSTRGLSSFF 276
             + G  +G       YP ++I+  +Q  S++ P    N   +    + IY  RG   FF
Sbjct: 261 ELVAGGLAGMASQTASYPFEIIRRRLQV-SVVSPTSIHNFQTIPDMIRIIYKERGWRGFF 319

Query: 277 KGFGPTMLRAAPANGATF 294
            G     ++  P    +F
Sbjct: 320 VGLSIGYIKVTPMVACSF 337

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 84/203 (41%), Gaps = 32/203 (15%)

Query: 127 GFAGGTANSF---LASPIEHVRIRLQTQTGT--GAAAQFHGPLDCIKKLTANNSL---MR 178
           G AGG A S    L +P++ ++I  QT        +    G +     + A++ +    +
Sbjct: 31  GLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLF-GATSGTTLWLMIYP 237
           G + T++R      + F+ YE +     H  +   E  T    L  G+ +G     M YP
Sbjct: 91  GHSATLIRIFPYAAIKFIAYEQI----RHFMIPSKEYETHARRLASGSMAGLCSVFMTYP 146

Query: 238 LDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSS----------------FFKGFGP 281
           LD+I+  +   + +  +    ML V K IY+ R   S                F++GF P
Sbjct: 147 LDLIRVRL---AYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTP 203

Query: 282 TMLRAAPANGATFATFELAMRVL 304
           T+L   P  G +F   +L   +L
Sbjct: 204 TVLGMIPYAGVSFFAHDLCGDIL 226

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 16/99 (16%)

Query: 22  RVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL-------DVVKKLVKNEGFR 74
           + + +L+AG   G++      PF+  + RLQ S V  T++       D+++ + K  G+R
Sbjct: 257 KTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWR 316

Query: 75  GFYKG------TLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           GF+ G       +TP+V   AC   +   NE +  +  +
Sbjct: 317 GFFVGLSIGYIKVTPMV---ACSFFRLRKNEVVSEYLRT 352

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 85/192 (44%), Gaps = 17/192 (8%)

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
           G+  + + GF GG A+     P++ ++ RLQ        AQ       ++++     L R
Sbjct: 7   GVPAHLVSGFFGGLASVCALQPLDLLKTRLQQ-------AQASSLRSVLREVRTTRELWR 59

Query: 179 GLTPTMLRESHGCGVY--FLTYEALIANELHKGVSRS----EIPTWKLCLFGATSGTTLW 232
           G  P+ LR S G  +Y   L Y         +  +RS     + +++  L GA S   + 
Sbjct: 60  GTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVG 119

Query: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           L+  P+ VIK  ++ +S L    G  + +  + I+ + G   FFKG   T LR AP  G 
Sbjct: 120 LVTMPITVIK--VRYESTLYAYNG--LAEATRHIWRSEGARGFFKGAAATTLRDAPYAGL 175

Query: 293 TFATFELAMRVL 304
               +E A  +L
Sbjct: 176 YVLLYEQAKEML 187

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 116/300 (38%), Gaps = 41/300 (13%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVK--NEGFRGFYKGTLTPL 84
           L++G  GG++ V   QP D  K RLQ +    ++L  V + V+   E +RG     L   
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQA--SSLRSVLREVRTTRELWRGTLPSALRTS 69

Query: 85  VGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYY---LCGFAGGTANSFLASPI 141
           +G    +S+      A+ R   +R  +S     L  LQ Y   L G     A   +  PI
Sbjct: 70  IGSALYLSLLNYSRSALARGSEARTRSS----LLPRLQSYQNLLTGALSRAAVGLVTMPI 125

Query: 142 EHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTY 198
             +++R ++         ++G  +  + +  +       +G   T LR++   G+Y L Y
Sbjct: 126 TVIKVRYESTL-----YAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY 180

Query: 199 E--------ALIANELHKGVS-RSEIPTWKL-----CLFGATSGTTLWLMIYPLDVIKSV 244
           E        AL A  L    S +   P   +         A+  TTL     P D IK+ 
Sbjct: 181 EQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTL---TAPFDTIKTR 237

Query: 245 MQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           MQ  S          +Q  + I       + F G    + R A +    +  +E  +++L
Sbjct: 238 MQLQS-----HPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLL 292

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 28/64 (43%)

Query: 43  PFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           PFDT K R+Q  S P   +  ++ +V  E  R  + G    L        + +G+ E + 
Sbjct: 230 PFDTIKTRMQLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELL 289

Query: 103 RFFH 106
           +  H
Sbjct: 290 KLLH 293

>Kwal_27.12481
          Length = 304

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 79/176 (44%), Gaps = 21/176 (11%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYKGT 80
           G AGG+S + +    D  + RL   S              +DV KK + ++G  G Y+G 
Sbjct: 122 GAAGGLSLMFV-YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
           L  +VG+     + FG  +++K         +G  E    L  +L G+A  T  S  + P
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLL-----TGSLEG-SFLASFLLGWAVTTGASTASYP 234

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGV 193
           ++ VR R+   +G   A +++G  D  +K+ A     SL +G    +LR   G GV
Sbjct: 235 LDTVRRRMMMTSGQ--AVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 118/307 (38%), Gaps = 50/307 (16%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL----DVVKKLVKNEGFRGFYKG 79
           +  ++AG+  GV   +   P DT K+R Q   V           V+ ++K EG R  +KG
Sbjct: 19  YNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKG 78

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHS---RNGNSGPNETLGLLQYYLCGFAGGTANSF 136
            +          +VQFG        + +   R    G   T+G L         G  +S 
Sbjct: 79  NIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGAL--------AGMTSSV 130

Query: 137 LASPIEHVRIRL---QTQTGTGAAAQFHGPLDCIKKLTANNSL---MRGLTPTMLRESHG 190
           ++ P++ +R RL   +T   T  A       +C +++  N  +     G++  M   +  
Sbjct: 131 VSYPLDLLRTRLIANRTSHRTSVAE------EC-RQMWLNEGVRGFFTGISTAMTTVTLS 183

Query: 191 CGVYFLTYEAL-IANELHKGVSRSEIPTWKLCL---FGATSGTTLWLMIYPLDVIKSVMQ 246
             + FLTYE + I  E H      E   W   +    G  +G     M++P+D ++  MQ
Sbjct: 184 TAIMFLTYETVNIVCENH------EKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQ 237

Query: 247 T------------DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
                         ++    + K+   +   I    G+S+ ++G    + ++ P    + 
Sbjct: 238 VMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISL 297

Query: 295 ATFELAM 301
             +E  M
Sbjct: 298 FVYERTM 304

>Scas_578.3*
          Length = 524

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 105/274 (38%), Gaps = 42/274 (15%)

Query: 51  LQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNG 110
           L  + + +  +  ++ L +  G R FY G    +  +    S++FG  E  KR   + +G
Sbjct: 258 LNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSG 317

Query: 111 NSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL 170
           +   N+ L  LQ Y+ G   G        PI+ ++ R+Q        A   G L      
Sbjct: 318 DKLVND-LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQ-------CAPLEGNL------ 363

Query: 171 TANNSLMRGLTPTMLRESHGCGVYFL------------------TYEALIANELHKGVSR 212
              N+L+      M +E  G  V++                   T+ AL    + +   +
Sbjct: 364 -KGNALLISTAKEMYKEG-GIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKK 421

Query: 213 SEIPTWKLCL-------FGATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAK 264
             IP   + L        GA SGT     +YP++++++ +Q   +   P        V  
Sbjct: 422 LNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFM 481

Query: 265 TIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
                 G+  F+KG  PT+++  PA    +  +E
Sbjct: 482 QTLKREGVPGFYKGLVPTLVKVCPAVSIGYLCYE 515

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 81/188 (43%), Gaps = 16/188 (8%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVP------TTALDVVKKLVKNEGFRGFYKGTLTP 83
           G AG ++Q+ I  P DT K R+Q + +          +   K++ K  G R FY+G L  
Sbjct: 334 GIAGVMAQISI-YPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLLG 392

Query: 84  LVGVGACVSVQFGVNEAMKRFFHSRNGN--SGPNETLGLLQYYLC---GFAGGTANSFLA 138
            +G+    ++  G   A+K+++  R     + P + + +L Y L    G   GT  +   
Sbjct: 393 ALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDV-MLSYLLVLPMGAFSGTVGATAV 451

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSL---MRGLTPTMLRESHGCGVYF 195
            PI  +R RLQ Q        + G  D   +      +    +GL PT+++      + +
Sbjct: 452 YPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVSIGY 511

Query: 196 LTYEALIA 203
           L YE   A
Sbjct: 512 LCYEKFKA 519

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 17/99 (17%)

Query: 224 GATSGTTLWLMIYPLDVIKS--VMQTD---SLLQPK-----QGKNM-------LQVAKTI 266
           G  SG        PLD IK   + +TD   +LL PK     QG N+       ++  +++
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSL 274

Query: 267 YSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
           Y   GL +F+ G G ++ +  P +   F TFELA R++ 
Sbjct: 275 YRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMA 313

>Scas_667.4
          Length = 308

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 79/181 (43%), Gaps = 31/181 (17%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYKGT 80
           G AGG+S + +    D  + RL   +  +           +DV K+ +  +G  G Y+G 
Sbjct: 125 GAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG-----LLQYYLCGFAGGTANS 135
           L  +VG+     + FG+ +++K           P    G      L  +L G+   T  S
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLK-----------PAVLTGSLEGSFLASFLLGWIVTTGAS 232

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCG 192
             + P++ VR R+   +G   A ++ G  DC +K+ A    +SL +G    +LR   G G
Sbjct: 233 TASYPLDTVRRRMMMTSGQ--AVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAG 290

Query: 193 V 193
           V
Sbjct: 291 V 291

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 104/251 (41%), Gaps = 13/251 (5%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           ++  ++  K EG   F++G    ++      ++ F   + +K  F  +          G 
Sbjct: 61  IECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGN 120

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT---GAAAQFHGPLDCIKKLTANNS-- 175
           L     G AGG +  F+ S +++ R RL     +   G + Q+ G +D  K+  A +   
Sbjct: 121 LAS--GGAAGGLSLLFVYS-LDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMA 177

Query: 176 -LMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM 234
            L RG  P+++      G+YF  Y++L    L   +  S + ++ L     T  +T    
Sbjct: 178 GLYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVTTGAST---A 234

Query: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
            YPLD ++  M   S  Q  +        + + +  G+SS FKG G  +LR     G   
Sbjct: 235 SYPLDTVRRRMMMTSG-QAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVIS 293

Query: 295 ATFELAMRVLG 305
              +L M + G
Sbjct: 294 MYDQLQMIMFG 304

>Scas_645.9
          Length = 391

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 115/270 (42%), Gaps = 37/270 (13%)

Query: 61  LDVVKKLVKNEGFRGFYKG-TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG 119
           L+   K+ K EG    ++G ++  L+ + A + V F   E ++   +S    S P     
Sbjct: 133 LEAFNKIWKLEGITTLWRGISINLLMAIPANI-VYFTGYEYLRD--NSPLATSSPT---- 185

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLT-------- 171
                +CG       +   +P+E ++ +LQ+      +      +  + K T        
Sbjct: 186 -FNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISG 244

Query: 172 ANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLF------GA 225
           A+N+L +GL  T+ R+     +Y+ +YE      L    S+S      L  F      G+
Sbjct: 245 ASNALFKGLEITLWRDVPFSAIYWGSYE-FCKTHLWMDTSKSHS---NLTFFINSFIGGS 300

Query: 226 TSGTTLWLMIYPLDVIKSVMQTD-------SLLQP---KQGKNMLQVAKTIYSTRGLSSF 275
            SGT   L+ +P DV K+  Q         S+++    +Q KNM +  + I+   G  + 
Sbjct: 301 ISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGAL 360

Query: 276 FKGFGPTMLRAAPANGATFATFELAMRVLG 305
           + G  P M++ AP+     +++EL+ R+  
Sbjct: 361 YTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 45/120 (37%), Gaps = 15/120 (12%)

Query: 3   EELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALD 62
           E   T L +D      + T      + G+  G    L+  PFD  K R Q S +      
Sbjct: 272 EFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKS 331

Query: 63  VVK-----------KLVKN----EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           VVK           K ++N    EG+   Y G +  +V +    ++     E  KR F++
Sbjct: 332 VVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 15/156 (9%)

Query: 155 GAAAQFHGPLDC---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVS 211
            ++ +F+G L+    I KL    +L RG++  +L       VYF  YE L  N      S
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSS 183

Query: 212 RSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTR- 270
               PT+   + GA +       + PL+++K+ +Q+   +  K   + + V + +  TR 
Sbjct: 184 ----PTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVS-KSTTSWMMVKELLKETRQ 238

Query: 271 ------GLSSFFKGFGPTMLRAAPANGATFATFELA 300
                   ++ FKG   T+ R  P +   + ++E  
Sbjct: 239 EMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFC 274

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 73/205 (35%), Gaps = 28/205 (13%)

Query: 20  STRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP-----TTALDVVKKLVKNE--- 71
           S+  F  L+ G    +       P +  K +LQ  S+P     TT+  +VK+L+K     
Sbjct: 182 SSPTFNPLMCGAIARILAASTVAPLELLKTKLQ--SIPRVSKSTTSWMMVKELLKETRQE 239

Query: 72  -----GFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLC 126
                     +KG    L       ++ +G  E  K         S  N T   +  ++ 
Sbjct: 240 MRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTF-FINSFIG 298

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQ-TGTGAAAQFHGP-----------LDCIKKLTANN 174
           G   GT  + +  P +  + R Q    G    +    P           L  I KL    
Sbjct: 299 GSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWG 358

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYE 199
           +L  GL P M++ +  C +   +YE
Sbjct: 359 ALYTGLVPRMVKIAPSCAIMISSYE 383

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/327 (22%), Positives = 121/327 (37%), Gaps = 52/327 (15%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA--------LDVVKKLVKNEGFRGFYK 78
           L  G AG  ++ LI  P D  K+  QTS+             L+    +   +  RG ++
Sbjct: 58  LAGGVAGSCAKTLIA-PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFF--------HSRNGNSGPNETLGLLQYYLCGFAG 130
           G    L+ +    +V+F   E ++           H R   SG   +L  L    C +  
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSG---SLAGLCSVFCTYPL 173

Query: 131 GTANSFLASPIEHVRIR---LQTQTGTGAAAQFHGPLDCIKKLTAN-NSLMRGLTPTMLR 186
                 LA   EH ++R   L  Q  +  A++       + K  A   +  RG  PT++ 
Sbjct: 174 DLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTVIG 233

Query: 187 ESHGCGVYFLTYE--------------------ALIANELHKGV------SRSEIPTWKL 220
                GV F  ++                     L A++L   V       R  + TW  
Sbjct: 234 MIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAE 293

Query: 221 CLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGK--NMLQVAKTIYSTRGLSSFFKG 278
            L G  +G       YP ++I+  +Q  ++  P + K  +M ++AK I+  RG   FF G
Sbjct: 294 LLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVG 353

Query: 279 FGPTMLRAAPANGATFATFELAMRVLG 305
                ++  P    +F  +E     +G
Sbjct: 354 LSIGYIKVTPMVACSFFVYERMKWYMG 380

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 87/204 (42%), Gaps = 34/204 (16%)

Query: 127 GFAGGTANSF---LASPIEHVRIRLQTQTG--TGAAAQFHGPLDCIKKLTANNSL---MR 178
           G AGG A S    L +P++ ++I  QT        A  F G L+    + + + L    +
Sbjct: 57  GLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTW--KLCLFGATSGTTLWLMIY 236
           G + T+LR      V F+ YE  I N +   +   E  T   +LC  G+ +G       Y
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQ-IRNVI---IPSKEYETHFRRLCS-GSLAGLCSVFCTY 171

Query: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYS---TRGLSS-------------FFKGFG 280
           PLD+I+  +   + +       +  + K IYS   +  LSS             F++G+ 
Sbjct: 172 PLDLIRVRL---AYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYI 228

Query: 281 PTMLRAAPANGATFATFELAMRVL 304
           PT++   P  G +F   +L   +L
Sbjct: 229 PTVIGMIPYAGVSFFAHDLFHDIL 252

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

Query: 9   LIIDDLD-------------GAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSS 55
           L +DDLD             G       + +LLAG   G++      PF+  + RLQ  +
Sbjct: 263 LRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGA 322

Query: 56  VP-------TTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRF 104
           V        T+  ++ K +    G+RGF+ G     + V   V+  F V E MK +
Sbjct: 323 VTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWY 378

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 85/186 (45%), Gaps = 21/186 (11%)

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLR 186
           GF+GG  ++ +  P + ++ RLQ Q  T    +       +K +   + L RG  P+ +R
Sbjct: 14  GFSGGLVSAIILQPFDLLKTRLQ-QDKTSTLWK------TLKSIETPSQLWRGALPSCIR 66

Query: 187 ESHGCGVYFLTYEALIANELHKG-----VSRSEIPT---WKLCLFGATSGTTLWLMIYPL 238
            S G  +Y LT    I   + KG        S +P    ++    GA +     L+  P+
Sbjct: 67  TSVGSAMY-LTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPI 125

Query: 239 DVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
            VIK  ++ +S L   Q  ++      I+ T GL  FF+GFG T LR AP  G  +  F 
Sbjct: 126 TVIK--VRYESTLY--QYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGL-YMLFY 180

Query: 299 LAMRVL 304
             M+VL
Sbjct: 181 DRMKVL 186

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/294 (20%), Positives = 116/294 (39%), Gaps = 23/294 (7%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYK 78
           +  R    L+ G +GG+   +I QPFD  K RLQ     T    +      ++ +RG   
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSIETPSQLWRGALP 62

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS--- 135
             +   VG    +++   + +A+ +    +N  S  +  L  L  Y   F+G    +   
Sbjct: 63  SCIRTSVGSAMYLTMLNSIRQAISK---GKNTGSTGSSYLPQLNMYENMFSGAVTRALTG 119

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYF 195
            +  PI  +++R ++      + ++      I +        RG   T LR++   G+Y 
Sbjct: 120 LITMPITVIKVRYESTLYQYTSLRY--ATSHIFRTEGLRGFFRGFGATALRDAPYAGLYM 177

Query: 196 LTYE-------ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL----MIYPLDVIKSV 244
           L Y+        L+ + + K  S +   T+   L   +S  +  +    +  P D +K+ 
Sbjct: 178 LFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTR 237

Query: 245 MQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
           MQ    L+P +  +       I +   + + F G    + R A + G  +  +E
Sbjct: 238 MQ----LEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYE 287

>Scas_702.10
          Length = 302

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 109/280 (38%), Gaps = 25/280 (8%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL-DVVKKLVKNEGFRGFYKGTLTPLVGVG 88
           G A G+   ++  P D  KVRLQ + +P   L  ++  +++NE   G Y G    ++   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 89  ACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYL-CGFAGGTANSFLASPIEHVRIR 147
              +V+FG  + MK        N  P   +  + Y L C    G     + +  + V IR
Sbjct: 76  TYTTVRFGAYDLMKE-------NLIPQGHINDMVYLLPCSMFSGAIGGLVGNFADVVNIR 128

Query: 148 LQTQTGTGAAAQ--FHGPLDCIKKLTAN----NSLMRGLTPTMLRESHGCGVYFLTYEAL 201
           +Q  +      +  +   +D + K+  +     +L+ G  P M+R         +TY+ +
Sbjct: 129 MQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYD-V 187

Query: 202 IANELHKGVS---RSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKN 258
             N L   +S   +         L      TT+     P DVIK+ +         + ++
Sbjct: 188 FKNYLVTKLSFDPKKNSTHLSASLLAGLVATTI---CSPADVIKTRIMNA---HKTESES 241

Query: 259 MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
            +++  +     G S  F+G+ P   R  P     F   E
Sbjct: 242 AIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           +DV KK + ++G  G Y+G L  +VG+     + FG+ +++K         +G  E    
Sbjct: 161 VDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLL-----TGSLEN-SF 214

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLM 177
           L  +L G+A  T  S  + P++ VR R+   +G   A ++ G  D  +K+ A     SL 
Sbjct: 215 LASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQ--AVKYDGAFDAFRKIVAAEGIKSLF 272

Query: 178 RGLTPTMLRESHGCGV 193
           +G    +LR   G GV
Sbjct: 273 KGCGANILRGVAGAGV 288

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 129/331 (38%), Gaps = 55/331 (16%)

Query: 15  DGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVV---KKLVKNE 71
           D   D + ++  +++G  GG          DT K R Q +       +++   + +   E
Sbjct: 45  DSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEE 104

Query: 72  GFR-GFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAG 130
           G R G Y G +  ++G     ++ FG  E  KR   +   +   N+T+  L     GF G
Sbjct: 105 GVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKR---TMIEDWQINDTITHLS---AGFLG 158

Query: 131 GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPL-----------DCIKKLTANN---SL 176
              +SF+  P E ++ RLQ Q       +F+ P            + IK +       SL
Sbjct: 159 DFISSFVYVPSEVLKTRLQLQ------GRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSL 212

Query: 177 MRGLTPTMLRESHGCGVYFLTYEAL--IANELHKGVSRS-EIPTWKLCLFGATSGTTLWL 233
             G   T+ R+     + F  YE    +A ++ +   R  E+      L GA +G    +
Sbjct: 213 FFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGI 272

Query: 234 MIYPLDVIKSVMQTDSLLQPKQGKNMLQVA--------------------KTIYSTRGLS 273
           +  P+DV+K+ +QT     P Q      V                     +T+Y + G+ 
Sbjct: 273 ITTPMDVVKTRVQTQQ--PPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVL 330

Query: 274 SFFKGFGPTMLRAAPANGATFATFELAMRVL 304
            FF G GP  +  +  +      +++ +R L
Sbjct: 331 GFFSGVGPRFVWTSVQSSIMLLLYQMTLRGL 361

>Kwal_27.11419
          Length = 298

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 84/187 (44%), Gaps = 22/187 (11%)

Query: 123 YYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTP 182
           +++ GF GG  ++ +  P + ++ RLQ    +         LD ++ +     L +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL-------LDVVRSIETPGQLWKGTLP 62

Query: 183 TMLRESHGCGVYFLT---YEALIANELHKGV-----SRSEIPT---WKLCLFGATSGTTL 231
           + LR S G  ++  T     + IA++  KG+     S S +P    ++  + GA +   +
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 232 WLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANG 291
            +   P+ V+K   ++         K++ + A  IY + G+   F G G T++R AP  G
Sbjct: 123 GVATMPITVLKVRFESTMY----NYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 292 ATFATFE 298
                +E
Sbjct: 179 LYVLFYE 185

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 113/292 (38%), Gaps = 31/292 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKL-VKNEGFRGFYKGTLTPLV 85
            + G  GG++  +I QPFD  K RLQ +   +  LDVV+ +    + ++G     L   V
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNK-SSNLLDVVRSIETPGQLWKGTLPSALRTSV 69

Query: 86  GVGACVS----VQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPI 141
           G    +S    V+  + +   +    +NG+S     L + +  + G     A      PI
Sbjct: 70  GSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPI 129

Query: 142 EHVRIRLQTQ----TGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLT 197
             +++R ++        G AA        I +      L  G   T++R++   G+Y L 
Sbjct: 130 TVLKVRFESTMYNYKSLGEAATH------IYRSEGIRGLFSGCGATVMRDAPYAGLYVLF 183

Query: 198 YE-----------ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ 246
           YE             +      GV  ++  T    +   +S +    +  P D IK+ MQ
Sbjct: 184 YEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTRMQ 243

Query: 247 TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
               L P Q    +Q  K+I       + F G    + R A + G  +  +E
Sbjct: 244 ----LNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 89/200 (44%), Gaps = 23/200 (11%)

Query: 128 FAGGTANSFLA---SPIEHVRIRLQ--------TQTGTGAAAQFHGPLDCIKKLTANNSL 176
           F G  A  F A   +P+E V+ +LQ        T+T        +     +K +  + +L
Sbjct: 163 FCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRAL 222

Query: 177 MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSR--SEIPTWKLCL----FGATSGTT 230
            +GL  T+ R+     +Y+ +YE L    L    +R  S+   W   +     G  SG  
Sbjct: 223 FKGLEITLWRDVPFSAIYWSSYE-LCKERLWLDSTRFASKDANWVHFINSFASGCISGMI 281

Query: 231 LWLMIYPLDVIKSVMQTDSL--LQPKQG---KNMLQVAKTIYSTRGLSSFFKGFGPTMLR 285
             +  +P DV K+  Q   +    PK G   +NM +  +TI+ T GL++ + G    +++
Sbjct: 282 AAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIK 341

Query: 286 AAPANGATFATFELAMRVLG 305
             P+     +++E++ +V G
Sbjct: 342 IRPSCAIMISSYEISKKVFG 361

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 94/252 (37%), Gaps = 69/252 (27%)

Query: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQ------TGTGAAA---------- 158
           + +L L +  L   AG    S + +P++ VRIRLQ Q      +  GAA           
Sbjct: 7   SNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAVSSGSK 66

Query: 159 ----------------------------------QFHGPLDCIKKLTANN---SLMRGLT 181
                                             +F+G L+   K+ +     SL RG++
Sbjct: 67  MKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGIS 126

Query: 182 PTMLRESHGCGVYFLTYEALIANELHKGVS--RSEIPTWKLCLFGATSGTTLWLMIYPLD 239
            T+L       VYF  YE +      + VS   S  PT      GA +       I PL+
Sbjct: 127 LTLLMAIPANMVYFSGYEYI------RDVSPIASTYPTLNPLFCGAIARVFAATSIAPLE 180

Query: 240 VIKSVMQTDSLLQPKQGKNMLQVAKTIYSTR------GLS-SFFKGFGPTMLRAAPANGA 292
           ++K+ +Q+      K  K  + V   +  TR      G S + FKG   T+ R  P +  
Sbjct: 181 LVKTKLQSIP-RSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAI 239

Query: 293 TFATFELAMRVL 304
            ++++EL    L
Sbjct: 240 YWSSYELCKERL 251

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 114/286 (39%), Gaps = 34/286 (11%)

Query: 45  DTTKVRLQTSSVPTTA-----LDVVKKLVKNEGFR-GFYKGTLTPLVGVGACVSVQFGVN 98
           DT K R Q    P+T      +   + ++  EG R G Y G    ++G     ++ F   
Sbjct: 77  DTVKTRQQ--GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATY 134

Query: 99  EAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTG--- 155
           E  KR      G  G NET   L     GF G   +SF+  P E ++ RLQ Q       
Sbjct: 135 EYTKR---KMIGEWGINETFSHLT---AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPF 188

Query: 156 --AAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEAL--IANELHK 208
             +   +    D +  +       +L  G   T+ R+    G+ F  YE    +A  +  
Sbjct: 189 FRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVEN 248

Query: 209 GVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQ------- 261
                ++      + GA +G    ++  PLDV+K+ +QT     P+     L+       
Sbjct: 249 KTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNS 308

Query: 262 VAK---TIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           + K   T+Y T GL+  F G GP  +  +  +      +++A++ L
Sbjct: 309 ITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTL 354

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 116/282 (41%), Gaps = 23/282 (8%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLV-KNEGFRGFYKG--TLTP 83
           LL   + G+ ++ +  P DT   RL ++    T+   +  ++ ++     F K   TL P
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFP 73

Query: 84  LVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
            +G  A   +     ++G     NE + + F     ++  ++T   L+    G   G   
Sbjct: 74  GLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGE 133

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVY 194
             L  P++ ++I+ QT      A +  G L  +K     N L RG   T  R + G   +
Sbjct: 134 IVLL-PLDVLKIKRQTNP---EAFKGRGFLKILKDEGIFN-LYRGWGWTAARNAPGS--F 186

Query: 195 FLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDSLLQP 253
            L      A E   G+      TW      +  G +  L++  PLDVIK+ +Q  +   P
Sbjct: 187 ALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNP 246

Query: 254 KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
           + G    ++ K      G ++FFKG  P +L   P    +FA
Sbjct: 247 ESG---FKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PTTALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G  + +++  P D  K R+Q  +   P +   +VK  +KNEGF  F+KG   
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTP 271

Query: 83  PLVGVGACVSVQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 114/284 (40%), Gaps = 27/284 (9%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFR---GFYKGTLTP 83
           LL   + G+ ++ +  P DT   RL ++    T+   + +++  + F    G    TL P
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFP 73

Query: 84  LVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
            +G  A   V     ++G     NE + + +     N    +T   ++    G   G   
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGE 133

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN--SLMRGLTPTMLRESHGCG 192
             L  P++ ++I+ QT   +     F      IK L      +L RG   T  R + G  
Sbjct: 134 IVLL-PLDVLKIKRQTNPESFKGRGF------IKILRDEGLFNLYRGWGWTAARNAPGS- 185

Query: 193 VYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDSLL 251
            + L      A E   G+      TW      +  G    L++  PLDVIK+ +Q  +  
Sbjct: 186 -FALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFD 244

Query: 252 QPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
            P+ G   L++ K      G+++FFKG  P +L   P    +FA
Sbjct: 245 NPESG---LRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PTTALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G  S +++  P D  K R+Q  +   P + L +VK  +KNEG   F+KG   
Sbjct: 212 QNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTP 271

Query: 83  PLVGVGACVSVQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Kwal_23.3529
          Length = 395

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 109/297 (36%), Gaps = 58/297 (19%)

Query: 45  DTTKVRLQTS-SVPT--TALDVVKKLVKNEGFR-GFYKGTLTPLVGVGACVSVQFGVNEA 100
           DT K R Q + + P     +   +K+   EG R G Y G    ++G     ++ FG  E 
Sbjct: 107 DTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFFGTYEL 166

Query: 101 MKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQF 160
            KR       + G NETL  L     G +G   +S +  P E ++ RLQ Q G      F
Sbjct: 167 TKR---KLIDDWGVNETLSHLT---AGLSGDLVSSVVYVPSEVLKTRLQLQ-GCYNNPHF 219

Query: 161 HG---------PLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVS 211
           H           +  I +L    +L  G   T+ R+       F  YE            
Sbjct: 220 HSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE------------ 267

Query: 212 RSEIPTWKLCLFGATSGTTLWLM----------------IYPLDVIKSVMQT-------- 247
             +   W   L G T    L L+                  P+DVIK+ +QT        
Sbjct: 268 --KFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVAS 325

Query: 248 DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           DS    +   ++++    +Y + G   FF G GP  +  +  +      +++ ++ L
Sbjct: 326 DSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSL 382

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 23/183 (12%)

Query: 17  AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKL 67
           +H    +  ++ AG   GV    IG P    K R+Q+ S           T+A + +  +
Sbjct: 120 SHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATI 179

Query: 68  VKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYLC 126
            ++EG +G ++G    ++  G   +VQ  +    K F    +  N G    L LL   + 
Sbjct: 180 FRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTG--LHLLSSTIA 237

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMRGLTPT 183
           GF  G A     +P + V  R+  Q G      + GP+DC  K   N   ++L +G    
Sbjct: 238 GFGVGVA----MNPWDVVLTRVYNQKGN----LYSGPIDCFIKTVRNEGLSALYKGFGAQ 289

Query: 184 MLR 186
           +LR
Sbjct: 290 ILR 292

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 116/295 (39%), Gaps = 37/295 (12%)

Query: 17  AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ--------TSSVPTTALDVVKKLV 68
           AH  ++ F   +AG       V +  PFD  K R+Q         + V T  +     + 
Sbjct: 15  AHKVSK-FGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIF 73

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR---NGNSGPNETLGLLQYYL 125
           KNEG  G  KG  +  +   A    + G  E ++   ++    N  S   + +G+     
Sbjct: 74  KNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGI--NVA 131

Query: 126 CGFAGGTANSFLASPIEHVRIRLQTQTG-------TGAAAQFHGPLDCIKKLTANNSLMR 178
            G   G   +F+ SP+  V+ R+Q+ +        T   + F+G L  I +      L R
Sbjct: 132 AGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNG-LATIFRSEGIKGLFR 190

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPL 238
           G+   MLR   G  V    Y  +  N L K    ++     L L    +G  + + + P 
Sbjct: 191 GVDAAMLRTGIGSAVQLPIYN-ICKNFLLKHDLMNDGTGLHL-LSSTIAGFGVGVAMNPW 248

Query: 239 DVIKSVMQTDSLLQPKQGKNMLQ-----VAKTIYSTRGLSSFFKGFGPTMLRAAP 288
           DV+ + +         Q  N+         KT+    GLS+ +KGFG  +LR  P
Sbjct: 249 DVVLTRVYN-------QKGNLYSGPIDCFIKTV-RNEGLSALYKGFGAQILRIGP 295

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 74/192 (38%), Gaps = 16/192 (8%)

Query: 129 AGGTANSF---LASPIEHVRIRLQTQ--TGTGAAAQFHGPLDCIKKLTANNS---LMRGL 180
           AGG A      + +P + V+ R+Q Q      AA  +  P+     +  N     L +GL
Sbjct: 26  AGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGL 85

Query: 181 TPTMLRESHGCGVYFLTYE---ALIANELHKGVSRSEIPTWKLCLF-GATSGTTLWLMIY 236
               L +    G     YE    ++ N  +  V   ++    + +  GATSG     +  
Sbjct: 86  ASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGS 145

Query: 237 PLDVIKSVMQTDS----LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           PL ++K+ MQ+ S    + Q     +      TI+ + G+   F+G    MLR    +  
Sbjct: 146 PLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAV 205

Query: 293 TFATFELAMRVL 304
               + +    L
Sbjct: 206 QLPIYNICKNFL 217

>Scas_562.12
          Length = 300

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 115/282 (40%), Gaps = 23/282 (8%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFR---GFYKGTLTP 83
           LL   + G+ ++ +  P DT   RL ++         + +++  E F    G    TL P
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFTLFP 73

Query: 84  LVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
            +G  A   V     ++G     NE + + +     ++   +T   ++    G   G   
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGIGE 133

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVY 194
             L  P++ ++I+ QT      A +  G +  +K     N L RG   T  R + G   +
Sbjct: 134 IVLL-PLDVLKIKRQTNP---EAFKGRGFVKILKDEGIFN-LYRGWGWTAARNAPGS--F 186

Query: 195 FLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDSLLQP 253
            L      A E   G+      +W      +  G +  L++  PLDVIK+ +Q  S   P
Sbjct: 187 ALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNP 246

Query: 254 KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
           + G   L + K  +   G+++FFKG  P +L   P    +FA
Sbjct: 247 ETG---LTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PTTALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G    +++  P D  K R+Q  S   P T L +VK   KNEG   F+KG   
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKGLTP 271

Query: 83  PLVGVGACVSVQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 83/183 (45%), Gaps = 21/183 (11%)

Query: 127 GFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLR 186
           GF GG  ++ +  P + ++ RLQ    T            +K++ +   L RG  P+ LR
Sbjct: 14  GFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWG-------TLKEIRSPKQLWRGALPSSLR 66

Query: 187 ESHGCGVYFLTYEALIANELHKGVSRS---------EIPTWKLCLFGATSGTTLWLMIYP 237
            S G  +Y  T   +    + KG +++         ++  ++    GA +   +  +  P
Sbjct: 67  TSIGSALYLSTLN-VFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMP 125

Query: 238 LDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           + +IK  ++ +S +     K++ +  + IYST G+  FF G G T++R AP  G     +
Sbjct: 126 ITIIK--VRYESTMYSY--KSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLY 181

Query: 298 ELA 300
           E A
Sbjct: 182 EKA 184

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 111/290 (38%), Gaps = 30/290 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVK-NEGFRGFYKGTLTPLV 85
           L+ G  GG++  ++ QPFD  K RLQ +   TT    +K++    + +RG    +L   +
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNK-DTTLWGTLKEIRSPKQLWRGALPSSLRTSI 69

Query: 86  GVGACVSVQFGVNEAM-KRFFHSRNGNSGPNETLGLLQYYLCG-FAGGTANSFLASPIEH 143
           G    +S       AM K    + N  S     L + +    G F  G    F+  PI  
Sbjct: 70  GSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVG-FITMPITI 128

Query: 144 VRIRLQTQTGT----GAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYE 199
           +++R ++   +    G A +     + I+          G   T++R++   G+Y L YE
Sbjct: 129 IKVRYESTMYSYKSLGEATRHIYSTEGIR------GFFNGCGATVMRDAPYAGLYVLLYE 182

Query: 200 A---LIANEL--------HKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248
               L+   L          G+  +   T    +    S +    +  P D IK+ MQ D
Sbjct: 183 KAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLD 242

Query: 249 SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
               P +     +    I S     + F G    + R A + G  +  +E
Sbjct: 243 ----PTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYE 288

>Scas_721.129
          Length = 323

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 119/312 (38%), Gaps = 52/312 (16%)

Query: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTS--------SVPTTALDVVKKLVKNEGFRG 75
           F   +AG       V    P +  K+R+Q           V    +  +  + +NEG RG
Sbjct: 22  FGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRG 81

Query: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFF----HSRNGNSGPNETLGLLQYYLCGFAGG 131
             KG +   +        Q G+N +   F+    ++ N    PNE    +Q      A G
Sbjct: 82  LQKGLVAAYI-------YQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAG 134

Query: 132 TAN----SFLASPIEHVRIRLQTQT-GTGAAAQFH-----GPLDCIKKLTANNSLMRGLT 181
            ++    + + SP+  V+ R+Q+ +       Q H       L  I +      L RG+ 
Sbjct: 135 ASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGID 194

Query: 182 PTMLRESHGCGVYFLTYEA----LIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYP 237
             +LR   G  V    Y      L+ N+L K     + P   L      SG  + +++ P
Sbjct: 195 AAILRTGAGSSVQLPIYNTAKNFLLKNDLMK-----DGPGLHLTA-STISGLGVAVVMNP 248

Query: 238 LDVIKSVMQTDSLLQPKQGKNMLQ-----VAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
            DVI + +         Q  N+ +       KT+  T G+S+ +KGF   +LR AP    
Sbjct: 249 WDVILTRIYN-------QKGNLYKGPVDCFVKTV-RTEGISALYKGFQAQILRIAPHTII 300

Query: 293 TFATFELAMRVL 304
                E  M+++
Sbjct: 301 CLTFMEQTMKLV 312

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 76/185 (41%), Gaps = 23/185 (12%)

Query: 15  DGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT---------TALDVVK 65
           + +H   +V  ++ AG + G+   +IG P    K R+Q+ S               + + 
Sbjct: 119 EESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLS 178

Query: 66  KLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYY 124
            + + EGF+G ++G    ++  GA  SVQ  +    K F    +    GP    GL  + 
Sbjct: 179 TIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGP----GL--HL 232

Query: 125 LCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMRGLT 181
                 G   + + +P + +  R+  Q G      + GP+DC  K       ++L +G  
Sbjct: 233 TASTISGLGVAVVMNPWDVILTRIYNQKGN----LYKGPVDCFVKTVRTEGISALYKGFQ 288

Query: 182 PTMLR 186
             +LR
Sbjct: 289 AQILR 293

>Scas_613.24
          Length = 177

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 19/167 (11%)

Query: 125 LCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTM 184
           + GF GG +++    P++ ++ R+Q   G    +        IK +       RG  P+ 
Sbjct: 13  VSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWS-------AIKDIKDPIQFWRGTLPSA 65

Query: 185 LRESHGCGVYFLTYEALIANELHKGVSRS--------EIPTWKLCLFGATSGTTLWLMIY 236
           LR S G  +Y      +    +H     +        ++  ++  L GA +   +  +  
Sbjct: 66  LRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITM 125

Query: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTM 283
           P+ ++K   ++         K+M +  K IY   G+S FFKGFGPT+
Sbjct: 126 PITILKVRYESTYY----SYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 32.3 bits (72), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL-DVVKKLVKNEGFRGFYKGTL 81
           ++++LL G         I  P    KVR +++     ++ + +K + K EG  GF+KG  
Sbjct: 106 MYENLLTGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKG-F 164

Query: 82  TPLVGVG 88
            P VG+G
Sbjct: 165 GPTVGIG 171

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 61/130 (46%), Gaps = 8/130 (6%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85
           G AG VS+ ++  PF+  K+ LQ    TS+     ++ V ++ K EG  G ++G     V
Sbjct: 19  GVAGAVSRTVV-SPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCV 77

Query: 86  GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS-PIEHV 144
            +    +VQF V E  K+     +G  G  + L   +       GG   S LA+ P++ V
Sbjct: 78  RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLV 135

Query: 145 RIRLQTQTGT 154
           R RL  QT  
Sbjct: 136 RTRLSIQTAN 145

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 18/175 (10%)

Query: 124 YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGL 180
           ++ G   G  +  + SP E V+I LQ Q+ T  +A  HG ++ + ++        L RG 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSST--SAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 181 TPTMLRESHGCGVYFLTYEALIANELHKG--VSRSEIPTWKLCLFGATSGTTLWLMIYPL 238
               +R      V F+ YE    +  H    V + ++  W+    GA  G    L  YPL
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 239 DVIKS--VMQTDSL--LQPKQGKNMLQ-------VAKTIYSTRGLSSFFKGFGPT 282
           D++++   +QT +L  L   + K++ +       + KT     G+   ++G  PT
Sbjct: 133 DLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 108/248 (43%), Gaps = 22/248 (8%)

Query: 43  PFDTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101
           P D  K RLQ +  +  + LD  K +V++EG    + G     +G     + ++G  E  
Sbjct: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94

Query: 102 KRFFHSRNGNSGPNETLGLLQYYLCGFAGGT-ANSFLASPIEHVRIRLQTQTGTGAAAQF 160
           K+ +   N  S           YLC  A        L  P E ++++ QT T       F
Sbjct: 95  KQTYS--NLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT-TIPPFCKNF 151

Query: 161 HGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSE--- 214
              L+   K+TA    + L +G+TP   R+       F ++E ++   ++  + RS+   
Sbjct: 152 ---LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLPRSKQEM 207

Query: 215 IPTWKLCLF---GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRG 271
            P+ ++ +    G  +G    ++ +P DV+ S +  D     KQG++M++ +K IYS  G
Sbjct: 208 SPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSRIG 263

Query: 272 LSSFFKGF 279
               + G 
Sbjct: 264 FGGLWNGL 271

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           +++ P + IK   QT     P   KN L+    I +  GLS  +KG  P   R  P    
Sbjct: 128 ILLCPWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMC 184

Query: 293 TFATFELAMRVL 304
            F +FE  + ++
Sbjct: 185 KFTSFERIVEMI 196

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           PLD++K  +Q +    P+  ++ L   KTI  + GLS  F G G T +  +      +  
Sbjct: 35  PLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGG 90

Query: 297 FE 298
           +E
Sbjct: 91  YE 92

>Kwal_47.19228
          Length = 281

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 10/158 (6%)

Query: 143 HVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALI 202
           H R +         + QF   +  I +       ++G  PT++R++    V F TY +L 
Sbjct: 114 HPRQKWALYYDEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL- 172

Query: 203 ANELHKGVSRSEIPTWKLCLF--GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNML 260
                K +     P  +   F  G  S   +  +  P+DVIK+ MQ+         KN L
Sbjct: 173 -----KQMISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTW--SNYKNSL 225

Query: 261 QVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
             A  I+   G + F+KG+ P +++   + G +F  ++
Sbjct: 226 NCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 69/154 (44%), Gaps = 15/154 (9%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           L  V+++ ++ G RGF +GT+  ++   +  +V+F    ++K+          PN+ L  
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-------SPNKPLNE 184

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLM 177
              +  GF    A   +  PI+ ++ R+Q++      + +   L+C  ++          
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRMQSKY---TWSNYKNSLNCAYRIFVEEGFTKFW 241

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIANELHKGVS 211
           +G  P +++     GV F  Y+ +  + L K V+
Sbjct: 242 KGWAPRLMKVGLSGGVSFGVYQYV--DNLMKAVN 273

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 3/76 (3%)

Query: 38  VLIGQPFDTTKVRLQ---TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQ 94
           V + QP D  K R+Q   T S    +L+   ++   EGF  F+KG    L+ VG    V 
Sbjct: 199 VAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVS 258

Query: 95  FGVNEAMKRFFHSRNG 110
           FGV + +     + NG
Sbjct: 259 FGVYQYVDNLMKAVNG 274

>Scas_669.6
          Length = 373

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 63/296 (21%), Positives = 113/296 (38%), Gaps = 42/296 (14%)

Query: 45  DTTKVRLQTSSVPTTALDVV---KKLVKNEGF-RGFYKGTLTPLVGVGACVSVQFGVNEA 100
           DT K R Q + +     ++    + +   EG  RG Y G    ++G     ++ FG  E 
Sbjct: 73  DTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEW 132

Query: 101 MKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTG----A 156
            KR      G+ G N+T+  L     G  G   +SF+  P E ++ RLQ Q         
Sbjct: 133 CKR---KMIGDLGFNDTVSHLS---AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQ 186

Query: 157 AAQFHGPLDCIKKLTAN----NSLMRGLTPTMLRESHGCGVYFLTYEALIANELH---KG 209
           +   +  L    ++  N     +L  G   T+ R+     + F  YE           K 
Sbjct: 187 SGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKD 246

Query: 210 VSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL-LQPKQG------------ 256
           +++  +        GA +G    ++  P+DVIK+ +QT    + P               
Sbjct: 247 ITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNK 306

Query: 257 --------KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
                    ++ +  K +Y + G+  FF G GP  +  +  +      +++ +R+L
Sbjct: 307 KSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLL 362

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 122/321 (38%), Gaps = 36/321 (11%)

Query: 13  DLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRL-----QTSSVPTTALDVVKK- 66
           D+   +D  + F   +AG   GV       PFD  KV L      +S++  +  DV+ K 
Sbjct: 190 DMTLINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKN 249

Query: 67  ------------------LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSR 108
                             L +  G + FY G     + V    S++FG  E  K+   ++
Sbjct: 250 PHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLM-TK 308

Query: 109 NGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIK 168
             N    + L  L  ++ G   G    F   PI+ ++ R+Q              +   K
Sbjct: 309 VENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAK 368

Query: 169 KLTANNSL---MRGLTPTML----RESHGCGVYFLTYEALI---ANELHKGVSRSEIPTW 218
           ++     L    RG+T  +L      +   G + +  +  I   A +L+K     E+   
Sbjct: 369 EMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNL 428

Query: 219 KLCLFGATSGTTLWLMIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAKTIYSTRGLSSFFK 277
            +   GA SGT    ++YP++++++ +Q   +   P +      V        G    FK
Sbjct: 429 VVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFK 488

Query: 278 GFGPTMLRAAPANGATFATFE 298
           G  PT+ +  PA   ++  +E
Sbjct: 489 GLVPTLAKVCPAVSISYLCYE 509

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 76/189 (40%), Gaps = 15/189 (7%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT------ALDVVKKLVKNEGFRGFYKGT 80
            +AG   GV       P DT K R+Q + +          +   K++    G + FY+G 
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSR-----NGNSGPNETLGLLQYYLCGFAGGTANS 135
              ++G+    ++  G    +K+++ S      N      E   L+   +  F+G T  +
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSG-TFGA 442

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCG 192
            +  PI  +R RLQ Q       ++ G  D + K         L +GL PT+ +      
Sbjct: 443 TVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVS 502

Query: 193 VYFLTYEAL 201
           + +L YE L
Sbjct: 503 ISYLCYENL 511

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKN-MLQVAKTIYSTRGLSSFFKGFGPT 282
           G  +G      +YP+D +K  MQ   L    +G+  M+Q AK +Y+  GL  F++G    
Sbjct: 327 GGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVG 386

Query: 283 MLRAAPANGATFATFEL 299
           +L   P       TF +
Sbjct: 387 VLGIFPYAALDLGTFSM 403

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 62  DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKR 103
           DV+ K ++ EG+ G +KG +  L  V   VS+ +   E +K+
Sbjct: 472 DVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKK 513

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/68 (20%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 238 LDVIKSVMQTDSLLQPKQGKN-MLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           L+  + V+  +   +P + ++ +++   ++Y   G+ SF+ G G   L+  P +   F +
Sbjct: 239 LNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGS 298

Query: 297 FELAMRVL 304
           FE+  +++
Sbjct: 299 FEITKKLM 306

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 110/268 (41%), Gaps = 37/268 (13%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           L+ ++K+ + EG    ++G    LV       V F   EA++        NS     L +
Sbjct: 84  LEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALR-------DNSPLASRLPV 136

Query: 121 LQYYLCG-FAGGTANSFLASPIEHVRIRLQT---QTGTGAAAQFHGPLDCIKKLTANNSL 176
               +CG FA   A + +A P+E +R RLQ+      T       G  D ++++    S+
Sbjct: 137 ANPLVCGAFARILAATTIA-PLELLRTRLQSVPRARDTERTIYLIG--DLLREMRHEVSV 193

Query: 177 M------RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCL----FGAT 226
           M      +GL  T+ R+     +Y+ TYE        +  +      W   +     G+ 
Sbjct: 194 MGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSM 253

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQ------------GKNMLQVAKTIYSTRGLSS 274
            G    L+ +P DV K+ MQ  ++  P+Q             + M      I  + G+ +
Sbjct: 254 GGAVAALLTHPFDVGKTRMQI-AIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRA 312

Query: 275 FFKGFGPTMLRAAPANGATFATFELAMR 302
            + G  P +++ AP+     +T+EL+ +
Sbjct: 313 LYTGLLPRVMKIAPSCAIMISTYELSKK 340

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 82/208 (39%), Gaps = 41/208 (19%)

Query: 129 AGGTANSFLASPIEHVRIRLQTQ------TGTGA-----------------------AAQ 159
           AG    S   +P++ VR+RL  Q      T TG                        AA+
Sbjct: 20  AGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCREPAAR 79

Query: 160 FHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIP 216
             G L+ ++K+       +L RGL  T++       VYF  YEAL  N        S +P
Sbjct: 80  LQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNSPLA----SRLP 135

Query: 217 TWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGK-----NMLQVAKTIYSTRG 271
                + GA +       I PL+++++ +Q+    +  +       ++L+  +   S  G
Sbjct: 136 VANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMG 195

Query: 272 LSSFFKGFGPTMLRAAPANGATFATFEL 299
             + FKG   T+ R  P +   + T+E 
Sbjct: 196 YRALFKGLEITLWRDVPFSAIYWGTYEF 223

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 37/94 (39%), Gaps = 16/94 (17%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDV----------------VKKLVKNEGF 73
           G+ GG    L+  PFD  K R+Q +      L V                +  + K+EG 
Sbjct: 251 GSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGI 310

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107
           R  Y G L  ++ +    ++     E  K+FF S
Sbjct: 311 RALYTGLLPRVMKIAPSCAIMISTYELSKKFFTS 344

>Scas_489.4
          Length = 297

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 111/294 (37%), Gaps = 25/294 (8%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTALDVVKKLVKNEGFRGFYKGTLT 82
            +AG   G  +  I  PF+  K RLQ    TS+     L ++    K +G    Y G   
Sbjct: 14  FIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPA 73

Query: 83  PLVGVGACVSVQFGVNEAMKRFFHS--RNGNSGPNETLGLLQYYLCGFAGGTANSFLA-S 139
            +VG  A   ++F   + +K           SGP          + G   G   S +A +
Sbjct: 74  FIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGV-------VAGLGAGLLESVVAVT 126

Query: 140 PIEHVRIRL-QTQTGTGAAAQFHGP--LDCIKKLTANNSLM---RGLTPTMLRESHGCGV 193
           P E ++  L   +       Q +G   L     L  +  +M   RG+ P  +R++    V
Sbjct: 127 PFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAV 186

Query: 194 YFLTYEAL--IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251
               Y  +  +  +         + +    + GA SG        P+D +K+ MQ+   L
Sbjct: 187 RLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS---L 243

Query: 252 QPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVLG 305
              +  + +     I+   GL +F+KG  P + R   + G  F  +E  +  LG
Sbjct: 244 DATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVFLG 297

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 79/180 (43%), Gaps = 13/180 (7%)

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCI---KKLTANNSLM 177
           L  ++ G   G   + +  P E  + RLQ    T  A++   PL  I    K     ++ 
Sbjct: 11  LHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASR--NPLVLIYNTAKTQGTGAIY 68

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM-IY 236
            G    ++  +   G+ FL ++  I N L   V+  E+   +  + G  +G    ++ + 
Sbjct: 69  VGCPAFIVGNTAKAGIRFLGFDT-IKNMLRDPVT-GELSGPRGVVAGLGAGLLESVVAVT 126

Query: 237 PLDVIKSVMQTDS-LLQPK---QGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           P + IK+ +  D   L+PK    G+ ML+   ++   +G+   ++G  P  +R A AN A
Sbjct: 127 PFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQA-ANQA 185

>Scas_328.1
          Length = 227

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 11/136 (8%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120
           LDV KK +  +G  G Y+G L  +VG+     + FG+ +++K         +G  E    
Sbjct: 83  LDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLL-----TGSFEN-AF 136

Query: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLM 177
           L  +L G+A   + S  + P++ VR R+   +G   A ++ G +DC +++ +     SL 
Sbjct: 137 LPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQ--AVKYKGAIDCFQQIVSQEGVYSLF 194

Query: 178 RGLTPTMLRESHGCGV 193
           +G    + R     GV
Sbjct: 195 KGCGANIFRGVAAAGV 210

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 31/181 (17%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA---------LDVVKKLVKNEGFRGFYKGT 80
           G AGG+S + +    D  + RL   +  + +         LDV KK +K +G  G Y+G 
Sbjct: 126 GAAGGLSLLFV-YSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGF 184

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQ-----YYLCGFAGGTANS 135
           +  ++G+     + FG+ ++ K           P    G L+      +L G+      S
Sbjct: 185 VPSVLGIIVYRGLYFGLYDSFK-----------PVLLTGALEGSFVASFLLGWVITMGAS 233

Query: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCG 192
             + P++ VR R+   +G     ++ G LDC++K+       SL +G    + R     G
Sbjct: 234 TASYPLDTVRRRMMMTSGQ--TIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAG 291

Query: 193 V 193
           V
Sbjct: 292 V 292

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 25/251 (9%)

Query: 59  TALDVVKKLVKNEGFRGFYKG-TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNET 117
           +  D + K+ K EG RG Y+G T + + G     S  F  +   K +F  +  N   N  
Sbjct: 77  STFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINR-KNTK 135

Query: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTG-------AAAQFHGPLDCIKKL 170
              ++  L G      +    +PI  +  R QT+ G          A + +     IK  
Sbjct: 136 FTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYKEQRSIKGF 195

Query: 171 TA--NNSLMRGLTPTMLRESHG--CGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGAT 226
                 SLM  + P++   S+       F T    +  EL    S S++  ++    G  
Sbjct: 196 WKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVD--SSSQLSPYQNFTLGVL 253

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKN---MLQVAKTIYSTRGLSSFFKGFGPTM 283
           S     ++  PL + K+ +Q       + G N     QV   +Y   GL S++KG  P +
Sbjct: 254 SKMISAIITMPLIISKAWLQ-------RNGSNFSSFQQVLYYLYKNEGLRSWWKGLSPQL 306

Query: 284 LRAAPANGATF 294
            +     G  F
Sbjct: 307 AKGVLVQGLLF 317

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 112/285 (39%), Gaps = 30/285 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNE------GFRGFYKGT 80
           +L   + G+ ++ +  P DT   RL ++     +   +  ++  E        R F   T
Sbjct: 13  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVF---T 69

Query: 81  LTPLVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGG 131
           L P +G  A   +     ++G     NE + R F +   N+   +T   L+    G   G
Sbjct: 70  LFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIG 129

Query: 132 TANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGC 191
                L  P++ ++I+ QT      A +  G +  +K       L RG   T  R + G 
Sbjct: 130 IGEIVLL-PLDVLKIKRQTNP---EAFKGRGFVKILKD--EGLGLYRGWGWTAARNAPGS 183

Query: 192 GVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDSL 250
             + L      A E   G+      TW      +  G +  L+I  PLDVIK+ +Q  + 
Sbjct: 184 --FALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNF 241

Query: 251 LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
             P+ G     + K      G S+FFKG  P +L   P    +FA
Sbjct: 242 ENPESG---FTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PTTALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G  + ++I  P D  K R+Q  +   P +   +VK  +KNEGF  F+KG   
Sbjct: 210 QNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTP 269

Query: 83  PLVGVGACVSVQFGVNEAM 101
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFALAQTL 288

>Kwal_23.3965
          Length = 307

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/299 (18%), Positives = 110/299 (36%), Gaps = 27/299 (9%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLVKNEGFRGFYK 78
           VF+ L+AG   G+S  ++  P DT K+RLQ            L   K+LV+ EG R  +K
Sbjct: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G +  +       S QF     + +           ++    +   + G   GT ++  +
Sbjct: 74  GNVPAMAMYILYGSTQFTSYAILNKLL-------SKSQLPAQIHTGMVGALSGTCSAIAS 126

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTY 198
            P + +R R         +       + I +        +G++ +++  +        TY
Sbjct: 127 YPCDVLRTRFIANHSRELSTMLSTAQE-IWRHEGFRGFFKGVSSSIVSIAVATSSILATY 185

Query: 199 EALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIK---SVMQTDSLLQPKQ 255
           E++      +    S +           +G     +++P+D ++    V+    L  P  
Sbjct: 186 ESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGH 245

Query: 256 ------------GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMR 302
                         N L++A  I    GL + + G+   + ++ P+   +   +E  +R
Sbjct: 246 TNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCLR 304

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 4/101 (3%)

Query: 204 NELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVA 263
           + L KG    E+P ++  + G  SG +  ++  PLD +K  +Q   L    Q   +L   
Sbjct: 4   DHLRKG---QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-LANEAQYGGILVTF 59

Query: 264 KTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           K +    G+ + +KG  P M          F ++ +  ++L
Sbjct: 60  KRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100

>Kwal_26.7653
          Length = 325

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 75/181 (41%), Gaps = 21/181 (11%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKLV 68
           H    V  ++++G   G+   ++G P    K R+Q+ S           T+  + +  + 
Sbjct: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128
           + EGF+G Y+G    ++  GA  SVQ  +    K F   ++        L L+   + GF
Sbjct: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL-LKHDLMKEGTGLHLVASTVSGF 243

Query: 129 AGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKK---LTANNSLMRGLTPTML 185
             G     + +P + +  R+  Q G      + GPLDC  K   +    +L +G    + 
Sbjct: 244 GVGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIF 295

Query: 186 R 186
           R
Sbjct: 296 R 296

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/335 (20%), Positives = 119/335 (35%), Gaps = 51/335 (15%)

Query: 1   MTEELPTPLIIDDLDG-AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ------- 52
           M++E+ T  +  + D  A          +AG       V +  P +  K R+Q       
Sbjct: 1   MSKEIDTKALAAEADKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA 60

Query: 53  -TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSV-QFGVNEAMKRFFHSRNG 110
               +    +  +K + KNEG RG  KG         +C  + Q G+N +   F+     
Sbjct: 61  DAQRIYKNPMQALKVIFKNEGIRGLQKGL--------SCAYIYQIGLNGSRLGFYEPIRS 112

Query: 111 --------NSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQ--- 159
                      P++   +    + G   G   + + SP+  ++ R+Q+ +      Q   
Sbjct: 113 VLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH 172

Query: 160 ---FHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEA----LIANELHKGVSR 212
                  L  I +      L RG+   +LR   G  V    Y      L+ ++L K    
Sbjct: 173 YTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK---- 228

Query: 213 SEIPTWKLCLFGAT-SGTTLWLMIYPLDVI--KSVMQTDSLLQPKQGKNMLQVAKTIYST 269
                  L L  +T SG  + +++ P DVI  +   Q  +L      K  L         
Sbjct: 229 ---EGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLY-----KGPLDCFVKTVRI 280

Query: 270 RGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
            G+ + +KGF   + R AP         E  M+V+
Sbjct: 281 EGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 118/295 (40%), Gaps = 29/295 (9%)

Query: 31  TAGGVSQ---VLIGQPFDTTKVRLQ--------TSSVPTTALDVVKKLVKNEGFRGFYKG 79
           TAGG++    V +  P +  K+R+Q           + T     +  + +NEG RG  KG
Sbjct: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82

Query: 80  TLTPLVGVGACVSVQFGVNE----AMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135
            +   +   A    + G  E     M + F+  +  S   +++G+  +   G A G   +
Sbjct: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNKTFYP-DQESHKVQSVGINVF--AGAASGIIGA 139

Query: 136 FLASPIEHVRIRLQTQTGT---GAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESH 189
            + SP+  V+ RLQ+ +     G    + G  + +K +        L RG+   +LR   
Sbjct: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199

Query: 190 GCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
           G  V    Y     N L +     + P+  L      SG  + +++ P DVI + +    
Sbjct: 200 GSSVQLPIYNTA-KNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYNQK 257

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
               K   + L   KT+    G+++ +KGF   + R  P         E  M+++
Sbjct: 258 GDLYKGPIDCL--VKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 75/182 (41%), Gaps = 21/182 (11%)

Query: 17  AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKL 67
           +H    V  ++ AG A G+   ++G P    K RLQ+ S           T   + +K +
Sbjct: 118 SHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTI 177

Query: 68  VKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCG 127
              EG +G ++G    ++  GA  SVQ  +    K F   RN       +L L    + G
Sbjct: 178 YMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LRNDIMEDGPSLHLTASTISG 236

Query: 128 FAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCI---KKLTANNSLMRGLTPTM 184
              G A   + +P + +  R+  Q G      + GP+DC+    K+    +L +G    +
Sbjct: 237 L--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQV 288

Query: 185 LR 186
            R
Sbjct: 289 FR 290

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 131/337 (38%), Gaps = 64/337 (18%)

Query: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT-----ALDVV 64
           + DD    ++ + ++   LAG  GG+         DT K R Q    P        L   
Sbjct: 44  LFDD----YEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ--GAPNVHKYKHMLQAY 97

Query: 65  KKLVKNEGF-RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQY 123
           + +   EGF RG Y G    ++G     ++ F   E  KR   +   +   N+T   L  
Sbjct: 98  RTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKR---TMINDYHLNDTFSHLT- 153

Query: 124 YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPT 183
              GF G   +SF+  P E ++ RLQ Q G      F+           N   +R    T
Sbjct: 154 --AGFLGDFFSSFVYVPSEVLKTRLQLQ-GCYNNPHFNSGY--------NYKSLRNAIAT 202

Query: 184 MLRESHGCGVYFLTYEALIANELH---------------------KGVSRSEIPTWKLCL 222
           + R + G    F  Y+A +A +L                      K + + ++      +
Sbjct: 203 IYR-TEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIV 261

Query: 223 FGATSGTTLWLMIYPLDVIKSVMQTD--------------SLLQPKQGKN-MLQVAKTIY 267
            GA +G    ++  PLDV+K+ +QT               ++ +P    N + +  +T+Y
Sbjct: 262 TGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVY 321

Query: 268 STRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           ++ G   FF G GP  +  +  +      +++A+RVL
Sbjct: 322 TSEGFFGFFSGVGPRFVWTSVQSSIMLLLYQMALRVL 358

>Kwal_27.11626
          Length = 299

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 114/286 (39%), Gaps = 32/286 (11%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNE------GFRGFYKGT 80
           +L   + G+ ++ +  P DT   RL ++    ++   +  ++  E      G R F   T
Sbjct: 13  VLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLF---T 69

Query: 81  LTPLVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGG 131
           L P +G  A   +     ++G     NE + + F +   N+   +T   L+    G   G
Sbjct: 70  LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIG 129

Query: 132 TANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN-SLMRGLTPTMLRESHG 190
                L  P++ ++I+ QT   +     F      IK L      L RG   T  R + G
Sbjct: 130 IGEIVLL-PLDVLKIKRQTNPESFKGRGF------IKILKDEGFGLYRGWGWTAARNAPG 182

Query: 191 CGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDS 249
              + L      A E   G+      TW      +  G +  L++  PLDVIK+ +Q   
Sbjct: 183 S--FALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRH 240

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
              P+ G    ++ +      G+++FFKG  P +L   P    +FA
Sbjct: 241 FDNPESG---FRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PTTALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G  + +++  P D  K R+Q      P +   +V+  +KNEG   F+KG   
Sbjct: 210 QNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGITAFFKGLTP 269

Query: 83  PLVGVGACVSVQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 270 KLLTTGPKLVFSFALAQSL 288

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 111/268 (41%), Gaps = 32/268 (11%)

Query: 61  LDVVKKLVKNEGFRGFYKG-TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG 119
           L+  +K+ K EG    ++G ++T L+ + A V V F   E    +   R+  +G   T+ 
Sbjct: 114 LEAFEKIAKFEGVTTLWRGISITLLMAIPANV-VYFTGYE----YVRDRSPLNGLYPTIN 168

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQT----QTGTGAAAQFHGPLDCIKKLTA--- 172
            L   +CG    T  +   +P+E ++ +LQ+        G+   +    + IK   A   
Sbjct: 169 PL---ICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRG 225

Query: 173 -NNSLMRGLTPTMLRESHGCGVYFLTYE------ALIANELHKGVSRSEIPTWKLCLFGA 225
              ++ +GL  T+ R+     +Y+ +YE      A ++       S +        L G 
Sbjct: 226 VAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGF 285

Query: 226 TSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKT---------IYSTRGLSSFF 276
            SG+   +  +P DV K+  Q   +   K   + L+   +         I  T G+ + +
Sbjct: 286 ISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALY 345

Query: 277 KGFGPTMLRAAPANGATFATFELAMRVL 304
            G  P + + AP+     +++EL  R+ 
Sbjct: 346 TGLAPRVAKIAPSCAIMISSYELTKRLF 373

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 176 LMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSE-IPTWKLCLFGATSGTTLWLM 234
            ++G  PT+ R+     V F TY +     L + +S ++ +  +   + G  S   +  +
Sbjct: 286 FVQGTAPTIFRQMGNSAVRFTTYTS-----LKQLISPNKPLNEYYAFVLGFISSCAVVAV 340

Query: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
             P+DVIK+ MQ+         KN L  A  I+   G+  F+KG+ P +++   + G +F
Sbjct: 341 TQPIDVIKTRMQSKYAW--ANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSF 398

Query: 295 ATFE 298
             ++
Sbjct: 399 GVYQ 402

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 65/156 (41%), Gaps = 14/156 (8%)

Query: 48  KVRLQTSSVPTTAL-DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFH 106
           ++ L     PT+     VK++    G RGF +GT   +       +V+F    ++K+   
Sbjct: 257 RLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLI- 315

Query: 107 SRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDC 166
                  PN+ L     ++ GF    A   +  PI+ ++ R+Q++    A A +   L+C
Sbjct: 316 ------SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKY---AWANYKNSLNC 366

Query: 167 IKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYE 199
             ++          +G  P +++     GV F  Y+
Sbjct: 367 AYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQ 402

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---ALDVVKKLVKNEGFRGFYKGTLTP 83
            + G     + V + QP D  K R+Q+         +L+   ++   EG   F+KG    
Sbjct: 327 FVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPR 386

Query: 84  LVGVGACVSVQFGVNEAMK 102
           L+ VG    V FGV + ++
Sbjct: 387 LMKVGLSGGVSFGVYQYVE 405

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 263 AKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
            K IY TRGL  F +G  PT+ R    +   F T+
Sbjct: 274 VKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTY 308

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 69/163 (42%), Gaps = 10/163 (6%)

Query: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLT 197
           A P++    R         ++ F G +  I +       ++G  PT+ R+     V F T
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 198 YEALIANEL--HKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255
           Y A I   L  HK +       ++    GA S   +  +  P+DVIK+ MQ+ +      
Sbjct: 233 Y-AWIVQSLSPHKALDE-----YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTY- 285

Query: 256 GKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
            K+ L  A  I+   G    +KG+ P + + + + G +F  ++
Sbjct: 286 -KSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---ALDVVKK 66
           I+  L   H +   ++   AG     + V + QP D  K R+Q+ +   T   +L+   +
Sbjct: 236 IVQSLS-PHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYR 294

Query: 67  LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK 102
           +   EGFR  +KG +  L  V     + FGV + ++
Sbjct: 295 IFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVE 330

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 57/139 (41%), Gaps = 13/139 (9%)

Query: 64  VKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQY 123
           V ++ +  G RGF +G +  +        V+F     + +       +  P++ L   Q 
Sbjct: 199 VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQ-------SLSPHKALDEYQA 251

Query: 124 YLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGL 180
           +  G     A   L  PI+ ++ R+Q++T   A   +   L+C  ++        + +G 
Sbjct: 252 FAAGALSSAAVVALTQPIDVIKTRMQSKT---AWFTYKSSLNCAYRIFVEEGFRYMWKGW 308

Query: 181 TPTMLRESHGCGVYFLTYE 199
            P + + S   G+ F  Y+
Sbjct: 309 VPRLFKVSLSGGISFGVYQ 327

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 62/134 (46%), Gaps = 10/134 (7%)

Query: 27  LLAGTAGGVSQVLIGQPF----DTTKVRLQTSS-----VPTTALDVVKKLVKNEGFRGFY 77
           ++ G  GGV+Q  +   F     T ++  Q ++     +P ++  V K + K EG RG  
Sbjct: 106 IMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGIN 165

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137
           KG     +        +FG++  ++       G +G ++ L  L+  +    GG  +++ 
Sbjct: 166 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAW- 224

Query: 138 ASPIEHVRIRLQTQ 151
             PIE +R+ +Q++
Sbjct: 225 NQPIEVIRVEMQSK 238

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 111/286 (38%), Gaps = 32/286 (11%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKG------- 79
           +L   + G+ ++ +  P DT   RL ++     +   +  ++    FR F          
Sbjct: 14  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVI----FRDFASEPLGRRLL 69

Query: 80  TLTPLVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAG 130
           +L P +G  A   +     ++G     NE + + F      +   +T   L+    G   
Sbjct: 70  SLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLI 129

Query: 131 GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHG 190
           G     L  P++ ++I+ QT      + +  G L  IK       L RG   T  R + G
Sbjct: 130 GIGEIVLL-PLDVLKIKRQTNP---ESFKGRGFLKIIKD--EGFGLYRGWGWTAARNAPG 183

Query: 191 CGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDS 249
              + L      A E   G+      TW      +  G +  L++  PLDVIK+ +Q  +
Sbjct: 184 S--FALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRN 241

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
              P+ G    ++ K      G ++FFKG  P +L   P    +FA
Sbjct: 242 FDNPESG---FKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFA 284

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--PTTALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G  + +++  P D  K R+Q  +   P +   ++K  +KNEGF  F+KG   
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTP 270

Query: 83  PLVGVGACVSVQFGVNEAMKRFFHS 107
            L+  G  +   F + + +   F +
Sbjct: 271 KLLTTGPKLVFSFALAQTLIPIFDN 295

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 27/184 (14%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTK-----VRLQTSSVP----TTALDVVKKLVKNEGFRGFY 77
           +L G +GGV+Q  +   F T        R + +S P     ++L V K++   EG RG  
Sbjct: 111 ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGIN 170

Query: 78  KGT----LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTA 133
           KG     +  +   G+   +   V + ++R  H R+     +E L  ++  +    GG  
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRS-----DEKLSAMEKIVASALGGGL 225

Query: 134 NSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHG 190
           +++   PIE +R+ +Q++T      +        + +  NN    L RG+TP +     G
Sbjct: 226 SAW-NQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI-----G 279

Query: 191 CGVY 194
            GV+
Sbjct: 280 LGVW 283

>Kwal_33.15597
          Length = 305

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 26  DLLAGTAGGVSQVLIGQPFDT--TKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTP 83
           +LL+G   G++  ++ QP DT  +KV     +   + + ++ +L K  GF G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTR 272

Query: 84  LVGVGACVSVQFGVNEAMKR 103
           LV VG   S+QFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 80/189 (42%), Gaps = 17/189 (8%)

Query: 122 QYYLCGFAG-GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLM 177
           ++ L G  G GT +S +  PI+ V+ R+Q +          G +   K++ ++    +L+
Sbjct: 15  KFALAGAIGCGTTHSAMV-PIDVVKTRIQLEP----TVYNKGMISSFKQIISSEGAGALL 69

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLW---LM 234
            G  PT+L  S      F  YE +        +   +   +K  ++  ++    +   + 
Sbjct: 70  TGFGPTLLGYSLQGSFKFGGYE-VFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIA 128

Query: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
           + PL+  +  + +    QP     ++     I    GLSSF+ GF P + +  P N A F
Sbjct: 129 LCPLEATRIRLVS----QPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKF 184

Query: 295 ATFELAMRV 303
             FE A  V
Sbjct: 185 LVFERAAEV 193

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 71/181 (39%), Gaps = 27/181 (14%)

Query: 43  PFDTTKVRLQTSSVPTT----ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           P D  K R+Q    PT      +   K+++ +EG      G    L+G     S +FG  
Sbjct: 33  PIDVVKTRIQLE--PTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 99  EAMKRFFHSRNGNSGPNETLGLLQ---YYLCGFAGGTA-NSFLAS----PIEHVRIRLQT 150
           E  K+ F          +TLG  Q   Y    + G  A   F A     P+E  RIRL +
Sbjct: 91  EVFKKLFI---------DTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVS 141

Query: 151 QTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGV 210
           Q     A    G    I K    +S   G TP + ++       FL +E   A E++ G+
Sbjct: 142 QPTF--ANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFER--AAEVYFGM 197

Query: 211 S 211
           +
Sbjct: 198 A 198

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 109/278 (39%), Gaps = 47/278 (16%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT-ALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           +AG+ GG + + +  P  T    LQT        L+ +K++    G  G++ G  + + G
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 87  VGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQY------YLCGFAGGTANSFLASP 140
           +     V +        +F+     +    TL   QY       L     G+  +  ++P
Sbjct: 76  MATTNFVYY--------YFYEWCAKTA--RTLTTKQYLSTWESILASTIAGSMTAVASNP 125

Query: 141 IEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLT 197
           I     R+        A   H  L  +  +   +   +L+ GL P ++  S+   + +  
Sbjct: 126 IWVANTRMT------VAKSNHSTLRTVIDIVKTDGPLTLLNGLKPALVLVSNPI-IQYTV 178

Query: 198 YEALIANELHKGVSRSEI--PTWKLCLFG----ATSGTTLWLMIYPLDVIKS---VMQTD 248
           YE L    L   + R ++  P+W   L      A +GTT     YP   +K+   +MQ D
Sbjct: 179 YEQL--KNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTT-----YPYITLKTRMHLMQND 231

Query: 249 SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRA 286
               PK  K+M  +   I    G+S  + G    ++++
Sbjct: 232 ----PKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQS 265

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 72/181 (39%), Gaps = 21/181 (11%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKLV 68
           H    V  ++ AG   G+   ++G P    K R+Q+ S           T+  + +  + 
Sbjct: 124 HKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIF 183

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128
           K EG  G ++G    ++  GA  SVQ  +    K F   +N        L LL   + G 
Sbjct: 184 KKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLL-QNDIMKEGTALHLLSSTVTGL 242

Query: 129 AGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCI---KKLTANNSLMRGLTPTML 185
             G     + +P + V  R+  Q G      + GP+DC+    K+    +L +G    + 
Sbjct: 243 GVG----IVMNPWDVVLTRVYNQKGN----TYKGPIDCMFKTIKIEGIGALYKGFGAQLF 294

Query: 186 R 186
           R
Sbjct: 295 R 295

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 122/330 (36%), Gaps = 45/330 (13%)

Query: 2   TEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV----- 56
           +E  P      +   A   ++V   +  G A  ++ V +  PF+  K R+Q         
Sbjct: 3   SENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIA-VTVTNPFELVKTRMQLQGEMSATN 61

Query: 57  ------PTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM-----KRFF 105
                 P  AL V+    KNEG +G  +G ++  V        + G  E +     K FF
Sbjct: 62  QRIYRNPFQALGVI---FKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFF 118

Query: 106 HSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQT-GTGAAAQFH--- 161
                 S P++   +      G   G   + + SP+  V+ R+Q+ +       Q H   
Sbjct: 119 PE----SDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTS 174

Query: 162 --GPLDCIKKLTANNSLMRGLTPTMLRESHGCGV----YFLTYEALIANELHKGVSRSEI 215
               L  I K      L RG+   +LR   G  V    Y  T   L+ N++ K       
Sbjct: 175 MSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMK------- 227

Query: 216 PTWKLCLFGAT-SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSS 274
               L L  +T +G  + +++ P DV+ + +      +    K  +          G+ +
Sbjct: 228 EGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQ---KGNTYKGPIDCMFKTIKIEGIGA 284

Query: 275 FFKGFGPTMLRAAPANGATFATFELAMRVL 304
            +KGFG  + R AP         E  M+++
Sbjct: 285 LYKGFGAQLFRIAPHTILCLTFMEQTMKLV 314

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 8/133 (6%)

Query: 27  LLAGTAGGVSQVLIGQPF-------DTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKG 79
           ++ G +GGV+Q  +   F       + TK +   +    ++    K++   EG RG  KG
Sbjct: 109 IMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGINKG 168

Query: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139
                +        +FG +  ++       G + P++ L  L+       GG  +++   
Sbjct: 169 VNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAW-NQ 227

Query: 140 PIEHVRIRLQTQT 152
           PIE +R+ +Q++T
Sbjct: 228 PIEVIRVEMQSKT 240

>Kwal_34.15907
          Length = 312

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 62/133 (46%), Gaps = 9/133 (6%)

Query: 27  LLAGTAGGVSQVLIGQPF-------DTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYK 78
           ++ G +GGV+Q  +   F       + TK +   + ++P ++    K++   EG +G  K
Sbjct: 112 IMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINK 171

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G     +        +FG++  +++      G + P++ L  L+       GG  +++  
Sbjct: 172 GVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAW-N 230

Query: 139 SPIEHVRIRLQTQ 151
            PIE +R+ +Q++
Sbjct: 231 QPIEVIRVEMQSK 243

>Scas_715.45
          Length = 305

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           +M+ P + IK   QT     P    N+++  K +Y+  GL+ F+KG  P   R  P    
Sbjct: 131 IMLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187

Query: 293 TFATFE 298
            F +FE
Sbjct: 188 KFTSFE 193

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 7   TPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP--TTALDVV 64
           T L+ D+       T ++  L + TA   + +++  PF+  KV+ QT+  P     ++  
Sbjct: 101 THLVKDEATAYKYRTSIYL-LSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGW 158

Query: 65  KKLVKNEGFRGFYKGTLTPL 84
           KK+   EG  GFYKG +TPL
Sbjct: 159 KKMYAKEGLNGFYKG-ITPL 177

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296
           PLD+IK  +Q D  L       ++Q+ K      GL   F G G T +  +      +  
Sbjct: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILK----KEGLGKLFTGVGATCIGYSLQGAGKYGG 91

Query: 297 FELAMRV 303
           +EL  R+
Sbjct: 92  YELFKRL 98

>Kwal_55.21106
          Length = 328

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 96/250 (38%), Gaps = 25/250 (10%)

Query: 60  ALDVVKKLVKNEGFRGFYKGTLTPLV-GVGACVSVQFGVNEAMKRFFHSR--NGNSGPNE 116
           +LD + K+ K +G  G Y+G  T ++ G     S  F  +   K FF  +   G  G   
Sbjct: 63  SLDALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFS 122

Query: 117 TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN-NS 175
           T   L   L G      +    SPI  +  R QT T +G+   F   L  I     N   
Sbjct: 123 TPEEL---LLGIVAAAVSQIFTSPIGVISTRQQTST-SGSKGGFREVLHQIYSEQNNITG 178

Query: 176 LMRGLTPTMLRESHGCGVYFLTYEAL--IANELHKGVSRS--------EIPTWKLCLFGA 225
             RG   +++   +   + F +YE L  I     + V  +        ++   +  L G 
Sbjct: 179 FWRGFKVSLILTVNPS-ITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGV 237

Query: 226 TSGTTLWLMIYPLDVIKSVMQ-TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284
            S     L+  PL V K+ +Q T S  Q  Q     QV   +Y   GL S +KG  P + 
Sbjct: 238 FSKVISTLITQPLIVSKAYLQRTGSNFQSFQ-----QVLLYLYKQEGLISLWKGLAPQLS 292

Query: 285 RAAPANGATF 294
           +     G  F
Sbjct: 293 KGILVQGLLF 302

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 9/63 (14%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQT---------DSLLQPKQGKNMLQVAKTIYSTRGLSS 274
           GA + +   +++YPLD++K+++QT         ++ ++P+  K+ +Q  +  +S   L  
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 275 FFK 277
            FK
Sbjct: 70  IFK 72

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 79/209 (37%), Gaps = 36/209 (17%)

Query: 125 LCGFAGGTANSFLASPIEHVRIRL------------QTQTGTGAAAQFHG------PLDC 166
           + G   G   S    P E+++  L            + Q    A A FH       P+  
Sbjct: 80  IAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVAR 139

Query: 167 IKKLTAN----------NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIP 216
           I+KL              + ++G T T+ R+     + F  Y A       +    S + 
Sbjct: 140 IEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSVI 199

Query: 217 TWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFF 276
           T      G  +  TL  M  P+DV+K+ M + +     + KN L     I+   G+++F+
Sbjct: 200 T------GLATSFTLVAMTQPIDVVKTRMMSQN--AKTEYKNTLNCMYRIFVQEGMATFW 251

Query: 277 KGFGPTMLRAAPANGATFATFELAMRVLG 305
           KG     ++   + G TF  +E    +LG
Sbjct: 252 KGSIFRFMKVGISGGLTFTVYEQVSLLLG 280

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 66/179 (36%), Gaps = 51/179 (28%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKV---------------------------RLQTSSVPTT 59
           L+AGT  G+ + L   PF+  K                            ++ T S P  
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 60  ALD----VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPN 115
            ++     VK + +  G   F +GT   +    A  S+QF    A KR   +RN  +   
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV 198

Query: 116 ETLGLLQYYLCGFAGGTANSF----LASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL 170
            T             G A SF    +  PI+ V+ R+ +Q    A  ++   L+C+ ++
Sbjct: 199 IT-------------GLATSFTLVAMTQPIDVVKTRMMSQ---NAKTEYKNTLNCMYRI 241

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 103/274 (37%), Gaps = 32/274 (11%)

Query: 43  PFDTTKVRLQT----SSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           PF+  K RLQ     S      L ++ +  + +G    Y G    +VG      V+F   
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 99  EAMKRFFHSRNGN-SGPNETLGLLQYYLCGFAGGTANSFLA-SPIEHVRIRL-------- 148
           +A++R      G  SGP          L G   G   S LA +P E V+  L        
Sbjct: 90  DALRRALQDERGALSGPRGM-------LAGLGAGLLESVLAVTPFEAVKTALIDDRQAAR 142

Query: 149 --QTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALI-ANE 205
                 G GAA  +   L  +        L+    P  LR++    V F  Y  L  A +
Sbjct: 143 PRYQHNGRGAARNYALLLRELGLRGLYGGLV----PVALRQASNQAVRFGCYTQLKQAVQ 198

Query: 206 LHKGVSRSE-IPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAK 264
            + G    + + + +  L GA SG        P+D +K+ MQ    L   +  + +   +
Sbjct: 199 RYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA---LDAARYGSTVGCFR 255

Query: 265 TIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298
            +    G+ + ++G  P + R   + G  F  +E
Sbjct: 256 AVVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

>Scas_705.9
          Length = 323

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 99/243 (40%), Gaps = 21/243 (8%)

Query: 66  KLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS----RNGNSGPNETLGLL 121
           ++ +  G RG Y+G  T +          F     ++R + S    RN  + P  ++  +
Sbjct: 62  RIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTV 121

Query: 122 QYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN---NSLMR 178
           +  + G         + +PIE +  + QT T       F+  L  I  + +N   +S  +
Sbjct: 122 EELIVGVGAAALTQVVNNPIEVILTKQQT-TDDKDNVDFYSVLKQIY-VESNGKLSSYWK 179

Query: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSE------IPTWKLCLFGATSGTTLW 232
           G   +++  +    + F  Y+    + L K VS SE      +   +  + GA +     
Sbjct: 180 GFKVSLIL-TVNPSITFAAYQRF-KDILLKQVSNSEKSYSGQLTVNQNFILGALAKIIST 237

Query: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
           ++  PL V K  +Q  +     + K+  +V + +Y   G+ + +KG GP + +     G 
Sbjct: 238 IITQPLIVAKVSLQRSN----SKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGL 293

Query: 293 TFA 295
            FA
Sbjct: 294 VFA 296

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 11/72 (15%)

Query: 224 GATSGTTLWLMIYPLDVIKSVMQ-------TDSLLQPKQ----GKNMLQVAKTIYSTRGL 272
           GA + T   +++YPLDV K+V+Q       TD L +  +     +N+++    I+  RGL
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 273 SSFFKGFGPTML 284
              ++G   ++ 
Sbjct: 70  RGLYQGMSTSVF 81

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 73/182 (40%), Gaps = 23/182 (12%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV---------PTTALDVVKKLV 68
           H    V  ++ +G A G+   +IG P    K RLQ+ S           T   + +  + 
Sbjct: 123 HKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182

Query: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYLCG 127
           K EG +G ++G    ++  GA  SVQ  +    K      +    GP   L L    + G
Sbjct: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGP--ALHLTASTISG 240

Query: 128 FAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKK---LTANNSLMRGLTPTM 184
              G A   + +P + +  R+  Q G      + GP+DC+ K   +    +L +G    +
Sbjct: 241 L--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAAQV 292

Query: 185 LR 186
            R
Sbjct: 293 FR 294

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 82/198 (41%), Gaps = 28/198 (14%)

Query: 129 AGGTANSF---LASPIEHVRIRLQTQ--TGTGAAAQFHGPLDCIKKLTANNS---LMRGL 180
           AGG A      + +PIE ++IR+Q Q      AA  +  P+  +  +  N     L +GL
Sbjct: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87

Query: 181 TPTMLRESHGCGVYFLTYEALIAN---------ELHKGVSRSEIPTWKLCLF-GATSGTT 230
               + +    G     YE + ++         E HK      + +  + +F GA SG  
Sbjct: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK------VQSVGVNVFSGAASGII 141

Query: 231 LWLMIYPLDVIKSVMQTDS-LLQPKQGKNMLQVAK---TIYSTRGLSSFFKGFGPTMLRA 286
             ++  PL ++K+ +Q+ S  ++  +  +   V     TI+ T G+   F+G    +LR 
Sbjct: 142 GAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201

Query: 287 APANGATFATFELAMRVL 304
              +      +  A  +L
Sbjct: 202 GAGSSVQLPIYNTAKNIL 219

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 58/133 (43%), Gaps = 9/133 (6%)

Query: 27  LLAGTAGGVSQVLIGQPF--------DTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYK 78
           ++ G  GGV+Q  +   F         T K      ++P ++    K++ K +G +G  K
Sbjct: 112 IMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINK 171

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G     +        +FG +  ++    +  G + P++ L  L+       GG  +++  
Sbjct: 172 GVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAW-N 230

Query: 139 SPIEHVRIRLQTQ 151
            PIE +R+ +Q++
Sbjct: 231 QPIEVIRVEMQSK 243

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 112/285 (39%), Gaps = 30/285 (10%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNE------GFRGFYKGT 80
           ++   + G+ ++ +  P DT   RL ++    T    +  +V  E      G R F   T
Sbjct: 13  VVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHASKPFGQRLF---T 69

Query: 81  LTPLVGVGACVSV-----QFG----VNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGG 131
           L P +G  A   +     ++G     NE + + F +    +   +T   L+    G   G
Sbjct: 70  LFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAGSLIG 129

Query: 132 TANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGC 191
                L  P++ ++I+ QT      + +  G L  ++       L RG   T  R + G 
Sbjct: 130 IGEIVLL-PLDVLKIKRQTNP---ESFRGRGFLRILRD--EGMGLYRGWGWTAARNAPGS 183

Query: 192 GVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIY-PLDVIKSVMQTDSL 250
             + L      A E   G+      TW      +  G +  L++  PLDVIK+ +Q+ + 
Sbjct: 184 --FALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNF 241

Query: 251 LQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
              + G     + K      G ++FFKG  P +L   P    +FA
Sbjct: 242 ESAESG---FTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT--TALDVVKKLVKNEGFRGFYKGTLT 82
           ++ ++   G  + +++  P D  K R+Q+ +  +  +   +VK  +KNEG   F+KG   
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTP 269

Query: 83  PLVGVGACVSVQFGVNEAM 101
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFAIAQTL 288

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 108/284 (38%), Gaps = 29/284 (10%)

Query: 44  FDTTKVRLQTSSVPTTALDVV---KKLVKNEGFR-GFYKGTLTPLVGVGACVSVQFGVNE 99
            DT K R Q +        ++   + L   EG R G Y G    ++G     +V FG  E
Sbjct: 74  LDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFGTYE 133

Query: 100 AMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTG---- 155
            +KR           +ET   L     GF G   +S +  P E ++ RLQ Q        
Sbjct: 134 WVKR---QMINEWQIHETYSHLA---AGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHF 187

Query: 156 -AAAQFHGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGVYFLTYEAL--IANELHKG 209
            +   + G  D ++ +      ++L  G   T+ R+     + F  YE     A  L + 
Sbjct: 188 QSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERK 247

Query: 210 VSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQT---------DSLLQPKQGKNML 260
                +      + GA++G    ++  PLDV+K+ +QT         D+    +   ++ 
Sbjct: 248 PVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIF 307

Query: 261 QVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           +    +    GL   F G GP  +  +  +      ++ A+R L
Sbjct: 308 RSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALRTL 351

>Scas_673.17
          Length = 314

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 78/190 (41%), Gaps = 17/190 (8%)

Query: 121 LQYYLCGFAG-GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SL 176
            ++ L G  G GT +S L  P++ V+ R+Q +          G +   KK+ A+    +L
Sbjct: 21  FKFALAGAIGCGTTHSSLV-PVDVVKTRIQLE----PTVYNKGMVGSFKKIIADEGAGAL 75

Query: 177 MRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM-- 234
           + G  PT+L  S      F  YE      +   +       +K  ++  ++    +L   
Sbjct: 76  LTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDT-IGYENAVHYKNSVYMGSAAVAEFLADI 134

Query: 235 -IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGAT 293
            + PL+  +  + +    QP     ++     I    G+ SF+ GF P + +  P N A 
Sbjct: 135 ALCPLEATRIRLVS----QPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAK 190

Query: 294 FATFELAMRV 303
           F  FE A  V
Sbjct: 191 FLVFERASEV 200

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDT--TKVRLQTSSVPTTALDVVKKLVKNEGFRGF 76
           D T    +LL+G   G +   + QP DT  +KV     +   + + ++ +L K  G  G 
Sbjct: 213 DMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGS 272

Query: 77  YKGTLTPLVGVGACVSVQFGVNEAMKR 103
           + G  T L+ VG   S+QF +  ++K 
Sbjct: 273 FAGLPTRLIMVGTLTSLQFAIYGSLKN 299

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 5/102 (4%)

Query: 199 EALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPK-QGK 257
            A    + HK    +    +K  L GA    T    + P+DV+K+ +Q    L+P    K
Sbjct: 2   SATTTTDAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQ----LEPTVYNK 57

Query: 258 NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
            M+   K I +  G  +   GFGPT+L  +      F  +E+
Sbjct: 58  GMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEV 99

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 80/205 (39%), Gaps = 27/205 (13%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT----ALDVVKKLVKNEGF 73
           + ++  FK  LAG  G  +      P D  K R+Q    PT      +   KK++ +EG 
Sbjct: 15  YAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLE--PTVYNKGMVGSFKKIIADEGA 72

Query: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL---LQYYLCGFAG 130
                G    L+G     + +FG  E  K+            +T+G    + Y    + G
Sbjct: 73  GALLTGFGPTLLGYSVQGAFKFGGYEVFKKL---------SIDTIGYENAVHYKNSVYMG 123

Query: 131 GTA-NSFLAS----PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTML 185
             A   FLA     P+E  RIRL +Q     A    G    I K     S   G TP + 
Sbjct: 124 SAAVAEFLADIALCPLEATRIRLVSQPTF--ANGLVGGFSRILKEEGVGSFYSGFTPILF 181

Query: 186 RESHGCGVYFLTYEALIANELHKGV 210
           ++       FL +E   A+E++ G+
Sbjct: 182 KQIPYNIAKFLVFER--ASEVYYGI 204

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 104/251 (41%), Gaps = 35/251 (13%)

Query: 43  PFDTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101
           P D  K RLQ +  + T+ L   +K++ NEG++  Y G     VG     + ++G  E  
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97

Query: 102 KRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS----PIEHVRIRLQTQTGTGAA 157
           K  + S      P  T+ L+       A  TA  FLA     P E ++++ QT       
Sbjct: 98  KHLYSSW---LSPGVTVYLM-------ASATAE-FLADIMLCPFEAIKVKQQTTMPPFC- 145

Query: 158 AQFHGPLDCIKKLTANN----SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRS 213
              +  +D  KK+ A +    +  +G+ P   R+       F ++E ++  +++  + + 
Sbjct: 146 ---NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV-QKIYSVLPKK 201

Query: 214 EIPTWKLCLF------GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIY 267
           +     L         G  +G     + +P DV+ S + ++     K  ++M   +K IY
Sbjct: 202 KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIY 257

Query: 268 STRGLSSFFKG 278
              G +  + G
Sbjct: 258 QKIGFTGLWNG 268

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 22/167 (13%)

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR---GLTPTMLRES-HGCGVY 194
           +P++ V+ RLQ          +   L   +K+ AN    +   G   T +  S  G G Y
Sbjct: 37  TPLDLVKCRLQVN-----PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91

Query: 195 --FLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ 252
             +  ++ L ++ L  GV+   + +       AT+     +M+ P + IK   QT     
Sbjct: 92  GGYEYFKHLYSSWLSPGVTVYLMAS-------ATAEFLADIMLCPFEAIKVKQQTT---M 141

Query: 253 PKQGKNMLQVAKTIYSTRG-LSSFFKGFGPTMLRAAPANGATFATFE 298
           P    N++   K +Y+  G + +F+KG  P   R  P     F +FE
Sbjct: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 58/133 (43%), Gaps = 9/133 (6%)

Query: 27  LLAGTAGGVSQVLIGQPF----DTTKVRLQTSS----VPTTALDVVKKLVKNEGFRGFYK 78
           +L G  GGV+Q  +   F     T ++    S+    VP ++  V K + K EG RG  K
Sbjct: 114 ILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINK 173

Query: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLA 138
           G     +        +FG++  ++       G +  ++ L   +       GG  +++  
Sbjct: 174 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGLSAW-N 232

Query: 139 SPIEHVRIRLQTQ 151
            PIE +R+ +Q++
Sbjct: 233 QPIEVIRVEMQSK 245

>Kwal_55.21338
          Length = 323

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 100/260 (38%), Gaps = 35/260 (13%)

Query: 43  PFDTTKVRLQTSSVPTTAL---DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNE 99
           P      +LQT       L   D +K + + +G  GF+ G  + L G      V +   E
Sbjct: 42  PLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYE 101

Query: 100 AMKR-FFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAA 158
           A  R    +R+      + L   +  L G   G+ N+  A+P+     R+  Q       
Sbjct: 102 ASSRCVLRARH-----TQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD---- 152

Query: 159 QFHGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEI 215
              G L  I  +  +   + L +GL P ++   +   + +  YE L    L    +R+  
Sbjct: 153 --RGTLSTIFDIVKDEGISGLFKGLNPALILVINPI-IQYTVYEQLKNWILSSRQTRTLS 209

Query: 216 PTWKLCLFG----ATSGTTLWLMIYPLDVIKSVM-----QTDSLLQPKQGKNMLQVAKTI 266
           P+W   L      A +G+T     YP   +K+ M        S   P   +++L +   I
Sbjct: 210 PSWAFILGAVGKLAATGST-----YPYVTMKARMHLLGEHKSSTAAPP--RSLLSLMAEI 262

Query: 267 YSTRGLSSFFKGFGPTMLRA 286
               G+   ++G G  ++++
Sbjct: 263 IKKDGILGLYRGIGIKLVQS 282

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 48/125 (38%), Gaps = 5/125 (4%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPL 84
           + +L G+  G        P      R+         L  +  +VK+EG  G +KG L P 
Sbjct: 120 ESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFDIVKDEGISGLFKG-LNPA 178

Query: 85  VGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHV 144
           + +     +Q+ V E +K +  S    S    TL     ++ G  G  A +    P   +
Sbjct: 179 LILVINPIIQYTVYEQLKNWILS----SRQTRTLSPSWAFILGAVGKLAATGSTYPYVTM 234

Query: 145 RIRLQ 149
           + R+ 
Sbjct: 235 KARMH 239

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 53/148 (35%), Gaps = 6/148 (4%)

Query: 137 LASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFL 196
           L  P+  V  +LQTQ   G        +  I +         GL   +   +    VY+ 
Sbjct: 39  LTYPLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYY 98

Query: 197 TYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG 256
            YEA  +  + +      + T +  L G+ +G+       PL V  + M        K  
Sbjct: 99  CYEA-SSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQ-----KSD 152

Query: 257 KNMLQVAKTIYSTRGLSSFFKGFGPTML 284
           +  L     I    G+S  FKG  P ++
Sbjct: 153 RGTLSTIFDIVKDEGISGLFKGLNPALI 180

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 10/126 (7%)

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFG--ATSGTTLW 232
           +  +G  PT+ R+     V F TY  L      K +     P  +   FG    S   + 
Sbjct: 208 TFFQGSMPTIFRQVGNSAVRFTTYTTL------KQMISPNKPLSEYYAFGIGVFSSCAVV 261

Query: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292
            +  P+DV+K+ MQ+         +N L      +   GL+S +KG+ P + +   + G 
Sbjct: 262 ALTQPIDVVKTRMQSKYTWS--LYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGV 319

Query: 293 TFATFE 298
           +F  ++
Sbjct: 320 SFGVYQ 325

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 60/145 (41%), Gaps = 13/145 (8%)

Query: 58  TTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNET 117
           T     V+++V+  GF  F++G++  +       +V+F     +K+          PN+ 
Sbjct: 191 TNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI-------SPNKP 243

Query: 118 LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN--- 174
           L     +  G     A   L  PI+ V+ R+Q++      + +   L+C+ +        
Sbjct: 244 LSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKY---TWSLYRNSLNCVYRTFIEEGLT 300

Query: 175 SLMRGLTPTMLRESHGCGVYFLTYE 199
           SL +G  P + +     GV F  Y+
Sbjct: 301 SLWKGWVPRLFKVGLSGGVSFGVYQ 325

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQ---TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           G     + V + QP D  K R+Q   T S+   +L+ V +    EG    +KG +  L  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 87  VGACVSVQFGV 97
           VG    V FGV
Sbjct: 313 VGLSGGVSFGV 323

 Score = 31.2 bits (69), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 51/288 (17%), Positives = 96/288 (33%), Gaps = 77/288 (26%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKV--RLQTSSVPTTALDVVKKLVKNEGFRGFYKGT 80
           ++ +LLAG+A  V Q  +  PF+  K   +L  S     A ++   +      + ++ G 
Sbjct: 8   LYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAFNMFHHV------KSYFAGC 61

Query: 81  LTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASP 140
               +G+    + +F   +   +          P   L L+     G   G   S L  P
Sbjct: 62  SALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIA---AGSITGFMESMLIIP 118

Query: 141 IEHVRIRL-----------QTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESH 189
            E+++ R+           Q +  TG         D  +  + NN               
Sbjct: 119 FENIKTRMIENALILSNRYQEEVETGGK-------DKPRSKSVNN--------------- 156

Query: 190 GCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
                 +  +  I  +L+K V +   P ++  L+     +T                   
Sbjct: 157 ------METKEQIRPKLYKQVKKEINPRYEKFLYYEKHPST------------------- 191

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
                   N+    + +  TRG ++FF+G  PT+ R    +   F T+
Sbjct: 192 --------NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTY 231

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 90/244 (36%), Gaps = 16/244 (6%)

Query: 60  ALDVVKKLVKNEGFRGFYKGTLTPLV-GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETL 118
           ALD ++++   EG  G Y+G  +  V G     S  F      K +F  +    G +   
Sbjct: 75  ALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGG-DARF 133

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178
              +  + G      +    +PI  V  R QT+     AA        +           
Sbjct: 134 STPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAENGWRGFWA 193

Query: 179 GLTPTMLRESHGCGVYFLTYEALI-------ANELHKGVSRSEIPTWKLCLFGATSGTTL 231
           GL  +++   +   + + TYE L        A   H   S + +   +  + G  S    
Sbjct: 194 GLKVSLVLTVNPS-ITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVLSKIVS 252

Query: 232 WLMIYPLDVIKSVMQ-TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPAN 290
            ++  PL + K+ +Q + S  Q     +  QV   +YST G  S +KG GP + +     
Sbjct: 253 TVLTQPLIIAKASLQRSGSCFQ-----DFHQVLHHLYSTEGPLSLWKGLGPQITKGVLVQ 307

Query: 291 GATF 294
           G  F
Sbjct: 308 GLLF 311

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 111/299 (37%), Gaps = 40/299 (13%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLVKNEGFRGFYKGTLT 82
           ++AG+  G+    +  P DT K+R Q            L   + + + EG R  +KG + 
Sbjct: 28  VVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87

Query: 83  PLVGVGACVSVQFGVNEAMKRFFHSRNGNSG-PNETLGLLQYYLCGFAGGTANSFLASPI 141
                    S+QFG       + ++   ++G P +   L      G   G  +S L  P+
Sbjct: 88  ASAMYVLYGSLQFGTYA----WLNTAAASAGLPPQAHSL----AVGALAGLVSSLLTYPL 139

Query: 142 EHVRIRLQTQTGTGAAAQFHG---PLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTY 198
           + +R RL        +A F         I          RG    +   +   G+ F  Y
Sbjct: 140 DLLRTRLVANR----SAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIY 195

Query: 199 EAL-IANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQ-TDSLLQP--- 253
           E   IA + +       +P W       T+G      ++PLD ++  +Q  D+   P   
Sbjct: 196 ETCTIAADTYG------LP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFT 248

Query: 254 --------KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
                    +G   L +A  +    G++S +KG    + ++ P    T   ++  +R+L
Sbjct: 249 RDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 77/196 (39%), Gaps = 17/196 (8%)

Query: 106 HSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLD 165
           H R G     E +  L   + G   G     + +P++ V+IR Q Q  +    ++HG L 
Sbjct: 15  HLRKG-----EAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLAS--EHKYHGILH 67

Query: 166 CIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCL 222
             + +       +L +G  P          + F TY  L       G+     P      
Sbjct: 68  TFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLP----PQAHSLA 123

Query: 223 FGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPT 282
            GA +G    L+ YPLD++++ +  +   +     ++ + A+ I+ T G + FF+G    
Sbjct: 124 VGALAGLVSSLLTYPLDLLRTRLVAN---RSAHFFSLRRQARVIWDTEGPAGFFRGGAWA 180

Query: 283 MLRAAPANGATFATFE 298
           +       G  F  +E
Sbjct: 181 IAATTLTTGLIFGIYE 196

>Kwal_23.5757
          Length = 307

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 98/261 (37%), Gaps = 37/261 (14%)

Query: 43  PFDTTKVRLQT-SSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101
           P D  K R Q  +S+  + LD  +++V++EG    + G     +G     + ++G  E  
Sbjct: 39  PLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE-- 96

Query: 102 KRFFHSRNGNSGPNETLGLLQYYLCG--FAGGTANSFLAS----PIEHVRIRLQTQTGTG 155
             FF  +       ET      Y  G   A   +  F+A     P E +++R QT     
Sbjct: 97  --FFKHQYSQLVSPETA---HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP 151

Query: 156 AAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSR 212
            A       D   K+       SL +G+TP   R+       F ++E ++        +R
Sbjct: 152 FARNV---FDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV----EMIYAR 204

Query: 213 SEIPTWKLCLFGATS---------GTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVA 263
              P  ++   G  S         G    ++ +P DV+ S +  +     K G++ LQ  
Sbjct: 205 LPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER----KSGESTLQAT 260

Query: 264 KTIYSTRGLSSFFKGFGPTML 284
             IY   G    + G    +L
Sbjct: 261 SRIYGKIGFPGLWNGLAVRIL 281

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 70/172 (40%), Gaps = 14/172 (8%)

Query: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYF 195
           +P++ V+ R Q       A+ +   LD  +++  +     +  G+  T +  S      +
Sbjct: 38  TPLDLVKCRRQVD-----ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92

Query: 196 LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL---MIYPLDVIKSVMQTDSLLQ 252
             YE    ++  + VS     +++  +F A S +  ++    + P + IK   QT   + 
Sbjct: 93  GGYE-FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA--VP 149

Query: 253 PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304
           P   +N+      +    G +S +KG  P   R  P     F +FE  + ++
Sbjct: 150 PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201

>Scas_696.9
          Length = 312

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 64/154 (41%), Gaps = 10/154 (6%)

Query: 45  DTTKVRLQTSSVPT-TALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKR 103
           + T+++  ++  P  ++ +V + +   EG RG YKG     +        +FG +  ++ 
Sbjct: 137 EITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVED 196

Query: 104 FFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQ---F 160
           +     G + P + L   +       GG  +++   PIE +R+ +Q++       +    
Sbjct: 197 WVRKATGKTKPEDRLNAWEKIGATAVGGGLSAW-NQPIEVIRVEMQSKKEDPNRPKNLTV 255

Query: 161 HGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVY 194
                 I K      L RG+TP +     G G++
Sbjct: 256 AKTFKYIMKTNGVKGLYRGVTPRI-----GLGIW 284

>Scas_687.15*
          Length = 328

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 64/150 (42%), Gaps = 14/150 (9%)

Query: 54  SSVPTTAL-DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNS 112
           S  P++ +  VVK++    G RGF +G +  +    +  +V+F     +K+         
Sbjct: 173 SKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI------- 225

Query: 113 GPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTA 172
            P + L  +  +  G     A   L  PI+ V+ R+Q++T   A   +   L+C  ++  
Sbjct: 226 SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKT---AHYFYKNSLNCAYRVFV 282

Query: 173 NN---SLMRGLTPTMLRESHGCGVYFLTYE 199
                SL +G  P + +     G+ F  Y+
Sbjct: 283 EEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVP---TTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           G     + V + QP D  K R+Q+ +       +L+   ++   EG    +KG L  L  
Sbjct: 240 GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFK 299

Query: 87  VGACVSVQFGVNEAMKRFFHS 107
           VG    + FGV + ++   H+
Sbjct: 300 VGLSGGISFGVYQYVENLSHT 320

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 258 NMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297
           N+  V K IY TRGL  F +G  PT+ R    +   F  +
Sbjct: 179 NIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAY 218

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 88/245 (35%), Gaps = 18/245 (7%)

Query: 60  ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLG 119
           ALDV+ K+ +NEGF G Y G    L+G        F     ++R +       G      
Sbjct: 90  ALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFS 149

Query: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCI----------KK 169
            ++  L        +    +PI  V  + QT+ G      F      +          K 
Sbjct: 150 TIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGITGFWKS 209

Query: 170 LTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGT 229
           L    SL+  + P++   S       L +    A +L+   S  ++   +  L G  S  
Sbjct: 210 LKV--SLVLTINPSITYASAEKLKDILYHVEWNAKDLND--SSLQLKPGQNFLIGVLSKI 265

Query: 230 TLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPA 289
               + +PL V K+ +Q  S     +  +  +V   +Y   G  + +KG  P + +    
Sbjct: 266 ISTCLTHPLIVAKASLQRSS----SKFTSFQEVLTYLYRHEGAHALWKGLLPQLTKGVIV 321

Query: 290 NGATF 294
            G  F
Sbjct: 322 QGLLF 326

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 70/171 (40%), Gaps = 23/171 (13%)

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFL 196
           PI+ V+ R+Q +          G +   K++ A     +L+ G  PT+L  S      F 
Sbjct: 37  PIDVVKTRIQLE----PTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFG 92

Query: 197 TYEAL----IANELHKGVSRSEIPTWKLCLFGATSGTTLWLM---IYPLDVIKSVMQTDS 249
            YE      I N  +   SR     +K  ++  ++    +L    + PL+  +  + +  
Sbjct: 93  GYEVFKKFFIDNLGYDTASR-----YKNSVYMGSAAMAEFLADIALCPLEATRIRLVS-- 145

Query: 250 LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
             QP+    ++     I    G+ SF+ GF P + +  P N A F  FE A
Sbjct: 146 --QPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERA 194

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 83/221 (37%), Gaps = 37/221 (16%)

Query: 43  PFDTTKVRLQTSSVPTT----ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           P D  K R+Q    PT      +   K+++  EG      G    L+G     + +FG  
Sbjct: 37  PIDVVKTRIQLE--PTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 99  EAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS-FLAS----PIEHVRIRL--QTQ 151
           E  K+FF    G    +      +Y    + G  A + FLA     P+E  RIRL  Q Q
Sbjct: 95  EVFKKFFIDNLGYDTAS------RYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQ 148

Query: 152 TGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVS 211
              G    F      I K     S   G TP + ++       FL +E   A+E + G +
Sbjct: 149 FANGLVGGF----SRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFER--ASEFYYGFA 202

Query: 212 RSEIPTWKLC---------LFGATSGTTLWLMIYPLDVIKS 243
               P  KL          L G T+G    ++  P D + S
Sbjct: 203 G---PKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLS 240

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 23  VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL--------DVVKKLVKNEGFR 74
           ++K  +   +GGV+Q L+  PFD  + R Q  ++    L        D +  + K EG +
Sbjct: 11  LYKLAMGAISGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPK 69

Query: 75  GFYKGTLTPLVGVGACVSVQFGVNEAMKR 103
           G+YKG    L  V    +V + V E ++ 
Sbjct: 70  GYYKGLTANLFKVIPSTAVSWLVYEVIRE 98

 Score = 32.0 bits (71), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 218 WKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG---KNMLQVAKTIYSTRGLSS 274
           +KL + GA SG     ++YP D+++   Q  ++   + G   K++     TI  T G   
Sbjct: 12  YKLAM-GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKG 70

Query: 275 FFKGFGPTMLRAAPANGATFATFEL 299
           ++KG    + +  P+   ++  +E+
Sbjct: 71  YYKGLTANLFKVIPSTAVSWLVYEV 95

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 108/264 (40%), Gaps = 43/264 (16%)

Query: 43  PFDTTKVRLQT-----SSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGV 97
           P  T   +LQT     ++   + L+ +K++ + +G  GFY G  + + G+     V +  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 98  NEAMKRFFHSRNG-NSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQ-TQTGTG 155
            E       SRN      ++ L  L+  L G   G+  +  ++PI     R+  T++   
Sbjct: 93  YE-----LTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKT 147

Query: 156 AAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVY--FLTYEALIANELHKGVSRS 213
           A A     ++ +KK +A  +L  GL P ++   +    Y  F   + L+     +G+   
Sbjct: 148 ALATI---IEIVKKDSA-KTLFNGLKPALVLVMNPIVQYTVFEQLKNLVLAWNKQGILS- 202

Query: 214 EIPTWKLCLFG----ATSGTTLWLMIYPLDVIKSVMQ---------TDSLLQPK----QG 256
             P+W   L      A +G+T     YP   +K+ M           DS  + K      
Sbjct: 203 --PSWAFLLGALGKLAATGST-----YPYITLKTRMHLSESGKHTDDDSGKKAKGHKASS 255

Query: 257 KNMLQVAKTIYSTRGLSSFFKGFG 280
           K+ML +   I    G+S  ++G G
Sbjct: 256 KSMLSLITEIVKKDGVSGLYRGVG 279

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%)

Query: 234 MIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGAT 293
           + YPL  I + +QT    +  Q K+ L+  K IY   GL  F+ G    +   A  N   
Sbjct: 30  LTYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVY 89

Query: 294 FATFELAMR 302
           +  +EL  R
Sbjct: 90  YYFYELTSR 98

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 36/92 (39%), Gaps = 1/92 (1%)

Query: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFY 77
           H      + +L G   G    +   P      R+  +    TAL  + ++VK +  +  +
Sbjct: 106 HKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTALATIIEIVKKDSAKTLF 165

Query: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN 109
            G    LV V   + VQ+ V E +K    + N
Sbjct: 166 NGLKPALVLVMNPI-VQYTVFEQLKNLVLAWN 196

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 100/257 (38%), Gaps = 39/257 (15%)

Query: 43  PFDTTKVRLQTS-------SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQF 95
           P  T   R+Q S       +   + L+ V+++ + EG  GFY G  + + G+ A     +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 96  GVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRL---QTQT 152
              E   R      G+   N +  +    L     G+  +  ++PI  V  R+   +++ 
Sbjct: 96  YFYELAARATMRVRGSRRLNTSEAI----LSSAVAGSMTAIASNPIWVVNTRMTVAKSEQ 151

Query: 153 GTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSR 212
            T A       LD ++K     +L  GL P ++  S+   + +  +E L    L    S 
Sbjct: 152 STLAVL-----LDIVRK-DGVTALFNGLRPALMLVSNPI-IQYTVFEQLKNVVLKWSGSD 204

Query: 213 SEIPTWKLCLFG----ATSGTTLWLMIYPLDVIKSVM-----QTDSLLQPKQGKNMLQVA 263
             +P+W   L      A +G+T     YP   +K+ M     + D+  Q      M+ + 
Sbjct: 205 VLLPSWAFLLGAVGKLAATGST-----YPYITLKTRMHLAKGKEDADTQQSMWSLMVDIV 259

Query: 264 KTIYSTRGLSSFFKGFG 280
           K      G+   + G G
Sbjct: 260 K----KEGIQGLYHGIG 272

>CAGL0D05500g complement(524950..526083) highly similar to sp|P48362
           Saccharomyces cerevisiae YGR187c HGH1, start by
           similarity
          Length = 377

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 68/154 (44%), Gaps = 10/154 (6%)

Query: 135 SFLASPIEHVR-IRLQTQTG--TGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGC 191
           SFL SP   VR I L    G  TG +A      D  + L     LM+  + T++++S   
Sbjct: 10  SFLHSPQPAVRQIALDNLVGFSTGPSASIFK-YDNYRALDDLKVLMKEKSRTLVQQS-AT 67

Query: 192 GVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251
            +  L  +A++  +L       E  TWK+C  G TS   + +++  L    S+     ++
Sbjct: 68  VLANLCDDAVMRKKLADDKEFLEYLTWKICDLGNTSSDIMCILLSNLSKEDSITYVFEIV 127

Query: 252 QPKQGKNMLQVAKTIYSTRG-----LSSFFKGFG 280
           +    K++  + K ++ ++      +  F KG+ 
Sbjct: 128 REDNDKDLPPLDKDVFKSKRVIDCLMDCFVKGYD 161

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 52/137 (37%), Gaps = 25/137 (18%)

Query: 43  PFDTTKVRLQT---SSVPTTALDVVKKLV---KNEGFRGFYKGTLTPLVGVGACVSVQFG 96
           P    K R+Q      VP     + ++LV   K+ G RG Y+G    L+  G   +VQ  
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196

Query: 97  V----NEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQT 152
           V     EA+ R          P+   G+  Y L       A     +P +    R+    
Sbjct: 197 VYSHAKEALSRHV--------PD---GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR 245

Query: 153 GTGAAAQFHGPLDCIKK 169
           G      + GPLDC+ K
Sbjct: 246 G----GLYRGPLDCLCK 258

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 28  LAGTAGGVSQVLIGQPFDTTKVRL--QTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85
           LA     V+  +   PFD    R+      +    LD + K V+ EGF   YKG L  L+
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277

Query: 86  GVG 88
            + 
Sbjct: 278 RIA 280

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 219 KLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPK-QGKNMLQVAKTIYSTRGLSSFFK 277
           K  L GA         + P+DV+K+ +Q    L+P    K M+   K I S+ G  +   
Sbjct: 15  KFALAGAIGCGITHSSMVPIDVVKTRIQ----LEPTVYNKGMVSSFKQIISSEGAGALLT 70

Query: 278 GFGPTMLRAAPANGATFATFEL 299
           GFGPT+L  +      F  +EL
Sbjct: 71  GFGPTLLGYSLQGSFKFGGYEL 92

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 66/167 (39%), Gaps = 15/167 (8%)

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFL 196
           PI+ V+ R+Q +          G +   K++ ++    +L+ G  PT+L  S      F 
Sbjct: 33  PIDVVKTRIQLE----PTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFG 88

Query: 197 TYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLW---LMIYPLDVIKSVMQTDSLLQP 253
            YE L        +       +K  ++  ++    +   + + PL+  +  + +    QP
Sbjct: 89  GYE-LFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVS----QP 143

Query: 254 KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
                +      I    G+ SF+ GF P + +  P N A F  FE A
Sbjct: 144 TFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHA 190

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 57/153 (37%), Gaps = 17/153 (11%)

Query: 43  PFDTTKVRLQTSSVPTT----ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           P D  K R+Q    PT      +   K+++ +EG      G    L+G     S +FG  
Sbjct: 33  PIDVVKTRIQLE--PTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 99  EAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS----PIEHVRIRLQTQTGT 154
           E  K+       N G +  +        G A      F A     P+E  RIRL +Q  T
Sbjct: 91  ELFKKL---AIDNMGYDNAVNYKNTIYIGSAA--IAEFFADIALCPLEATRIRLVSQP-T 144

Query: 155 GAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRE 187
            A   F G    I K     S   G TP + ++
Sbjct: 145 FANGLFGG-FSRILKEEGVGSFYNGFTPILFKQ 176

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 89/226 (39%), Gaps = 35/226 (15%)

Query: 43  PFDTTKVRLQTSSVPTT----ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           P D  K R+Q    PT      +   +K++  EG      G    L+G     + +FG  
Sbjct: 33  PIDVVKTRIQLE--PTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 99  EAMKRFFHSRNGNSGPNETLGL---LQYYLCGFAGGTANS-FLAS----PIEHVRIRLQT 150
           E  K+FF          +TLG     +Y    + G  A + FLA     P+E  RIRL +
Sbjct: 91  EVFKKFFI---------DTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVS 141

Query: 151 QTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELH--- 207
           Q     A    G    I K     S   G TP + ++       FL +E   A+EL+   
Sbjct: 142 QPTF--ANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFER--ASELYFSL 197

Query: 208 ----KGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDS 249
                 +S++ +    L L G T+G    ++  P D + S +   S
Sbjct: 198 APPKDTLSQTSLTAINL-LSGLTAGLAAAIVSQPADTLLSKVNKTS 242

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 66/167 (39%), Gaps = 15/167 (8%)

Query: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFL 196
           PI+ V+ R+Q +          G +   +K+ A     +L+ G  PT+L  S      F 
Sbjct: 33  PIDVVKTRIQLE----PTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFG 88

Query: 197 TYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLM---IYPLDVIKSVMQTDSLLQP 253
            YE +        +       +K  ++  ++    +L    + PL+  +  + +    QP
Sbjct: 89  GYE-VFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVS----QP 143

Query: 254 KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELA 300
                ++     I    G+ SF+ GF P + +  P N A F  FE A
Sbjct: 144 TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERA 190

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 64/149 (42%), Gaps = 17/149 (11%)

Query: 56  VPTTALDVVKKLVKNEGFRGFYKGTLTPLV-GVGACVSVQFGVNEAMKRFFHSRNGNSGP 114
           +PT  L    +L +  G R ++KGT+  L+  VG  V V+F     +K+F      N+  
Sbjct: 177 LPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSV-VRFTTFTMLKQFAPKEYQNNEY 235

Query: 115 NET-LGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN 173
             T LGL+    C   G T       P++ ++ R+Q +    +   +   ++C  ++   
Sbjct: 236 FATLLGLISS--CAVVGAT------QPLDVIKTRMQAK---DSVLLYRNSINCAYRIFVE 284

Query: 174 NS---LMRGLTPTMLRESHGCGVYFLTYE 199
                L +G  P +++      V F  Y+
Sbjct: 285 EGFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 248 DSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
           ++L   K   N+L  A  +Y   GL ++FKG  PT++R    +   F TF +
Sbjct: 170 EALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTM 221

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 22/197 (11%)

Query: 114 PNETLG-LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTA 172
           PN +L    ++ L G  G  A      PI+ V+ R+Q +    ++    G +   +K+  
Sbjct: 8   PNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSS----GMVGSFRKIVG 63

Query: 173 NN---SLMRGLTPTMLRESHGCGVYFLTYE----ALIANELHKGVSRSEIPTWKLCLFGA 225
                +L+ G  PT+L  S      F  YE    A +    ++   +   P +     G+
Sbjct: 64  EEGAAALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIY----IGS 119

Query: 226 TSGTTLW--LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTM 283
            +    +  + + PL+  +  + +    QP     ++     I    G+ SF+ GF P +
Sbjct: 120 AAIAEFFADIALCPLEATRIRLVS----QPTFANGLVGGFARILKEEGIGSFYNGFTPIL 175

Query: 284 LRAAPANGATFATFELA 300
            +  P N A F  FE A
Sbjct: 176 FKQIPYNIAKFVVFEHA 192

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 39  LIGQPFDT--TKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFG 96
           +I QP DT  +KV     +   +   ++ +L K  GF G + G  T LV VG   S+QFG
Sbjct: 228 VISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 287

Query: 97  VNEAMKR 103
           +   +K+
Sbjct: 288 IYGKLKQ 294

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 214 EIPTW------KLCLFGATS-GTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTI 266
           ++P +      K  L GA   G T   M+ P+DV+K+ +Q + L   K    M+   + I
Sbjct: 6   QVPNYSLSDYAKFALAGAIGCGATHSAMV-PIDVVKTRIQLEPL---KYSSGMVGSFRKI 61

Query: 267 YSTRGLSSFFKGFGPTMLRAAPANGATFATFEL 299
               G ++   GFGPT+L  +      F  +E+
Sbjct: 62  VGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEV 94

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 58/152 (38%), Gaps = 15/152 (9%)

Query: 43  PFDTTKVRLQTSSVPTTA--LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEA 100
           P D  K R+Q   +  ++  +   +K+V  EG      G    L+G     + +FG  E 
Sbjct: 35  PIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEV 94

Query: 101 MKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTA-NSFLAS----PIEHVRIRLQTQTGTG 155
            K+ F    G     ET    QY    + G  A   F A     P+E  RIRL +Q    
Sbjct: 95  FKKAFVDALG----YET--ACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQPTF- 147

Query: 156 AAAQFHGPLDCIKKLTANNSLMRGLTPTMLRE 187
            A    G    I K     S   G TP + ++
Sbjct: 148 -ANGLVGGFARILKEEGIGSFYNGFTPILFKQ 178

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 80/190 (42%), Gaps = 19/190 (10%)

Query: 122 QYYLCGFAG-GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLM 177
           ++ L G  G GT +S +  PI+ V+ R+Q +          G +   K++ ++    +L+
Sbjct: 15  KFALAGAIGCGTTHSAMV-PIDVVKTRIQLEP----TVYNKGMISSFKQIISSEGAGALL 69

Query: 178 RGLTPTMLRESHGCGVYFLTYEALIANELHKGV-SRSEIPTWKLCLFGATSGTTLW---L 233
            G  PT+L  S      F  YE  +  +L   V    +   +K  ++  ++    +   +
Sbjct: 70  TGFGPTLLGYSLQGSFKFGGYE--VFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADI 127

Query: 234 MIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGAT 293
            + PL+  +  + +    QP     ++     I    G  SF+ GF P + +  P N A 
Sbjct: 128 ALCPLEATRIRLVS----QPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAK 183

Query: 294 FATFELAMRV 303
           F  FE A  V
Sbjct: 184 FLVFERAAEV 193

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 83/219 (37%), Gaps = 33/219 (15%)

Query: 43  PFDTTKVRLQTSSVPTT----ALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           P D  K R+Q    PT      +   K+++ +EG      G    L+G     S +FG  
Sbjct: 33  PIDVVKTRIQLE--PTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 99  EAMKRFFHSRNGNSGPNETLGLLQ---YYLCGFAGGTA-NSFLAS----PIEHVRIRLQT 150
           E  K+ F          + LG  Q   Y    + G  A   F A     P+E  RIRL +
Sbjct: 91  EVFKKLFI---------DVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVS 141

Query: 151 QTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGV 210
           Q     A    G    I K     S   G TP + ++       FL +E   A E++ G+
Sbjct: 142 QPTF--ANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFER--AAEVYFGM 197

Query: 211 -----SRSEIPTWKLCLF-GATSGTTLWLMIYPLDVIKS 243
                S S   T  + L  G T+G    ++  P D + S
Sbjct: 198 AGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLS 236

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 40  IGQPFDTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98
           +  PFDT K R+Q   S  T + +    +VKNE     + G    L        + +G+ 
Sbjct: 240 VTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIY 299

Query: 99  EAM-KRF 104
           E + KRF
Sbjct: 300 EELVKRF 306

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 109/304 (35%), Gaps = 49/304 (16%)

Query: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVG 86
           L+ G  GG++  +  QP D  K R+Q     T    + K L + +     ++GTL   + 
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT----LWKNLKEIDSPLQLWRGTLPSALR 69

Query: 87  VGACVSVQFGVNEAMKRFFHSRNGNSGPNET---------------LGLLQYYLCG-FAG 130
                ++       M+     R  N+ P+ T               L + +  L G FA 
Sbjct: 70  TSIGSALYLSCLNLMRSSLAKRR-NAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFAR 128

Query: 131 GTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGLTPTMLRESHG 190
           G    ++  PI  +++R ++     ++      +  I          RG   T LR++  
Sbjct: 129 GLVG-YITMPITVIKVRYESTLYNYSS--LKEAITHIYTKEGLFGFFRGFGATCLRDAPY 185

Query: 191 CGVYFLTYEALIANELHKGVSRSEIPTWK----------------LCLFGATSGTTLWLM 234
            G+Y L YE   + +L   V  S    +                   +  A+  TT   +
Sbjct: 186 AGLYVLLYEK--SKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATT---V 240

Query: 235 IYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294
             P D IK+ MQ    L+P +  N      +I     +   F G    + R A + G  +
Sbjct: 241 TAPFDTIKTRMQ----LEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAW 296

Query: 295 ATFE 298
             +E
Sbjct: 297 GIYE 300

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 14/110 (12%)

Query: 15  DGAHD--STRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTS-SVPTTALDVVKKLVKNE 71
           D ++D  S    ++ + G    +   L+ QP    K  LQ++ S  TT  + +  L KNE
Sbjct: 212 DHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNE 271

Query: 72  GFRGFYKGTLTPLV-GV---GACVSVQFGVNEAMKR-------FFHSRNG 110
           G +  +KG L  L  GV   G   + +  + +++KR       FF   NG
Sbjct: 272 GLKSLWKGVLPQLTKGVIVQGLLFAFRGELTKSLKRLIFLYSSFFLKHNG 321

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 74/191 (38%), Gaps = 15/191 (7%)

Query: 19  DSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRL----QTSSVPTTALDVVKKLVKNEGFR 74
           D T   + LL G+    S+  +     +++ R      T  +  +++ +V K +   G++
Sbjct: 61  DYTHYIRVLLTGSDNTQSETKV----RSSRYRFWNPKYTYYLENSSIGIVTKALNRYGWK 116

Query: 75  GFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTAN 134
                 L PLV       V +    A    F  R  +        +  +   GF  G A 
Sbjct: 117 VIPDRILPPLVANSLAGVVLYTTYLATLNNFPLRATDQAFQH--NMFDFLRAGFLAGAAQ 174

Query: 135 SFLASPIEHVRIRLQTQTGTGAAAQFHG----PLDCIKKLTANNSLMRGLTPTMLRESHG 190
           + +++PI+ +  R        +A ++        D I+++        G   + +RES G
Sbjct: 175 AIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFG-GFGLSFIRESFG 233

Query: 191 CGVYFLTYEAL 201
             +YF T+E +
Sbjct: 234 FALYFTTFEMI 244

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 237 PLDVIKSVMQTDSLLQP-KQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295
           P+D I +    D LL   K+  N+   ++      GL   F GFG + +R +      F 
Sbjct: 180 PIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGFGLSFIRESFGFALYFT 239

Query: 296 TFEL 299
           TFE+
Sbjct: 240 TFEM 243

>AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH]
           complement(1112020..1113423) [1404 bp, 467 aa]
          Length = 467

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 66/165 (40%), Gaps = 16/165 (9%)

Query: 4   ELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDV 63
           ++P P  ID ++    S  V K +    A  +   L+  P D  K RL   +V +T    
Sbjct: 254 QIPDPYFIDIIN----SPDVQKSVALTFAAAIFTGLVLLPLDVIKTRLVVGAVASTHERS 309

Query: 64  VKKLVKNEGFRGFYK---GTLTPLVGVGACVSVQFGV--NEAMKRFFHSRNGNSGPNETL 118
           +++LVK   +R +     G L  L  + + +S  F V  +  + R ++    +S      
Sbjct: 310 LRRLVKRWSWREYIHSLPGELVVLNVLNSLLSKAFRVFTSIGLHRQYNIDRFSSR----- 364

Query: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGP 163
               ++   F   +   F   P+E +  R +       A+ FH P
Sbjct: 365 --YAFHTLEFLSDSLQLFFKLPVEALLKRAELHYILEPASPFHLP 407

>CAGL0L07392g 815667..816854 similar to sp|P43122 Saccharomyces
           cerevisiae YDL104c, hypothetical start
          Length = 395

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 169 KLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSG 228
           K T N+S   G+ PTM  E H   +  L  EAL A   HK  S  E P+  L       G
Sbjct: 58  KSTLNSSEYGGIIPTMAHEHHQMKIGSLVQEALTA---HKCTSPKENPSIDLICVTRGPG 114

Query: 229 TT 230
            T
Sbjct: 115 MT 116

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 25  KDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLVKNEGFRGFYKGTLTP 83
           ++ L G    +    + QP    K+ LQ   S   T  +V++ + +NEGF   +KG + P
Sbjct: 223 ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVI-P 281

Query: 84  LVGVGACV 91
            V  G  V
Sbjct: 282 QVSKGVIV 289

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 100/258 (38%), Gaps = 20/258 (7%)

Query: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMK-RFFHSRNG-----NSGP 114
           +D + K+ K  GF G Y+G  T +        + F     ++  +F  + G     +   
Sbjct: 53  IDCIIKIFKKRGFLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSK 112

Query: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN 174
              L  ++    G + G     + +PI  +  R Q  T  G  A     +  I + +  +
Sbjct: 113 FIELSTIEELALGMSAGAMTQVVTNPISVISTR-QQLTKDGEDASLKAVIKQIYEESNGD 171

Query: 175 --SLMRGLTPTMLRESHGCGVYFLTYEALIANEL-HKGVSRSEIPTWKLC-----LFGAT 226
             +  +G    ++  S    + + +Y+ L +  L  KG+S S+  + +L      L G  
Sbjct: 172 LTAFWKGFKVALVL-STNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMF 230

Query: 227 SGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRA 286
           S      +  PL V K  +Q     +  + K   +V + IY   G  S +KG  P + + 
Sbjct: 231 SKMISTFVTQPLIVAKITLQG----KGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQVSKG 286

Query: 287 APANGATFATFELAMRVL 304
               G  F   +  +RV+
Sbjct: 287 VIVQGLLFTYKDEIVRVI 304

>Scas_693.7
          Length = 583

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 34  GVSQVLIGQPFDTTK-------VRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLT 82
           G+   L G PFD  K       +++  SS+  +AL  VKK   NE F G+   ++T
Sbjct: 249 GMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRIQSVT 304

>Sklu_2129.3 YIL115C, Contig c2129 2430-6689 reverse complement
          Length = 1419

 Score = 29.6 bits (65), Expect = 4.1,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 236 YPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPT 282
           +P D+   + +T+ L +PK   + ++    I+ T G+ SF K   PT
Sbjct: 447 FPEDLENLLKKTNRLSEPKNSTDKVKNLPDIFKTTGMESFIKDKPPT 493

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 126 CGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHG----PLDCIKKLTANNSLMRGLT 181
            GF  G A +  ++PI+ +  R        +A +++      +D +K++        G  
Sbjct: 162 AGFMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCF-GGFG 220

Query: 182 PTMLRESHGCGVYFLTYEALIANELHKGVSRSE 214
            ++++ES G  VYF T+E L     +K +   E
Sbjct: 221 LSLVKESVGFAVYFTTFELLKGQVCNKTIEYLE 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,614,242
Number of extensions: 386409
Number of successful extensions: 2166
Number of sequences better than 10.0: 216
Number of HSP's gapped: 1268
Number of HSP's successfully gapped: 503
Length of query: 305
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 204
Effective length of database: 13,099,691
Effective search space: 2672336964
Effective search space used: 2672336964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)