Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1893.328128114850.0
Kwal_23.58252432635062e-63
ADL073W2772685032e-62
YIL049W (DFG10)2532784978e-62
CAGL0L00693g2492784438e-54
Scas_704.372512764325e-52
KLLA0C08261g2332654072e-48
YBL088C (TEL1)2787109740.29
Kwal_47.1772659137681.2
KLLA0C03223g52034662.2
Kwal_55.1993559350652.8
Scas_651.140651643.6
Scas_682.17192362627.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1893.3
         (281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           576   0.0  
Kwal_23.5825                                                          199   2e-63
ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   198   2e-62
YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   196   8e-62
CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   175   8e-54
Scas_704.37                                                           171   5e-52
KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   161   2e-48
YBL088C (TEL1) [113] chr2 complement(51016..59379) Phosphatidyli...    33   0.29 
Kwal_47.17726                                                          31   1.2  
KLLA0C03223g 291786..293348 no similarity, hypothetical start          30   2.2  
Kwal_55.19935                                                          30   2.8  
Scas_651.1                                                             29   3.6  
Scas_682.17                                                            28   7.1  

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MYEEGDMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKE 60
           MYEEGDMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKE
Sbjct: 1   MYEEGDMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKE 60

Query: 61  KREMTNVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLY 120
           KREMTNVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLY
Sbjct: 61  KREMTNVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLY 120

Query: 121 ESYCISKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVF 180
           ESYCISKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVF
Sbjct: 121 ESYCISKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVF 180

Query: 181 LASSYNQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLAD 240
           LASSYNQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLAD
Sbjct: 181 LASSYNQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLAD 240

Query: 241 GLKYCLLWVGINLSVSAIETRNYYSHRYQDVAPHAIIPFVL 281
           GLKYCLLWVGINLSVSAIETRNYYSHRYQDVAPHAIIPFVL
Sbjct: 241 GLKYCLLWVGINLSVSAIETRNYYSHRYQDVAPHAIIPFVL 281

>Kwal_23.5825
          Length = 243

 Score =  199 bits (506), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/263 (44%), Positives = 166/263 (63%), Gaps = 31/263 (11%)

Query: 20  ASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQILDFFESIVV 79
           ASF+V I+ V LAKW+L   LKYGKTL        +G+  +K        +L FFE + V
Sbjct: 11  ASFLVGIASVHLAKWQLPALLKYGKTL--------EGSRTQK-------GLLGFFEQLTV 55

Query: 80  PRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISKFGAESKMNISHY 139
           P+ WF+HFY+ ST  +++N ++   +L++ L L HS RRLYE+ C++K+G  S+M++SHY
Sbjct: 56  PKQWFTHFYVYSTTLAILN-VYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHY 114

Query: 140 LVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSYNQYQNHVYLSQLVK 199
           LVG+WFY+  N  +++  SK     S S     + +A+ VF  SS +QY NH++LS+LVK
Sbjct: 115 LVGLWFYSVAN--WAVFESK-----SRSQLPLVRFLAVLVFALSSVDQYMNHLHLSKLVK 167

Query: 200 YTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLLWVGINLSVSAIE 259
           YT P  GLF   +  HYFDE+L+Y SL  Y      G L   L  CL+WV +NLS SA+E
Sbjct: 168 YTMPTYGLFSITTSPHYFDEVLLYLSLTAYT-----GSLK--LFACLVWVIVNLSTSALE 220

Query: 260 TRNYYSHRY-QDVAPHAIIPFVL 281
           TR +Y  ++ Q   P+AIIPFVL
Sbjct: 221 TRAWYLKKFPQTTPPYAIIPFVL 243

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  198 bits (503), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 168/268 (62%), Gaps = 24/268 (8%)

Query: 17  LIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQILDFFES 76
           LI  S+ + +  + LAK++L   L+YGKT               ++++  V++   ++ S
Sbjct: 31  LIHFSYGIGLFSLWLAKYRLPKLLQYGKT--------------RQKKLVGVIE--PWYTS 74

Query: 77  IVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISKFGAESKMNI 136
           I VPR +FSHFY++S   +  N  W+P  +I     FHSLRRL ES  ++K+G+ES+M+ 
Sbjct: 75  IAVPRRYFSHFYVLSFVLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHA 134

Query: 137 SHYLVGIWFYTSLNLIFSIGLSKDNKITSLSS-NSAFQLIALFVFLASSYNQYQNHVYLS 195
           +HYLVG+WFY+ LNL   + L+   +  S S+ N  F  +    FL +S++Q +NH++L+
Sbjct: 135 AHYLVGLWFYSVLNLSVYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLA 194

Query: 196 QLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLLWVGINLSV 255
            ++KYT P++GLFK V+CAHYFDEI+IY+SL      +R+      L   ++WV  NL V
Sbjct: 195 HMIKYTLPRRGLFKIVACAHYFDEIVIYASLAAMEATTRW-----SLTVAVIWVCANLGV 249

Query: 256 SAIETRNYYSHRY--QDVAPHAIIPFVL 281
           SA+ET+ YY  ++  Q VAP+A+IP+++
Sbjct: 250 SAVETKRYYDAKFKGQAVAPYALIPYIM 277

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  196 bits (497), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 164/278 (58%), Gaps = 30/278 (10%)

Query: 6   DMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMT 65
           D ++ +K        SF V I  + +AK  L  FL+YGKT    ++ K+           
Sbjct: 4   DEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSS--------- 54

Query: 66  NVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCI 125
               IL+  +   VP+A+FSHFY ++TF SLV   +YP   I W+   HSLRRLYE+  +
Sbjct: 55  ----ILERIKKFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYV 110

Query: 126 SKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSY 185
             + + S+MN SHYLVGIWFY+ L LI +I L K++   +L+ N      A  +F  +S+
Sbjct: 111 LHYTSNSRMNWSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMN------AFIIFCIASW 164

Query: 186 NQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYC 245
           +QY+NHV L+ LVKY+ P   LF+ V C HY DEI+IYS+L  Y +              
Sbjct: 165 DQYKNHVILANLVKYSLPTGRLFRLVCCPHYLDEIIIYSTLLPYEQ---------EFYLT 215

Query: 246 LLWVGINLSVSAIETRNYYSHRYQD--VAPHAIIPFVL 281
           L+WV  +L++SA+ET+NYY H+++D  VAP+AIIPF++
Sbjct: 216 LVWVITSLTISALETKNYYRHKFKDNHVAPYAIIPFII 253

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  175 bits (443), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 162/278 (58%), Gaps = 33/278 (11%)

Query: 6   DMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMT 65
           D    ++ IT+ +  S +V +  +++AK+ L  FL+YGKT     +    GNE       
Sbjct: 3   DNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKN----GNE------- 51

Query: 66  NVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCI 125
               I D  ++  VP+++F+HFYI+S+  +LV    YP  ++ W    HS RRLYE+  I
Sbjct: 52  ---NIWDKIKNFSVPKSYFAHFYILSSVLALVTLASYPTDILVWQLFLHSSRRLYETLYI 108

Query: 126 SKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSY 185
           SK+  +SKMN SHY VG+WFY+ LN++  + + ++        N+  +++ + V + +S+
Sbjct: 109 SKYTEKSKMNWSHYAVGLWFYSQLNILVYLRVQRE--------NTTARVLPILVMVLASW 160

Query: 186 NQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYC 245
           +QY+NHV LS+L KY+ P+  LF+ V C HY DE++IY SL  Y              + 
Sbjct: 161 DQYKNHVVLSKLKKYSLPRSRLFELVCCPHYLDEMIIYGSLVSYGH---------EFVWP 211

Query: 246 LLWVGINLSVSAIETRNYYSHRYQD--VAPHAIIPFVL 281
           L+WV  +LS+SA+E+R +Y  +++D  V  +A IP++L
Sbjct: 212 LIWVIASLSISALESRKFYLSKFKDTEVPRYAAIPYIL 249

>Scas_704.37
          Length = 251

 Score =  171 bits (432), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 160/276 (57%), Gaps = 30/276 (10%)

Query: 8   DRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNV 67
           D  +  + +   +SF + +  + +AK+ L  FL+YGKTL    +    G+         V
Sbjct: 4   DTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTL----NTAQSGD---------V 50

Query: 68  LQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISK 127
           + + D      VP+++FSHFY +S   S+     YP + + WL  FHSLRRLYE+  + K
Sbjct: 51  MTLWDKIIHFTVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCK 110

Query: 128 FGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSYNQ 187
           + ++S+MN SHY+VGIWFYT L+LI +I L  +        +    + ALF+ + +S++Q
Sbjct: 111 YTSKSRMNWSHYVVGIWFYTVLHLILNICLYFERI------SPTINISALFILILASWDQ 164

Query: 188 YQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLL 247
           Y+NH  L+ L KY+ P + LFK V C HY DE++IYS+   Y              + L+
Sbjct: 165 YKNHRVLAHLRKYSLPTQRLFKIVCCPHYLDEMIIYSTFLSYNA---------EFIWPLI 215

Query: 248 WVGINLSVSAIETRNYYSHRY--QDVAPHAIIPFVL 281
           WV ++LS+SAIET+N+Y  ++  ++V  ++IIP++L
Sbjct: 216 WVVVSLSISAIETKNFYKSKFVEENVPDYSIIPYIL 251

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 154/265 (58%), Gaps = 38/265 (14%)

Query: 16  LLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQILDFFE 75
           +L+ ++F V I  V +A++ +   LKYGKT                 E +N     +F+ 
Sbjct: 6   ILLYSTFYVGIISVFVAEFYIPQLLKYGKTW----------------EASN-----NFWY 44

Query: 76  SIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISKFGAESKMN 135
           S+  P++ F HFY++S+ FS+ N +W    L+      HS+RRLYE YC++K+G +SK++
Sbjct: 45  SLTCPKSNFGHFYLLSSIFSIYNLLWIRS-LLTLSVFIHSVRRLYECYCVTKWG-QSKIH 102

Query: 136 ISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSYNQYQNHVYLS 195
           +SHYLVGIWFYT+LNL           I      + + LI++ +F+ SS +Q  NH YLS
Sbjct: 103 LSHYLVGIWFYTTLNL----------GIMLYHGETQYSLISVILFIMSSLDQATNHDYLS 152

Query: 196 QLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLLWVGINLSV 255
           +L KY+ P  GLFK++  AHYFDE+LIY+S     + SR       L +C+LW+ +NL  
Sbjct: 153 KLKKYSQPSYGLFKYICSAHYFDELLIYTSFMLMDKGSR-----MLLIHCILWILVNLGT 207

Query: 256 SAIETRNYYSHRYQDVAPHAIIPFV 280
           S+ ET N+Y  ++   +   +IP+V
Sbjct: 208 SSFETGNWYQEKFGYRSRWYLIPYV 232

>YBL088C (TEL1) [113] chr2 complement(51016..59379)
           Phosphatidylinositol 3-kinase (PI kinase) homolog
           involved in control of telomere length and protection of
           telomeres from homologous recombination, involved with
           Mec1p in maintenance of genome stability and DNA damage
           checkpoint control [8364 bp, 2787 aa]
          Length = 2787

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 16/109 (14%)

Query: 5   GDMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREM 64
           GDM R  K    L+ ++    +SC+LLA       +K+ K LLS        +EK   ++
Sbjct: 482 GDMARLFKVCLPLVKSNESCQLSCLLLA-----NSIKFSKQLLS--------DEKTINQI 528

Query: 65  TNVLQILDFFESIVVPRAWF---SHFYIISTFFSLVNGIWYPGHLIAWL 110
            ++ ++ D    I+V    F    +   +   F  +NGI     +  WL
Sbjct: 529 YDLYELSDILGPILVTNESFMLWGYLQYVGKDFQSMNGISSADRIFEWL 577

>Kwal_47.17726
          Length = 591

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 241 GLKYCLLWVGINLSVSAIETRNYYSHRYQDVAPHAII 277
           G KYC+L +  N S  A+E+R  Y    Q     AII
Sbjct: 357 GGKYCILQIDPNFSPDALESRQVYGVTLQQKRNDAII 393

>KLLA0C03223g 291786..293348 no similarity, hypothetical start
          Length = 520

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 127 KFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKD 160
           K   E K NI+HY+    F+T +N++F I L KD
Sbjct: 275 KILKEQKANINHYM--DRFFTEINVLFPIILEKD 306

>Kwal_55.19935
          Length = 593

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 2   YEEGDMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDD 51
           YE+GD ++AIK +T  +D    +     L++K     F + G   L +DD
Sbjct: 311 YEKGDYEQAIKTLTEAVDQGREMRADYKLISK----SFARIGNAYLKMDD 356

>Scas_651.1
          Length = 406

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 20  ASFVVAISCVLLAKWKLTGFLKYGKTLLSV----DDKKHDGNEKEKREMTN 66
             FVV ++CV++ K+ L+  + Y   L++V    DD+K +  E EKR   N
Sbjct: 315 GKFVVGVTCVVIWKYLLSKPIVYW-ILINVFKISDDRKENSKELEKRIKQN 364

>Scas_682.17
          Length = 1923

 Score = 28.5 bits (62), Expect = 7.1,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 12  KCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQIL 71
           K I +LI+  F+   S + +AKW L    + G  L +V D   +G+EK    M   +  L
Sbjct: 782 KAIPVLIEKGFLKDDSPIEIAKWLLQ---QDGLNLATVGDYLGEGDEKNIAVMHAFVDEL 838

Query: 72  DF 73
           DF
Sbjct: 839 DF 840

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,546,153
Number of extensions: 400649
Number of successful extensions: 1435
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1430
Number of HSP's successfully gapped: 20
Length of query: 281
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 181
Effective length of database: 13,134,309
Effective search space: 2377309929
Effective search space used: 2377309929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)