Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1900.165865830450.0
Kwal_56.2251064159620880.0
Scas_611.164656920840.0
YMR008C (PLB1)66459220540.0
KLLA0C05940g64058219350.0
CAGL0J11770g65959419280.0
YOL011W (PLB3)68657719160.0
YMR006C (PLB2)70658818590.0
Scas_685.367757017930.0
Scas_644.870459017900.0
CAGL0E02321g70458317420.0
CAGL0J11748g69557716520.0
Scas_92.0d2362189761e-129
AAL027W5924265482e-61
Sklu_2442.195844345313e-59
Kwal_0.1735074195053e-56
CAGL0H03575g5144214633e-50
YNL012W (SPO1)6314104685e-50
Scas_695.105533964339e-46
KLLA0F12232g6804194166e-43
ADR106W798169760.49
Scas_668.419537701.4
Kwal_56.2355759432675.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1900.1
         (658 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement       1177   0.0  
Kwal_56.22510                                                         808   0.0  
Scas_611.1                                                            807   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   795   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   749   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   747   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   742   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   720   0.0  
Scas_685.3                                                            695   0.0  
Scas_644.8                                                            694   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   675   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   640   0.0  
Scas_92.0d                                                            380   e-129
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   215   2e-61
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     209   3e-59
Kwal_0.173                                                            199   3e-56
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   182   3e-50
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   184   5e-50
Scas_695.10                                                           171   9e-46
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   164   6e-43
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    34   0.49 
Scas_668.4                                                             32   1.4  
Kwal_56.23557                                                          30   5.1  

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score = 1177 bits (3045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/658 (88%), Positives = 584/658 (88%)

Query: 1   MLALASLVFLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNS 60
           MLALASLVFLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNS
Sbjct: 1   MLALASLVFLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNS 60

Query: 61  ALEDFLNRATENFTDNSIVKTLFNSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGS 120
           ALEDFLNRATENFTDNSIVKTLFNSSSAPRIGVACSGGGYR            DNRTRGS
Sbjct: 61  ALEDFLNRATENFTDNSIVKTLFNSSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGS 120

Query: 121 VEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXPG 180
           VEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQ             PG
Sbjct: 121 VEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPG 180

Query: 181 GTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLRE 240
           GTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLRE
Sbjct: 181 GTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLRE 240

Query: 241 ADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKV 300
           ADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKV
Sbjct: 241 ADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKV 300

Query: 301 NNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKFLT 360
           NNGTPETKGQCIAGFDNTGFIMGT              TLMLLNASLPSYLYKFANKFLT
Sbjct: 301 NNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLT 360

Query: 361 GLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERE 420
           GLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERE
Sbjct: 361 GLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERE 420

Query: 421 LDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTF 480
           LDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTF
Sbjct: 421 LDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTF 480

Query: 481 FGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNL 540
           FGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNL
Sbjct: 481 FGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNL 540

Query: 541 TDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQTIXX 600
           TDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQTI  
Sbjct: 541 TDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQTITS 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVVTPCLANIYILLAAVIGVVAGLM 658
                                            VVVTPCLANIYILLAAVIGVVAGLM
Sbjct: 601 GSDSSATGTTTSSSSTPSSSTSSGNSDTKNSGGVVVTPCLANIYILLAAVIGVVAGLM 658

>Kwal_56.22510
          Length = 641

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/596 (64%), Positives = 457/596 (76%), Gaps = 7/596 (1%)

Query: 1   MLALASLVFL-LSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTN 59
           ML + SL+   +S V AWSPT+SY PGNV+C DDINLVR+A  LS +E+EWLKKR+ YT 
Sbjct: 1   MLWILSLLLAAISAVQAWSPTDSYVPGNVSCADDINLVRKASSLSPNETEWLKKRDAYTK 60

Query: 60  SALEDFLNRATENFTDNSIVKTLFNSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRG 119
            AL  FL+RAT NF+++S+V  ++ S   PRI VACSGGGYR            DNRT G
Sbjct: 61  EALRTFLDRATSNFSNSSLVDNVWKSGKIPRIAVACSGGGYRAMLSGAGMLSAMDNRTNG 120

Query: 120 SVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXP 179
           + EHGLGGLLQSTTYLAGLSGGNWLVG+LAWNNWTSVQHI+DT G              P
Sbjct: 121 ATEHGLGGLLQSTTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNSILNP 180

Query: 180 GGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLR 239
           GG N+L + +RWD ISDAV+AK DAGFN SL DVWGRALSYDFFPTL  GG  YTWSTLR
Sbjct: 181 GGVNILTSANRWDQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWSTLR 240

Query: 240 EADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTK 299
           +ADVFKN EMPFPISVADGRYPGTQ+I+LN+T+FEFNPFEMGSWD SL AFT+VKYLGT+
Sbjct: 241 DADVFKNGEMPFPISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTE 300

Query: 300 VNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKFL 359
           V NGTP T+GQC+AGFDNTGF+MGT               L L   S+ S+L  F   FL
Sbjct: 301 VKNGTPVTQGQCVAGFDNTGFVMGTSSTLFNQFL------LQLNTTSVSSFLKGFIQDFL 354

Query: 360 TGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEER 419
             LS+D +DIA+Y PNPF+ T YV +NYT  IV SE L+LVDGGEDG+NIPL+PL+Q++R
Sbjct: 355 QDLSEDSNDIAIYNPNPFRDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDR 414

Query: 420 ELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPT 479
           ++DVIFALDNSADT++YWP G SL  TYERQF  QG DIAFPYVPDV TFV  GLN +P 
Sbjct: 415 DVDVIFALDNSADTDEYWPAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPV 474

Query: 480 FFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNN 539
           FFGCDATN +DL Y PPL+VYMPN ++S+NSN STFK+SYSS  R  M +NGFEA+TRNN
Sbjct: 475 FFGCDATNTSDLAYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNN 534

Query: 540 LTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSASISSYNN 595
           LTDDS+F+ CVACAV+RRKQ+S N T PEEC KCF NYCW+   SK ++++++ +N
Sbjct: 535 LTDDSNFMGCVACAVLRRKQESQNMTFPEECTKCFQNYCWDGKTSKKTSNVTTLDN 590

>Scas_611.1
          Length = 646

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/569 (67%), Positives = 442/569 (77%), Gaps = 8/569 (1%)

Query: 14  VGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENF 73
           VGAWSP+NSY P NVTCDD+INL+REA  LS DE  WL KR+  T+ ALE FL R+T NF
Sbjct: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77

Query: 74  TDNSIVKTLF--NSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGLLQS 131
           +D S++  LF  NSSSAPRIGVACSGGGYR            DNRT G+ EHGLGGLLQ 
Sbjct: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137

Query: 132 TTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXPGGTNVLETTSRW 191
            TYLAGLSGGNWL  TL WNNWTSVQ IL+ M               PGG N+LET  RW
Sbjct: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILETGERW 197

Query: 192 DDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMPF 251
           D ISDAV AKQDAGFN SL DVWGRALSY+FFP+L  GG  YTWSTLR+ADVFKNAEMPF
Sbjct: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257

Query: 252 PISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQC 311
           PISVADGRYPGT VINLNATVFEFNPFEMGSWD +L  FT+VKYLGT V+NG P T+G+C
Sbjct: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317

Query: 312 IAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKFLTGLSKDYDDIAL 371
           IAGFDNTGFI GT               L + + SLPS++ K A+ FL  LS DY+DIA+
Sbjct: 318 IAGFDNTGFITGTSSTLFNQFL------LHINSTSLPSFITKLASHFLNDLSADYNDIAI 371

Query: 372 YAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNSA 431
           Y+PNPF+  +++  NY++SIV+S+ L+LVDGGED QNIPL+PLLQ+ERELDVIFALDNSA
Sbjct: 372 YSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSA 431

Query: 432 DTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDL 491
           DTNQ WP+G SL  TYERQF  QG+ +AFPYVPD +TFV LGLNKRPTFFGCDA NLTDL
Sbjct: 432 DTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDL 491

Query: 492 DYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVA 551
           +YIPPLVVY+PN + SFN NQSTFK+SYS+  R +MI+NGFE+ TR N TDDSDF+ C+ 
Sbjct: 492 EYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIG 551

Query: 552 CAVIRRKQQSMNATLPEECEKCFTNYCWN 580
           CA++RRKQQSMNATLP EC +CFTNYCWN
Sbjct: 552 CAIMRRKQQSMNATLPTECNQCFTNYCWN 580

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/592 (65%), Positives = 444/592 (75%), Gaps = 10/592 (1%)

Query: 1   MLALASLVFLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNS 60
           +++ A L  L   V AWSP NSY P NVTCDDDINLVREA GLS +E+EWLKKR+ YT  
Sbjct: 7   LVSAAVLTSLTENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKE 66

Query: 61  ALEDFLNRATENFTDNSIVKTLF--NSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTR 118
           AL  FLNRAT NF+D S++ TLF  NSS+ P+I VACSGGGYR            DNRT 
Sbjct: 67  ALHSFLNRATSNFSDTSLLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTD 126

Query: 119 GSVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXX 178
           G+ EHGLGGLLQ  TYLAGLSGGNWL  TLAWNNWTSVQ I+D   +             
Sbjct: 127 GANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILT 186

Query: 179 PGGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTL 238
           P G N+ +T SRWDDISD V  K+DAGFN SL DVWGRAL+Y+F+P+L  GG  YTWSTL
Sbjct: 187 PDGINIFKTGSRWDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTL 246

Query: 239 READVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGT 298
           READVFKN EMPFPI+VADGRYPGT VINLNAT+FEFNPFEMGSWD +L AFT+VKYLGT
Sbjct: 247 READVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGT 306

Query: 299 KVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNAS-LPSYLYKFANK 357
            V NG P  KGQCIAGFDNTGFI  T               L+ LN++ LPS++   A  
Sbjct: 307 NVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQF-------LLRLNSTDLPSFIANLATD 359

Query: 358 FLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQE 417
           FL  LS + DDIA+YAPNPFK  N++ +N T SI+ESE L+LVDGGED QNIPL+PLLQ+
Sbjct: 360 FLEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQK 419

Query: 418 ERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKR 477
           ERELDVIFALDNSADT+ YWP+G SL  TY+RQF  QG +++FPYVPDV+TFV LGLNK+
Sbjct: 420 ERELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKK 479

Query: 478 PTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTR 537
           PTFFGCDA NLTDL+YIPPL+VY+PN++ SFN NQSTFK+SYS   R  MIKNGFEA T 
Sbjct: 480 PTFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATM 539

Query: 538 NNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSAS 589
            N TDDSDF+ CV CA+IRRKQQ++NATLP EC +CFTNYCWN      S S
Sbjct: 540 GNFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVS 591

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/582 (62%), Positives = 428/582 (73%), Gaps = 8/582 (1%)

Query: 1   MLALASLVFLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNS 60
           +  + S+   L  V AWSPTN Y PG V CD++INLVR+A  +S DE++WLK R   T  
Sbjct: 10  LFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVP 69

Query: 61  ALEDFLNRATENFT-DNSIV-KTLFNSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTR 118
           AL+DFL R  + FT D SI+ K L    +AP++ +ACSGGGYR            DNRT 
Sbjct: 70  ALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTD 129

Query: 119 GSVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXX 178
           G+ +HGLGGLLQS+TYLAGLSGGNWLVGTLA+NNWTSVQ I++ M               
Sbjct: 130 GANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVN 189

Query: 179 PGGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTL 238
           PGG N+  + SRWDDISDAV+ K+ AGFN S+TDVWGRALSY+FFP+L  GG  YTW+TL
Sbjct: 190 PGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTL 249

Query: 239 READVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGT 298
           R+ DVFKN EMPFPISVA GRYPGTQV+NLNATVFEFNPFEMGSWD +L  FT+V+Y GT
Sbjct: 250 RDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGT 309

Query: 299 KVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKF 358
            V NGTP   G+C+AGFDNTGF+MGT               L L    LPS+LY   + F
Sbjct: 310 NVTNGTPNVTGKCVAGFDNTGFVMGTSSSLFNQFL------LQLNTTDLPSFLYNLLHGF 363

Query: 359 LTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEE 418
           LT  S DYDDI+++APNPF     +  NY++SI E + LYLVDGGEDGQNIPL PLLQ E
Sbjct: 364 LTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTE 423

Query: 419 RELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRP 478
           RE+DVIFALDNSADT+Q WP+GFSLTQTY RQF  QG  IAFPYVPDV+TF  LGLN RP
Sbjct: 424 REIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRP 483

Query: 479 TFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRN 538
           TFFGCDA NLTDL+ IPPLVVYMPNT+ESFNSN STFK+SYS+  R  MI+NGFEAVT  
Sbjct: 484 TFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMK 543

Query: 539 NLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
           NLT D +F+ C++CA++RRKQ+S+N TLP EC+ CF  YCWN
Sbjct: 544 NLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWN 585

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/594 (60%), Positives = 436/594 (73%), Gaps = 16/594 (2%)

Query: 14  VGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENF 73
           V AWSPTNSY P NVTC +DINL+R A GLS  E +WLKKR+V T  ALE FL R T NF
Sbjct: 20  VEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVTSNF 79

Query: 74  TDNS----IVKTLF--NSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGG 127
           T NS    ++  LF  NSS+ P+IG+A SGGGYR            DNRT G+ EHGLGG
Sbjct: 80  TSNSSASNLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGG 139

Query: 128 LLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXPGGTNVLET 187
           LLQ+ TYLAGLSGGNWL  TL+WNNWTSVQ I+D+                PGG N+ +T
Sbjct: 140 LLQAATYLAGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSAIWDISHSIVSPGGINIFKT 199

Query: 188 TSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNA 247
            SRWD ISDAV+ KQ AGFN SL DVWGRALSY FFPTL  GG AY WS LRE+DVFKNA
Sbjct: 200 GSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNA 259

Query: 248 EMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPET 307
           EMP PISVADGRYPGT VI+LN+TVFE++PFE+GSWD SL AFT+V+YLGTKV++G P  
Sbjct: 260 EMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAE 319

Query: 308 KGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKFLTGLSKDYD 367
           +G+CIAGFDN GF+MGT               L + + S+P ++   A  FL  LS+DYD
Sbjct: 320 EGKCIAGFDNVGFLMGTSSTLFNQFL------LRINDTSIPKFIRNLATHFLKDLSEDYD 373

Query: 368 DIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFAL 427
           DIA+YAPNPF+  +YV  N ++S+ ESE L+LVDGGEDGQN+PL+PL+Q+ER+LD++FAL
Sbjct: 374 DIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFAL 433

Query: 428 DNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATN 487
           DNSADT + WP+G SL  TY RQF  QG  + FP VP   TFV LGLNK+PTFFGCDA N
Sbjct: 434 DNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARN 493

Query: 488 LTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFV 547
           +TDL+YIPPL+VY+PN++ S+N N STFKLSYS + R  +I+NGFEA T NNLT DS+F 
Sbjct: 494 MTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFA 553

Query: 548 SCVACAVIRRKQQSMNATLPEECEKCFTNYCWN---DNA-SKGSASISSYNNQT 597
            C+ CA++RRKQQ++N TLP+ECE CFTNYCWN   DN  +KG  + + ++N +
Sbjct: 554 GCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGVTASNDFDNAS 607

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/577 (61%), Positives = 434/577 (75%), Gaps = 13/577 (2%)

Query: 9   FLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNR 68
           FLL+   AWSPT+SY PG V+C DDINLVREA  +S +ES WL+KR   T+ AL+DFL R
Sbjct: 20  FLLA-ANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTR 78

Query: 69  ATENFTDNS-IVKTLFN---SSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHG 124
           AT NF+D+S ++  LFN   S + P+I VA SGGGYR            DNRT G+ EHG
Sbjct: 79  ATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHG 138

Query: 125 LGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXPGGTNV 184
           LGGLLQSTTYL+G SGGNWLVGTLA NNWTSVQ IL+ M               PGG N+
Sbjct: 139 LGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINI 198

Query: 185 LETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVF 244
            +T  RWD IS+AV++KQ+A +N SL D+WGRAL+Y+FFP+L  GG   TWS++R+  VF
Sbjct: 199 FKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVF 258

Query: 245 KNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGT 304
           +NAEMPFPISVADGRYPGT+VINLNATVFEFNPFEMGSWD SL +F NVKYLGT V+NG 
Sbjct: 259 QNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGV 318

Query: 305 PETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNAS-LPSYLYKFANKFLTGLS 363
           P  +G+C AGFDN GFIMGT               L+ +N++ LPS++ + A  FL  LS
Sbjct: 319 PLERGKCTAGFDNAGFIMGTSSTLFNQF-------LLRINSTHLPSFITRLARHFLKDLS 371

Query: 364 KDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDV 423
           +D++DIA+Y+PNPFK T ++  +YT SIV+S+ L+LVDGGED +N+P++PL+Q+ER++D+
Sbjct: 372 QDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDI 431

Query: 424 IFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGC 483
           IFA+DNSAD    WP+G SL  TYERQF KQG  ++FPYVPD +TFV LGLNK+PTFFGC
Sbjct: 432 IFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGC 491

Query: 484 DATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDD 543
           DA NLTDL YIPPLVVY+PN + SFNSNQS FKLSYS   RR+MI+NGFE  TRNN TDD
Sbjct: 492 DANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDD 551

Query: 544 SDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
            +F+ CV CA+IRRKQQ++N TLP ECE CF NYCWN
Sbjct: 552 PEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWN 588

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/588 (59%), Positives = 427/588 (72%), Gaps = 17/588 (2%)

Query: 1   MLALASLVFLLSTVGAWSPT--NSYTPGNVTC-DDDINLVREAVGLSTDESEWLKKREVY 57
           +L  +SL+  LS     S T  + Y P  + C  DD +LVR A GLST E++WLKKR+ Y
Sbjct: 6   ILQASSLISGLSLAADSSSTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAY 65

Query: 58  TNSALEDFLNRATENFTDNSIVKTLF--NSSSAPRIGVACSGGGYRXXXXXXXXXXXXDN 115
           T  AL  FL+RAT NF+D S++ TLF  NSS+ P+IG+ACSGGGYR            DN
Sbjct: 66  TKEALHSFLSRATSNFSDTSLLSTLFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDN 125

Query: 116 RTRGSVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXX 175
           RT G+ EHGLGGLLQS+TYL+GLSGGNWL GTLAWNNWTSVQ I+D M +          
Sbjct: 126 RTDGANEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKS 185

Query: 176 XXXPGGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTW 235
              PGG+N+  T  RW+ I   V AK DAGFN SL+D+W RALSY+FFP+LP+ G A TW
Sbjct: 186 IVNPGGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTW 245

Query: 236 STLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKY 295
           S+LR+ DVFKN EMP PI+VADGRYPGT VINLNAT+FEF PFEMGSWD SL AFT+VKY
Sbjct: 246 SSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKY 305

Query: 296 LGTKVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSY---LY 352
           LGT V NG P  K QC++G+DN GF++ T                  L AS  +Y   + 
Sbjct: 306 LGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFS---------LEASTSTYYKMIN 356

Query: 353 KFANKFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLI 412
            FANK++  LS+D DDIA+YA NPFK T +V  NYT SIV+++ L+LVDGGEDGQN+PL+
Sbjct: 357 SFANKYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLV 416

Query: 413 PLLQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVEL 472
           PL+++ER+LDV+FALD S +T++ WP+G  +T TYERQ+ KQG  +AFPYVPDV+TF+ L
Sbjct: 417 PLIKKERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNL 476

Query: 473 GLNKRPTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGF 532
           GL  +PTFFGCDA NLTDL+YIPPLVVY+PNTK SFN NQST K++Y+   R  MI+NGF
Sbjct: 477 GLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGF 536

Query: 533 EAVTRNNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
           EA T  N TDDS+F+ C+ CA+IRRKQ+S+NATLP EC KCF +YCWN
Sbjct: 537 EAATMGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWN 584

>Scas_685.3
          Length = 677

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/570 (57%), Positives = 419/570 (73%), Gaps = 12/570 (2%)

Query: 14  VGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENF 73
           V AWSP+N Y P NVTC DD+NL+REA  LS DE +WLKKR   T  +L+ FL+R+T+NF
Sbjct: 17  VQAWSPSNGYAPANVTCADDVNLLREASDLSKDEQDWLKKRNTITAESLKTFLDRSTKNF 76

Query: 74  TDNS--IVKTLF-NSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGLLQ 130
           +D+S  ++  LF +  + P+IG+A SGGGYR            DNRT G+ +HGLGGLLQ
Sbjct: 77  SDSSSSLLNKLFQDGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGGLLQ 136

Query: 131 STTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXPGGTNVLETTSR 190
           S+TYLAGLSGGNWL  TLAWNNWTSVQ I+D +                   + +  +S 
Sbjct: 137 SSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVENSIWDIDNSLFS---ISEMANSSI 193

Query: 191 WDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMP 250
           W DI++ V AKQDAGFN +L D+WGRAL+Y+FFP L +GG  YTWSTLR+++VFKNAEMP
Sbjct: 194 WTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRDSEVFKNAEMP 253

Query: 251 FPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQ 310
           FPI+VADGRYPGT VI+LNATVFEFNPFEMGSWD +L +FT+VKYLGT V+NG P   GQ
Sbjct: 254 FPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGKPIDAGQ 313

Query: 311 CIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKFLTGLSKDYDDIA 370
           C+AGFDN GF++GT               L   ++ LP  L    + F   L+  Y+DIA
Sbjct: 314 CVAGFDNAGFVLGTSATLFNLM------PLPFTSSMLPKSLSVLGDNFTASLADTYNDIA 367

Query: 371 LYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNS 430
           +Y+PNPF+  + V  N++++IV+S+ L+LVDGGEDG+ IPL+PLLQE+R LDV+FALD +
Sbjct: 368 IYSPNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFALDFN 427

Query: 431 ADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTD 490
           +DT   WP+G SL  TY+RQFE QG+ ++FPYVPD  TF++ GLN +PTFFGCDA NLTD
Sbjct: 428 SDTTTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAKNLTD 487

Query: 491 LDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCV 550
           L+YIPPL+VY+PN++ SFNSN ST +LSY+S  R  MI+NGFE+ TR N TDD +F+ C+
Sbjct: 488 LEYIPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEFLGCI 547

Query: 551 ACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
            CA++RRKQQS+N TLP ECE+CFTNYCWN
Sbjct: 548 GCAIMRRKQQSLNETLPSECEQCFTNYCWN 577

>Scas_644.8
          Length = 704

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/590 (56%), Positives = 410/590 (69%), Gaps = 20/590 (3%)

Query: 7   LVFLLSTVGAWSPTNSYTPGNVTC--------DDDINLVREAVGLSTDESEWLKKREVYT 58
           +V L  T  AW+P+NSY P  + C        ++D +L+REA  +S +ES WL+KR   T
Sbjct: 13  IVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNT 72

Query: 59  NSALEDFLNRATEN------FTDNSIVKTLFNSSSA--PRIGVACSGGGYRXXXXXXXXX 110
              L  FLNR+  +      F   +++ +L  S SA  P+IG+A SGGGYR         
Sbjct: 73  REPLLQFLNRSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGIL 132

Query: 111 XXXDNRTRGSVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQXXXXX 170
              DNRTRG+  HGLGGLLQSTTYL+G SGGNWLVGTLA+NNWTSVQ I+D   +     
Sbjct: 133 AAMDNRTRGAQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIW 192

Query: 171 XXXXXXXXPGGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGG 230
                   PGG N+ ++  RWD ISDA+  KQ AGF+ SL DVWGRALSY FFP+L  GG
Sbjct: 193 DLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGG 252

Query: 231 DAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAF 290
            AYTWS+LR++ VF   +MPFPISVADGRYPG++V+NLNATVFEFNPFEMGSWD SL  F
Sbjct: 253 VAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTF 312

Query: 291 TNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSY 350
           T+VK+LGT V+ G P    +C+ GFDNT FIMGT              T    N  LP +
Sbjct: 313 TDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINST----NLHLPGF 368

Query: 351 LYKFANKFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIP 410
           + K A  FL  +S+D++D+A Y PNPFK  N++  NYT+SIV S+ LYLVDGGED +NIP
Sbjct: 369 ITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIP 428

Query: 411 LIPLLQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFV 470
           L+PL+Q ER+LD++FA+DNS D    WP+G SL  T+ERQF +QG  +AFPYVP   TFV
Sbjct: 429 LLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFV 488

Query: 471 ELGLNKRPTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKN 530
            LGLN++PTFFGCDA NLTDL+YIPPLV+Y+PN + SF SNQS FKLSY+ E RRAMI N
Sbjct: 489 NLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISN 548

Query: 531 GFEAVTRNNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
           GFE  TRNN TDD DF+ C+ CA+IRRKQQS+N TLPE C  CFTNYCWN
Sbjct: 549 GFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWN 598

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 411/583 (70%), Gaps = 27/583 (4%)

Query: 16  AWSPTNSYTPGNVTC-DDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRAT---E 71
            +S  + Y P    C  DDINLVREA GLS +E++WL++R+V T  AL +FL RAT   +
Sbjct: 19  GYSVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQ 78

Query: 72  NFTDNSIVKTLFNSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGLLQS 131
           NFT   +   +F++   PRIG+A SGGGYR            DNRTRG+++HGLGG+LQS
Sbjct: 79  NFT--QLFHRIFDAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQS 136

Query: 132 TTYLAGLSGGNWLVGTLAWNNWTSVQHILD---------TMGQXXXXXX--XXXXXXXPG 180
           TTY+ G SGGNWLV +L+WNNWTSVQ ILD           G+               PG
Sbjct: 137 TTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPG 196

Query: 181 GTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLRE 240
           G N+++T  RWD I++AV AKQ+AGFN SL DVWGRALSY FFPTL  GG  YTWS+LR+
Sbjct: 197 GLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRD 256

Query: 241 ADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKV 300
           + +F+  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWD SL AFT+VKYLGT V
Sbjct: 257 SPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNV 316

Query: 301 NNGTP--ETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNAS-LPSYLYKFANK 357
            NG P   T  +CI GFDNT FIMGT               L+ +N++ LP+++ K+A  
Sbjct: 317 TNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQF-------LLRINSTHLPNFVTKWATN 369

Query: 358 FLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQE 417
            L   + +++D+A+Y PNPFK T YV EN++ SIV+SE LYLVDGGED +N+PLIPLLQ 
Sbjct: 370 LLKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQR 429

Query: 418 ERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKR 477
           +R+LD+IFA+DNSAD    WP+G SL  TYERQF  QG  IAFP++PD +TF+ LGLNKR
Sbjct: 430 DRDLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKR 489

Query: 478 PTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTR 537
           PTFFGC+ATN+T L YIPPLVVY PN++ SFNSNQS FKLSYS +    MI NGFE  TR
Sbjct: 490 PTFFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATR 549

Query: 538 NNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
           NN TDD +F+ C+ACA+++RKQ++++  LP ECE+C   YCW+
Sbjct: 550 NNFTDDPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWD 592

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/577 (54%), Positives = 403/577 (69%), Gaps = 10/577 (1%)

Query: 22  SYTPGNVTCDDDINLVREAV-GLSTDESEWLKKREVYTNSALEDFLNRATENFTDNSIVK 80
           SYTP NV+C D+ N +R A  GLS  E EWLKKR+  T  AL+ FL RA  N +   I  
Sbjct: 21  SYTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITS 79

Query: 81  TLFN-SSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGLLQSTTYLAGLS 139
            LFN + + P++G+A +GGGYR            DNRT G+ EHGLGGLLQ+ TY+AGLS
Sbjct: 80  ALFNDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGLS 139

Query: 140 GGNWLVGTLAWNNWTSVQHILDTMGQXXXXXXXXXXXXXPGGTNVLETTSRWDDISDAVD 199
           GGNWL GTLA+NN+TSVQ IL+   +             P   +  +T +RW  I   V 
Sbjct: 140 GGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQ 199

Query: 200 AKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMPFPISVADGR 259
            K+DAGFN ++TD+W RAL+Y +FPTLPN G   TWS+LR+ ++F N EMP PISVADGR
Sbjct: 200 GKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGR 259

Query: 260 YPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFDNTG 319
           YPGT VINLNATVFE  PFE+GSWD SL AF+++KYLGT+V +G PET+ +CI GFD+  
Sbjct: 260 YPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDAS 318

Query: 320 FIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANKFLTGLSKDYDDIALYAPNPFKG 379
           FIMGT              T+   +A   +YL   ++  + G+ K+ +DIA+YAPNPFKG
Sbjct: 319 FIMGTSSSLFNEF------TMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKG 372

Query: 380 TNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNSADTNQYWPN 439
           + YV  NYT SIV+S+ L+LVDGGED Q IP +PLL++ER+LD+IFA+D   +T+  +P 
Sbjct: 373 SKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPA 432

Query: 440 GFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDLDYIPPLVV 499
           G  + +TYERQF KQG  +AFPYVPD++TFV LGL  +P+F+GCDA NLTDL+YIPPL+V
Sbjct: 433 GGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIV 492

Query: 500 YMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRRKQ 559
           Y+PN+  SF SN STFKL+Y+   R  MI+N FEA TRNNLT+D+D+V+CV CA+IRRKQ
Sbjct: 493 YIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQ 552

Query: 560 QSMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQ 596
           QS+N TLP+ C+KCFTNYCWN         + + NNQ
Sbjct: 553 QSLNLTLPDICDKCFTNYCWNGTIDNTPTKLLTPNNQ 589

>Scas_92.0d
          Length = 236

 Score =  380 bits (976), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 190/218 (87%), Gaps = 6/218 (2%)

Query: 228 NGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSL 287
           NGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSL
Sbjct: 18  NGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSL 77

Query: 288 RAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASL 347
           RAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGT               L L    L
Sbjct: 78  RAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGT------SSSLFNQFLLQLNTTGL 131

Query: 348 PSYLYKFANKFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQ 407
           PS++YK ANKFLTGLS DYDDIALYAPNPFKGT +V ENYTRSIVESEILYLVDGGEDGQ
Sbjct: 132 PSFIYKLANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQ 191

Query: 408 NIPLIPLLQEERELDVIFALDNSADTNQYWPNGFSLTQ 445
           NIPL+PLLQEERELDVIFALDNSADTNQYWPNGF    
Sbjct: 192 NIPLVPLLQEERELDVIFALDNSADTNQYWPNGFEFHH 229

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/426 (33%), Positives = 204/426 (47%), Gaps = 51/426 (11%)

Query: 186 ETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTL-READVF 244
           +  S + D+   V  K+  GF  S TD WGRAL    +    N     + S L   +++ 
Sbjct: 187 KVLSFYIDLHSEVRPKKIMGFPVSFTDYWGRALWKKIYV---NESMISSMSELFARSEIT 243

Query: 245 KNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGT 304
            N E P PI +A+ +     ++N    VFEF PFE GSW+R L  F N+KYLG+    G 
Sbjct: 244 NNYEAPLPIIIANCK--NEDLVN---AVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGV 298

Query: 305 PETKGQCIAGFDNTGFIMGTXXXXX--------XXXXXXXXXTLMLLNASLPSYLYKFAN 356
            ++   C+ GFD+ GFI  T                      T+  + A   ++     N
Sbjct: 299 AQS---CVQGFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKN 355

Query: 357 KFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQ 416
           K          D AL+ PNPF    Y +      +  S+ LYLVDGGEDG+NIPL P LQ
Sbjct: 356 K-PNSFFGTRSDFALFQPNPF----YRYPGVDSPLTNSDKLYLVDGGEDGENIPLRPFLQ 410

Query: 417 EERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQG-------DDIA-----FPYVP 464
            ER++D+IFALD+S+    Y P G  L   Y+      G        D+       PY+P
Sbjct: 411 PERQVDLIFALDSSSGRINY-PTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIP 469

Query: 465 DVSTFVELGLNKRPTFFGC--------DATNLTDLDYIPPLVVYMPNTKESFNSNQSTFK 516
               F   GL KRP  FGC        +A+       +PP+V Y  N   ++NSN STFK
Sbjct: 470 SAEEFEAKGLLKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFK 529

Query: 517 LSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRRKQQSMNAT--LPEECEKCF 574
           L Y+    + M++NG    T +N   ++ +  CV C V++R   ++NA+  LP  C++CF
Sbjct: 530 LRYNHSEVQGMLENGASLFTHDN---NTAYFQCVGCLVVKRAYDNVNASAKLPPTCQQCF 586

Query: 575 TNYCWN 580
             YC+N
Sbjct: 587 RRYCYN 592

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  209 bits (531), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 142/434 (32%), Positives = 208/434 (47%), Gaps = 53/434 (12%)

Query: 183 NVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREAD 242
           N  +T   + ++   V  K+  GF+ S TD WGRAL       L N         L    
Sbjct: 168 NFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCR 227

Query: 243 VFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNN 302
            FK  ++PFPI V++ +   ++ +     VFEF PFE GSWD  L  F  +KYLG+K+ +
Sbjct: 228 NFKEFKVPFPIIVSNCKNSPSKTV-----VFEFTPFEFGSWDEYLNEFIKLKYLGSKIVS 282

Query: 303 GTPETKGQCIAGFDNTGFIMGTXXXXX--------XXXXXXXXXTLMLLNASLPSYLYKF 354
           G      +C  GFD+ GFI  T                      TL  + A + ++  + 
Sbjct: 283 GK---TFRCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLRL 339

Query: 355 AN----KFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIP 410
                 K +        D ALY PNPF    Y        + +   LYLVDGGE+G+NIP
Sbjct: 340 VKDMGAKDVPNNPLTRPDYALYRPNPF----YKLLTVNNELTKENHLYLVDGGENGENIP 395

Query: 411 LIPLLQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDI------------ 458
           + PLL  +R+LDVIFALD+S+D+N Y PNG  L   Y   F    + +            
Sbjct: 396 IRPLLLPQRKLDVIFALDSSSDSNNY-PNGTILRNLYN-NFHNGQESLNITREGITSNID 453

Query: 459 AFPYVPDVSTFVELGLNKRPTFFGCDATNL----------TDLDYIPPLVVYMPNTKESF 508
             PY+P+  +FVE  L  RP  FGC  ++           T+   +PP+V+Y  N   S+
Sbjct: 454 LLPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSY 513

Query: 509 NSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRRK--QQSMNATL 566
           +SN STFK SY+S     M++NG +         ++ +  C+ C +I+R+  ++   A L
Sbjct: 514 SSNTSTFKQSYNSSEIEGMLRNGQDIF---GFDANNTYHKCLGCIIIKREYDRRQTTAEL 570

Query: 567 PEECEKCFTNYCWN 580
           PE C +C+ +YC+N
Sbjct: 571 PEFCHQCYQDYCFN 584

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 2/33 (6%)

Query: 127 GLLQSTTYLAGLSGGNWLVGTLAWN--NWTSVQ 157
           GLL    Y++GLSGG+W++ +L  +  N+ S+Q
Sbjct: 15  GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQ 47

>Kwal_0.173
          Length = 507

 Score =  199 bits (505), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/419 (33%), Positives = 196/419 (46%), Gaps = 60/419 (14%)

Query: 198 VDAKQDAGFNASLTDVWGRALSYDFFPTLPNGG-DAYTWSTLREADVFKNAEMPFPISVA 256
           V +K+ +GF  S TD WG AL     PT   G   A+   + R    F+  E+P PI VA
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSISAFADKSQR----FQRYEVPLPIFVA 168

Query: 257 DGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFD 316
           + +       NL   VFEF PFE GSW  ++R F  ++YLG+++  GTP+   +CI GFD
Sbjct: 169 NCKND-----NLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTPQ---KCIIGFD 219

Query: 317 NTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSY--LYKFANKFLTGLSK---------- 364
             GF+  T                 L+  SL +   +    + F  G+ K          
Sbjct: 220 EVGFVTATSSSLFNSVLMY---VWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEAN 276

Query: 365 --DYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELD 422
              + + A+Y PNPF    Y     +  + +   LYLVDGGEDG+NIP+ PLL  ER+LD
Sbjct: 277 IMSHPEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLD 332

Query: 423 VIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPY-----VPDVSTFVELGLNKR 477
           VIFALD+S+D   + PNG  L   Y+  +         PY     +P    FV   L  R
Sbjct: 333 VIFALDSSSDVCSF-PNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSR 391

Query: 478 PTFFGCDATNLTDLD-----------YIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRA 526
           P  FGC   +   L+            +PP+++Y  N   SF SN STFKL YS      
Sbjct: 392 PVAFGCHMESYPTLNSTNWVRNSSHLELPPILIYHANANHSFASNLSTFKLKYSKIEVEQ 451

Query: 527 MIKNGFEAVTRNNLTDDSDFVSCVACAVIRRKQQSM-----NATLPEECEKCFTNYCWN 580
           M++NG    +     D   +  C+AC +++R             LP  C+ CF+ YC+N
Sbjct: 452 MLRNGKHIFS---FDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  182 bits (463), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 131/421 (31%), Positives = 207/421 (49%), Gaps = 54/421 (12%)

Query: 183 NVLETTSRWD-------DISDAVDAKQDAGFNASLTDVWGRALSYDF-FPTLPNGGDAYT 234
           N+ E  S++        D+   + +K+  GF  S TD W +AL  +  +  LP      T
Sbjct: 121 NLFEKLSKFKNALQFYIDLHLHIRSKRINGFPISFTDYWAQALVQNIKYRQLPT---HLT 177

Query: 235 WS-TLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNV 293
           +S ++R ++ FKN  +P PI VA+ R        L   +FEF P+E GSW++ L  F N+
Sbjct: 178 YSKSVRTSNYFKNYLVPIPIIVANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNI 232

Query: 294 KYLGTKVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXX----XXXXXTLMLLNASLPS 349
           +YLG+++ NG      QC  G D+ GFI  T                  +     A++ +
Sbjct: 233 EYLGSRIINGVSH---QCYKGLDDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKT 289

Query: 350 YLYKFA---NKFLTGLSKDYD-------DIALYAPNPFKGTNYVFENYTRSIVESEILYL 399
            L  F     KF + L            D A+Y  NPF    Y + N    + +++ LYL
Sbjct: 290 VLAVFGLGTTKFESALQTSSQITAALDTDYAVYRHNPF----YKYSNIKNELAQNDYLYL 345

Query: 400 VDGGEDGQNIPLIPLLQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIA 459
           VDGGEDG+NIP+  L+   R +D+I  +D+S+D   Y  NG  L     +  EK+G  I 
Sbjct: 346 VDGGEDGENIPIRTLV--PRNVDMIMIMDSSSDKKNY-ANGDKLKIVLNQMKEKEG--IY 400

Query: 460 FPYVPDVSTFVELGLNKRPTFFGCDATNLTDLDYIPPLVVYMPNTKESFN--SNQSTFKL 517
           + Y   + T       KRPT  GC     +D   + P++VY PN++ S    +N STFK+
Sbjct: 401 YRYPTKIVTS-----QKRPTIIGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKM 454

Query: 518 SYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNY 577
            Y+SE ++ +I +G+  VT +    + D+  C+AC +++R     +   P++C  C++ Y
Sbjct: 455 IYTSEEQQLLIDHGYTLVTGHG---EHDYQKCMACILVKRSYDQASIIPPKQCSICYSKY 511

Query: 578 C 578
           C
Sbjct: 512 C 512

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  184 bits (468), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 198/410 (48%), Gaps = 51/410 (12%)

Query: 191 WDDISDAVDAKQDAGFNASLTDVWGRALSYDF---FPTLPNGGDAYTWSTL-READVFKN 246
           +  +   +  K+  GF  S TD WG+A+       F   PN   ++++S L   +  FK 
Sbjct: 253 YKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPN--HSFSFSKLVNSSKKFKE 310

Query: 247 AEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPE 306
             +P PI VA+ +  G     L+  +FEF PFE GSW+  LR F  + YLG+K+ +G  E
Sbjct: 311 CSVPIPIFVANCK-NGL----LSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKAE 365

Query: 307 TKGQCIAGFDNTGFIMGTXXXXXX--------XXXXXXXXTLMLLNASLPSYLYKFANKF 358
              +CI  FD+ GFI  T                       +  LN  +   ++    + 
Sbjct: 366 ---KCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMG--IFGLGKEE 420

Query: 359 LTGLSKDYD----DIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPL 414
           +  +SKD      D A+Y PNPF    Y++      +     LYLVDGGEDG+NIPL  L
Sbjct: 421 IFSISKDSSRLETDYAVYQPNPF----YLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTL 476

Query: 415 LQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGL 474
           +  ERELDVIF LD+S+D + Y PNG  L + +E+  E   +++ + +  +V TF     
Sbjct: 477 VIPERELDVIFVLDSSSDIDNY-PNGSKLKRIFEKLDE---ENVHYQFPNNVKTFT---- 528

Query: 475 NKRPTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEA 534
              P   GC+AT  T  D   P+++Y  N      SN STFK++Y+     +M+  G   
Sbjct: 529 --HPIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTG--- 583

Query: 535 VTRNNLTDDSD--FVSCVACAVIRRKQQSM--NATLPEECEKCFTNYCWN 580
             R   ++D D  + +C+ C + +R    +         C +CF +YC++
Sbjct: 584 --RGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS 631

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (46%), Gaps = 20/145 (13%)

Query: 10  LLSTVGAWSPTNSYTPGNVTCDDDINLVREAVG-LSTDESEWLKKREVYTNSALEDFLNR 68
           LL+ V A +P     P +        L+REA   L  +E+ +LKK+++ T + L  FL  
Sbjct: 11  LLTVVLATAPFQVQCPSS-------PLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKS 63

Query: 69  ATENFTDNSIVKTLFNSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGL 128
            TE    +   K +      P+IG+A SGGGYR            ++           GL
Sbjct: 64  LTEAKFSSKFYKRVL--KDPPKIGIAISGGGYRSMLVGTGFISQMNDY----------GL 111

Query: 129 LQSTTYLAGLSGGNWLVGTLAWNNW 153
            + + Y+AGLSGG+W++  L   N+
Sbjct: 112 FEYSDYIAGLSGGSWILMDLVVQNF 136

>Scas_695.10
          Length = 553

 Score =  171 bits (433), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 187/396 (47%), Gaps = 61/396 (15%)

Query: 186 ETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYT-------WSTL 238
           E  + + D+   V  K+  GF  S TD WG AL       L N    ++       +S L
Sbjct: 172 EVLNFYIDLHLRVRTKKIQGFFVSFTDYWGEAL----LKRLNNKDKKFSAFANTVSFSKL 227

Query: 239 READV-FKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLG 297
            E+++ F   E P PI VA+ R        L   +FEF+PFE GSW++ LR F  + YLG
Sbjct: 228 IESNLKFSKFEAPIPIFVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLG 282

Query: 298 TKVNNGTPETKGQCIAGFDNTGFIMGTXXXXXXXXXXXXXXTLMLLNASLPSYLYKFANK 357
           +K+ NGT +    C   FD+ GFI  T               +    +SL +     A  
Sbjct: 283 SKIVNGTAKI---CYKEFDDIGFITATSSSIFNNVLIFIWQKMS--RSSLEAMKSVKAVM 337

Query: 358 FLTGLSKDYD----------------DIALYAPNPFKGTNYVFENYTRSIVESEILYLVD 401
            L GL    D                D A+Y  NPF    + + N   ++ + + LYLVD
Sbjct: 338 GLFGLIGTKDSTKPLTLSNTAIAPETDYAVYYHNPF----FRYPNIDNALTKDDHLYLVD 393

Query: 402 GGEDGQNIPLIPLLQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFP 461
           GGEDG+NIPL  L+  ER++DVIFA+D+S+D N Y  NG  L  T  R  EK G     P
Sbjct: 394 GGEDGENIPLRSLIIPERKVDVIFAIDSSSDVNNY-ANGTKLI-TILRHLEKLGYHYKIP 451

Query: 462 YVPDVSTFVELGLNKRPTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSS 521
            +              P  FGC+A +L       P+++Y  NT+ S+ SN STFK++Y+ 
Sbjct: 452 KISKKRI-------NHPLIFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNE 497

Query: 522 ENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRR 557
               AM++NG +    N   ++  + +C+ C + +R
Sbjct: 498 TEVGAMLQNGMDIFNDN---ENIYYQNCLGCILSKR 530

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 86  SSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGLLQSTTYLAGLSGGNWLV 145
           S+ P IGVA SGGGYR              +          GL    +YL+GLSGG+W++
Sbjct: 6   SNPPNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVL 55

Query: 146 GTLAWNNWTSVQHI 159
             L  NN+   + I
Sbjct: 56  MDLIVNNFNITKMI 69

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  164 bits (416), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 127/419 (30%), Positives = 192/419 (45%), Gaps = 47/419 (11%)

Query: 191 WDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMP 250
           + ++   V  K++AGF  SLTD  G+AL  D  P           S   +++ FK  + P
Sbjct: 280 YINLHRQVRQKKEAGFPISLTDYLGQAL-LDRLPA-QKQDHLKQLSNFVQSESFKKFDAP 337

Query: 251 FPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQ 310
            P+ VA+ +   ++   L+  VFEF PFE GSW  ++  F + KYLG+    G      +
Sbjct: 338 IPVFVANAK--TSKGPELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGKLT---K 392

Query: 311 CIAGFDNTGFIMGTXXXXXXXXXXXXXXTL---MLLNASLPSYLYKFANKFLTGLSKDYD 367
           C+ GFDN GFI  T              T+   +  N  L +    F   F  G +    
Sbjct: 393 CVNGFDNLGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFG-VFGVGFNAIRS 451

Query: 368 DIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFAL 427
           D A+Y PNPF    Y        I ++  L+LVDGGEDG+NIPL  L    R+ DVIF +
Sbjct: 452 DYAIYQPNPF----YKDPEVLNLISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIV 507

Query: 428 DNSADTNQYWPNGFSLTQTYER--QFEKQGDDIAF----------PYVPDVSTFVELGLN 475
           D+S+D  +  P+   L  TY+     E+Q   +A           PY+P     +    +
Sbjct: 508 DSSSD-KENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFS 566

Query: 476 -KRPTFFGC-----DATNLTDL--------DYIPPLVVYMPNTKESFNSNQSTFKLSYSS 521
              P  FGC     +   LTD           +PP+++Y  N   +F SN STFKL+Y+ 
Sbjct: 567 LSTPIAFGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTK 626

Query: 522 ENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580
           +    M+ NG      NN     +++ C+ C ++ R+ Q + ++    C+ C    C+N
Sbjct: 627 DEYNGMLNNGHHLF--NNDDTQGEYLQCLGCVMLLRQNQELVSSF---CDACIRKVCYN 680

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 57/128 (44%), Gaps = 18/128 (14%)

Query: 23  YTPGNVTCDDDINL-VREAVGLSTDESEWLKKREVYTNSALEDFLNRATENFTDNSIVKT 81
           Y P NV C  D++L   +   LS  E ++L KR        E F       + D +I   
Sbjct: 21  YAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTEVIKGKFEKF-------YEDLAIPGI 73

Query: 82  LFNSSSAPRIGVACSGGGYRXXXXXXXXXXXXDNRTRGSVEHGLGGLLQSTTYLAGLSGG 141
             +S   PRI VA SGGG+R                 G  +HGL    + T+Y+AG+SGG
Sbjct: 74  NVDSLQFPRIAVAISGGGFRSMLISSGF-------VLGMQQHGL---WECTSYVAGISGG 123

Query: 142 NWLVGTLA 149
           +W +  L 
Sbjct: 124 SWTLLKLV 131

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 16/169 (9%)

Query: 342 LLNASLPSYLYKFANKFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESE---ILY 398
           L   +L  Y+  F   FL    + Y  ++         T+Y+FE ++R I E E   +LY
Sbjct: 213 LKKLNLNVYIQNFETAFLNSTREYYRKMSQEYLQTHSVTDYIFEAHSR-IAEEESKIVLY 271

Query: 399 LVDGGE----DGQNIPLIPLLQEERELDVIFALDNSADTN-----QYWPNGFSLTQTYER 449
           L D       D  N  LI    EE + + I  L +  +T      +     F+L     +
Sbjct: 272 LDDHTRKPLSDTLNEVLIAEHAEELKSEFILLLKSRDETKISTLYELMQRDFTLLPELAK 331

Query: 450 QFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDLDYIPPLV 498
            FE+  +D+      +V   +E       +  G  A  L+  DYI  L+
Sbjct: 332 SFEEHVEDVG---QSEVRKLLESHKEASNSDSGKKAAPLSPRDYIKTLI 377

>Scas_668.4
          Length = 195

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 401 DGGEDGQNIPLIPLLQEER-ELDVIFALDNSADTNQY 436
           D GE+G ++P  P+  EE+ EL   FAL+N +   QY
Sbjct: 26  DDGEEGDSVPEYPMDSEEQEELIQNFALNNYSRNQQY 62

>Kwal_56.23557
          Length = 594

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 384 FENYTRSIVESEILYLVDGGEDGQNIPLIPLL 415
            + YT  +  + ++Y  + G+DGQ +P  PLL
Sbjct: 149 IDGYTAQVSHTMVIYPTEDGKDGQKVPTGPLL 180

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,470,201
Number of extensions: 885481
Number of successful extensions: 2110
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2085
Number of HSP's successfully gapped: 39
Length of query: 658
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 550
Effective length of database: 12,857,365
Effective search space: 7071550750
Effective search space used: 7071550750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)