Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1893.251351324790.0
Kwal_23.581951651619290.0
KLLA0C08283g51951918450.0
CAGL0L00671g54352916950.0
YER056C (FCY2)53352516750.0
Scas_715.47d53352916680.0
Kwal_34.1573051851716410.0
Scas_704.3654548016350.0
Scas_715.4953251816290.0
ADL074W52451416250.0
YER060W (FCY21)52851116070.0
CAGL0J02948g51551915800.0
YER060W-A (FCY22)53047615660.0
Scas_715.47d152352313950.0
CAGL0C00231g54050813740.0
Scas_715.54d2322315792e-71
Kwal_47.172165425444774e-53
KLLA0D05060g5235344703e-52
YGL186C (TPN1)5795454137e-44
Scas_710.305844383292e-32
CAGL0L06138g6313923249e-32
Scas_701.168682137e-21
Scas_690.1*636682235e-19
KLLA0D03454g637164711.3
Scas_640.16505104682.7
AGL147C189623674.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1893.2
         (513 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1893.2 YER056C, Contig c1893 1725-3266                           959   0.0  
Kwal_23.5819                                                          747   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   715   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   657   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   649   0.0  
Scas_715.47d                                                          647   0.0  
Kwal_34.15730                                                         636   0.0  
Scas_704.36                                                           634   0.0  
Scas_715.49                                                           632   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   630   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   623   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   613   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   607   0.0  
Scas_715.47d1                                                         541   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   533   0.0  
Scas_715.54d                                                          227   2e-71
Kwal_47.17216                                                         188   4e-53
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   185   3e-52
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   163   7e-44
Scas_710.30                                                           131   2e-32
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   129   9e-32
Scas_701.1                                                             87   7e-21
Scas_690.1*                                                            91   5e-19
KLLA0D03454g 293313..295226 similar to sp|P05316 Saccharomyces c...    32   1.3  
Scas_640.16                                                            31   2.7  
AGL147C [4165] [Homologous to ScYDR170C (SEC7) - SH] (420751..42...    30   4.4  

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/513 (92%), Positives = 474/513 (92%)

Query: 1   MSSSKEEYAIQDMEKQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITD 60
           MSSSKEEYAIQDMEKQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITD
Sbjct: 1   MSSSKEEYAIQDMEKQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITD 60

Query: 61  EEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFF 120
           EEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFF
Sbjct: 61  EEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFF 120

Query: 121 SVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQC 180
           SVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQC
Sbjct: 121 SVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQC 180

Query: 181 PPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSG 240
           PPWAACL            GYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSG
Sbjct: 181 PPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSG 240

Query: 241 ATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILG 300
           ATTAGGVL            WTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILG
Sbjct: 241 ATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILG 300

Query: 301 AASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYS 360
           AASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYS
Sbjct: 301 AASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYS 360

Query: 361 IALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXX 420
           IALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFME            
Sbjct: 361 IALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYLAIYIAI 420

Query: 421 XXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHI 480
              EHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHI
Sbjct: 421 SLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHI 480

Query: 481 GEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           GEYGGDIGFELGMGFSFITYNILRPLEIKYTGR
Sbjct: 481 GEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513

>Kwal_23.5819
          Length = 516

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/516 (69%), Positives = 416/516 (80%), Gaps = 3/516 (0%)

Query: 1   MSSSKEEYAIQDMEKQ--NPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPI 58
           MS  KEEY IQD+EK+  +  E+++ DS PVVESTEYT +S +DR AA L+AETKGIEP+
Sbjct: 1   MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV 60

Query: 59  TDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVA 118
           T+EEKDDDSI NAASMWFSANMVIAA++LGVLG  V+GLNFW  VL ++ FS LG+IPVA
Sbjct: 61  TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA 120

Query: 119 FFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGA 178
           ++SVFGAELG+RQMVLSRFL+GNVTARIFALIN+IACVGWGAVNTIASA LLHMINPGGA
Sbjct: 121 YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA 180

Query: 179 QCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWT 238
           +CPPWA CL            GYRVIHAYEKWSW+PNFAVFLVIIARLKI G+FS+GEW 
Sbjct: 181 RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI 240

Query: 239 SGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLI 298
           SG   A  VL            WTTYAADYTVYMPR+TNK K+FFA++FGL FPLCFS+I
Sbjct: 241 SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300

Query: 299 LGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNM 358
           LGAA+    + N+ + + ++   VGGL+YAILV +SLHGFG+FCCVLLAMSTVANNIPNM
Sbjct: 301 LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM 360

Query: 359 YSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXX 418
           YSIALGTQ++WEPLAK+PRVFWT+AGNLVTLAIAIPAYYKF SFM++FM+          
Sbjct: 361 YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI 420

Query: 419 XXXXXEHFFYRK-GFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIA 477
                EH F+RK  F+ YNVDDWN+WD+LPIGYAGC ALF+GA GVA GM QTYW GQIA
Sbjct: 421 GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQIA 480

Query: 478 RHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           R IG+YG DIGFE+G  FS I YNILRPLE+KY GR
Sbjct: 481 RKIGDYGADIGFEIGFCFSVIVYNILRPLELKYVGR 516

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/519 (69%), Positives = 414/519 (79%), Gaps = 10/519 (1%)

Query: 2   SSSKEEYAIQDMEKQNPLELTET------DSTPV-VESTEYTTVSFIDRWAAKLKAETKG 54
           SSSKEEY + D+EKQ   EL++T      +  PV VE+TE T +S++D  A+KL AETKG
Sbjct: 4   SSSKEEYVLHDVEKQ---ELSKTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKG 60

Query: 55  IEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGL 114
           IEPITD+EKDDD ILNAASMW SAN+VIAA++LG +GT VFGLNF E+VL I+FFSFLGL
Sbjct: 61  IEPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGL 120

Query: 115 IPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMIN 174
           +PVAFFSVFGAELG+RQ+VLSRFL+GNVTARIF  IN+IACVGWGAVNTIASASLLH++N
Sbjct: 121 LPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVN 180

Query: 175 PGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFST 234
           P G  CPPWA CL            GYRVIHAYEKWSWVPNFAVFLVIIARL  +G F+ 
Sbjct: 181 PSGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTA 240

Query: 235 GEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLC 294
           G W SG+TTAGGVL            WTTYA+DYTVYMPR+TNK K+F A+V GLAFPLC
Sbjct: 241 GSWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLC 300

Query: 295 FSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANN 354
           FS+ILGAA++ G   N  W + Y+ +SVGGL YAIL++DSL GFG FCCV+LA+ST++NN
Sbjct: 301 FSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNN 360

Query: 355 IPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXX 414
           IPNMYSIALGTQ+++EPLAKVPRV WTI GNLVTLAIAIPAYYKFE+FM++FM+      
Sbjct: 361 IPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYL 420

Query: 415 XXXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEG 474
                    EHF YR GFKGYNVDDW+RWD+LPIGYAG  ALFIGAFGVAFGM+Q YW+G
Sbjct: 421 AIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQG 480

Query: 475 QIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           QI R IGE GGDIGFELG GF+FITYNI RPLE KY GR
Sbjct: 481 QIGRLIGENGGDIGFELGAGFAFITYNIFRPLEKKYVGR 519

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/529 (60%), Positives = 385/529 (72%), Gaps = 19/529 (3%)

Query: 3   SSKEEYAIQDMEKQNPLELTETDSTPV-----------VESTEYTTVS-------FIDRW 44
           S   +Y + ++EKQ P+E  +T +                S+E  TV        FI R 
Sbjct: 16  SHSNDYELNEVEKQ-PVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRL 74

Query: 45  AAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVL 104
           A K+ AETKG+EP+TDEEK DDS+LNAASMWFSAN+V+A+YALG LG  VF LNF  SVL
Sbjct: 75  ALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVL 134

Query: 105 TIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTI 164
           TI+FF+ +GL+ VAFFSVFGAE G+RQM+LSRFL+GNVTAR+FA INV+ACVGWG VNT+
Sbjct: 135 TIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTV 194

Query: 165 ASASLLHMINPGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIA 224
            +A LLH++N G  Q P W  CL            GY +IHAYE+WSWVPNFAVFLVIIA
Sbjct: 195 VAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIA 254

Query: 225 RLKISGNFSTGEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFA 284
           RL  SG FS G WTSGATTAGGVL            WTTYAADYTVYMPR+ NK+KIFF 
Sbjct: 255 RLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFF 314

Query: 285 LVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCV 344
           L  GLAFPL F++ILGAAS  G   N  W   Y+  ++GGL YAILV +SLHGFGEFCCV
Sbjct: 315 LCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCV 374

Query: 345 LLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMS 404
           LLAMST+ANNIPNMY+IAL  Q+++EP ++VPRV WT+AGN   + I+IPA Y FE F+ 
Sbjct: 375 LLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLE 434

Query: 405 SFMEXXXXXXXXXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVA 464
           +FM+               EHF YR+GFKGYN++DWN WDRLPIG AGC+ALF+GAFGVA
Sbjct: 435 NFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVA 494

Query: 465 FGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
            GMSQTYW G+I+RHIG++GGDIGFELGM ++FI +NI+RPLEIKY GR
Sbjct: 495 LGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRPLEIKYFGR 543

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/525 (61%), Positives = 386/525 (73%), Gaps = 19/525 (3%)

Query: 8   YAIQDMEKQNPL------------------ELTETDSTPVVESTEYTTVSFIDRWAAKLK 49
           Y IQD+EK++P+                    +E D   +VES+E T +S+  ++ A L 
Sbjct: 9   YEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLN 68

Query: 50  AETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFF 109
           AETKG+EP+T++EK DDSILNAASMWFSANMVIA+YALG LG  VFGLNF +SVL IIFF
Sbjct: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128

Query: 110 SFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASL 169
           + +GLI VAFFSVFGAELG+RQM+LSR+L+GNVTARIF+LINVIACVGWG VNT  SA L
Sbjct: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188

Query: 170 LHMINPG-GAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKI 228
           L+M+N G G  CP WA CL            GY VIHAYEKWSWVPNFAVFLVIIA+L  
Sbjct: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248

Query: 229 SGNFSTGEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFG 288
           SG F  GEW  GATTAG VL            WTTYAADYTVYMP+STNK+KIFF+LV G
Sbjct: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308

Query: 289 LAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAM 348
           LAFPL F++ILGAAS      +  WK YY+ +++GG++YAILV +SL+GFG+FCCVLLA+
Sbjct: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368

Query: 349 STVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFME 408
           ST+ANNIPNMY++AL  Q++W PLAK+PRV WT+AGN  TL I+IPA Y F+ FM +FM+
Sbjct: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428

Query: 409 XXXXXXXXXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMS 468
                          EHFFYR+ F  YN+DDW+ W+ LPIG AG AAL +GAFGVA GM 
Sbjct: 429 SIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMC 488

Query: 469 QTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           QTYW G+I R IG+YGGDIGFELG  ++FI YNILRPLE+KY GR
Sbjct: 489 QTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRPLELKYFGR 533

>Scas_715.47d
          Length = 533

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/529 (61%), Positives = 380/529 (71%), Gaps = 18/529 (3%)

Query: 3   SSKEEYAIQDME-------------KQNPLELTET---DSTPVVESTEYT--TVSFIDRW 44
           S K  Y IQD+E                 ++L  T   +    +E TE T    SF +R 
Sbjct: 5   SDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRL 64

Query: 45  AAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVL 104
           A++L AETKGIE ITDEEK D SIL+A SMWFSANMVI+AY LG +G  V+GLNF   VL
Sbjct: 65  ASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVL 124

Query: 105 TIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTI 164
           TIIFFS LGL+PVAFFS+FGA+ G+RQMVLSRFL+GN TARI A+INVI+ VGWG VN++
Sbjct: 125 TIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSV 184

Query: 165 ASASLLHMINPGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIA 224
           AS+ LL+M+N G   CP WA C+            GY  IHAYE+WSWVPNFAVFLVIIA
Sbjct: 185 ASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIA 244

Query: 225 RLKISGNFSTGEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFA 284
           RL +SGNFS GEWTSG TTAG VL            WT YAADYTVYMPR TNK+KIFF+
Sbjct: 245 RLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFS 304

Query: 285 LVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCV 344
           LV GL+FPL F LILGAAS  G   N  W  YY+++ +GG+ YAILV DSLHGFGEFCCV
Sbjct: 305 LVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCV 364

Query: 345 LLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMS 404
           LLA+ST+ANNIPNMYSI L  Q++WEPLAKVPR  WT+AGN  TLAI+IPA Y F+ FM 
Sbjct: 365 LLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFME 424

Query: 405 SFMEXXXXXXXXXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVA 464
            FM                EHF +R+GFKGYNV+DW+   +LP+G AGCAALF+GAFGVA
Sbjct: 425 DFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVA 484

Query: 465 FGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
            GMSQTYW G+IARHIGEYGGDIGFELG G++F+ Y ILRPLEIKY GR
Sbjct: 485 LGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533

>Kwal_34.15730
          Length = 518

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/517 (59%), Positives = 385/517 (74%), Gaps = 7/517 (1%)

Query: 4   SKEEYAIQDME-KQNPLELTETD-----STPVVESTEYTTVSFIDRWAAKLKAETKGIEP 57
           +K++Y +QD+E      E T  D     S+   E      ++ ++R A KL+AETKGIEP
Sbjct: 2   AKDKYEVQDLELNVYSQENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIEP 61

Query: 58  ITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPV 117
           +T++EKDD SI NAA +WFSANMVIAA+++G+LG  VF LNFW  V++I+ F+F+G++PV
Sbjct: 62  VTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLPV 121

Query: 118 AFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGG 177
             +SVFG +L +RQMVLSRFL+GNVTARIFALINVIAC+GWG VNT+ SA LLHMINP G
Sbjct: 122 CLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPTG 181

Query: 178 AQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEW 237
            +CPPWA CL            GYRVIH + K+SW+PNF VF+VIIARLKI G+FS G+W
Sbjct: 182 GRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGKW 241

Query: 238 TSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSL 297
            SG+TTAG +L            WTTYAAD+TVYMPR+ N+ ++FFA++ GL FPLCF++
Sbjct: 242 ESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFTI 301

Query: 298 ILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPN 357
           ILGAA+      N ++ ++YE    GGLVYAILV  SLHGFG+FCCVLLAMSTVAN +PN
Sbjct: 302 ILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVPN 361

Query: 358 MYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXX 417
           MYSIALGTQ++WEPLAKVPRVFWT+AGNL+TLAIAIPAYY+FE+FM++FM+         
Sbjct: 362 MYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSIY 421

Query: 418 XXXXXXEHFFYRKG-FKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQI 476
                 EHF +R+  F  Y+  +WN W RLP+GYAGCAALF+GA GVA GM QTYW G+I
Sbjct: 422 IGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGEI 481

Query: 477 ARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
            R IGE+GGDIGFELG+ FS I Y  LRPLEIK+ GR
Sbjct: 482 GRLIGEFGGDIGFELGLAFSMIVYTALRPLEIKFVGR 518

>Scas_704.36
          Length = 545

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 366/480 (76%), Gaps = 1/480 (0%)

Query: 34  EYTTVSFIDRWAAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTG 93
           E T +SF +R+ A L AETKG+EP+TDEEK DDSI+NAASMWFSAN+VIA+YALG LG  
Sbjct: 67  EETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPI 126

Query: 94  VFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVI 153
           VF LNF  SVL IIFF+ LGL+ +AFFSVFGAE G+RQM+LSR+L+GN+TARIFA+IN+I
Sbjct: 127 VFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINII 186

Query: 154 ACVGWGAVNTIASASLLHMINPGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWV 213
           ACVGWG VNT+AS+ LL+M+N     CP WA CL            GY VIHAYEKWSWV
Sbjct: 187 ACVGWGVVNTVASSQLLNMVNTPN-NCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWV 245

Query: 214 PNFAVFLVIIARLKISGNFSTGEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMP 273
           PNFAVFLVIIARLK+SG F+ GEWTSG TTAG VL            WTTYAADYTVYMP
Sbjct: 246 PNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMP 305

Query: 274 RSTNKWKIFFALVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKD 333
           RSTNK+ IFF+L  GL+ PL F++ILGAAS  G   N  W  YY+ + +GG+ YAILV D
Sbjct: 306 RSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPD 365

Query: 334 SLHGFGEFCCVLLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAI 393
           SLHGFG+FCCVLLAMSTVANNIPNMY+IAL  Q++++P +KVPRV WT+AGN  TL I+I
Sbjct: 366 SLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISI 425

Query: 394 PAYYKFESFMSSFMEXXXXXXXXXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGC 453
            A Y F+ FM +FM                EHF YRKGF+GYNV+DWN W +LPIG AG 
Sbjct: 426 AACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGT 485

Query: 454 AALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           +AL +GAFGVA GMSQ+YW G+I + IG++GGDIGFELG  ++FI YN+LRPLEIKYTGR
Sbjct: 486 SALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545

>Scas_715.49
          Length = 532

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 375/518 (72%), Gaps = 10/518 (1%)

Query: 6   EEYAIQDMEK-----QNPLELTETD-----STPVVESTEYTTVSFIDRWAAKLKAETKGI 55
             Y + D+E+     ++P +   +D      +   E    T ++  +R AA L AETKGI
Sbjct: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74

Query: 56  EPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLI 115
           EPITDEEK+D S+LNAASMWFSANMVIAAYA+G LG  VFGLNF  S L IIFF+ LGL+
Sbjct: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134

Query: 116 PVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINP 175
           PVAFFS+FGA+LG+RQMVLSRFL+GN TARIF++IN +ACVGWG VNT+AS+ LL+M+N 
Sbjct: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194

Query: 176 GGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTG 235
           G  +CP WA C+            GYRVIH++EKW WVPNFA FLVIIARL  SGNFS G
Sbjct: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNG 254

Query: 236 EWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCF 295
           EWTSG TTAG VL            WTTYAADYTVYMPR+TNK+KIFF+LV GL+FPL F
Sbjct: 255 EWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFF 314

Query: 296 SLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNI 355
            +ILGAAS  G   N  W  YY ++ +GGL YAILV +SLHGFGEFCCV+L++S VANN+
Sbjct: 315 VMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNV 374

Query: 356 PNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXX 415
           PNMY+IAL  Q++W PLAK+PRVFWT+AGN  TL IAIPA Y F++FM  FM+       
Sbjct: 375 PNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDSIAYYLA 434

Query: 416 XXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQ 475
                   EHF YR+ F+ YNV+DW+   +LPIG AGC A  +G  GVA GM QTYW GQ
Sbjct: 435 IYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQ 494

Query: 476 IARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           I R IGEYGGD+GFELG G+SFI YN++RPLE+KY GR
Sbjct: 495 IGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/514 (60%), Positives = 377/514 (73%), Gaps = 4/514 (0%)

Query: 1   MSSSKEEYAIQDMEKQNP-LELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPIT 59
           MS +K++ +  D+EK+   L   E   TP V+ TEYTT+S+++RWAA+L AETKG+ P+T
Sbjct: 14  MSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVT 73

Query: 60  DEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAF 119
           ++E  D S+LNAASMWFSAN+VIAA+A+GVL T VF LN  E+VL  + FSF+G++ VAF
Sbjct: 74  EDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAF 133

Query: 120 FSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQ 179
           FSVFGAE G+RQM+LSR+LMGN TARIF LINVIACVGW +VNTIAS +LLHMINP GA+
Sbjct: 134 FSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGAR 193

Query: 180 CPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTS 239
           CPPWAA L            GYRVIHAYEKWSWVPN  VFL+IIARL I+GNF+ G    
Sbjct: 194 CPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLG 253

Query: 240 GATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLIL 299
           G  TAG  L            WTTYAADYTVYMP+++NK++IFF ++ GLA PL F+LIL
Sbjct: 254 GKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLIL 313

Query: 300 GAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMY 359
           GAA+   +  N  W +YY+ HSVGGL +AIL +++L GFG+FCCV+LAMSTVANNIPNMY
Sbjct: 314 GAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMY 373

Query: 360 SIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXX 419
           SIAL TQ++W   A+VPRVFWT+ GN  +L IAI AYYKFE+FM+SFM+           
Sbjct: 374 SIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIV 433

Query: 420 XXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARH 479
               EHF +RKGF+GY+V  W+R D LP GYAGCAAL +GA GVA GMS  Y+ G IA+ 
Sbjct: 434 ICVTEHFVFRKGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAKL 493

Query: 480 IGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
               GGDIGF L  GFSFI Y   RPLE+KYTGR
Sbjct: 494 A---GGDIGFLLAAGFSFIVYICCRPLELKYTGR 524

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/511 (60%), Positives = 369/511 (72%), Gaps = 15/511 (2%)

Query: 3   SSKEEYAIQDMEKQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITDEE 62
           S+ E Y   D+E     EL E              +SF++R AA L AETKGIEPIT++E
Sbjct: 33  STNEFY--DDVESHGTEELVEAK------------LSFLNRIAAGLSAETKGIEPITEDE 78

Query: 63  KDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSV 122
           K DDSILNAASMWFSANMV+ AYA+G LG  VF LNF +SV  IIFF+ LGL+ VAFFSV
Sbjct: 79  KTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNLLGLVSVAFFSV 138

Query: 123 FGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPP 182
           FGAELG+RQM+LSR+L+GN+ ARIF+ IN IAC+GWG VNT+AS+ +L+M+NPG  QCP 
Sbjct: 139 FGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLNMVNPG-HQCPL 197

Query: 183 WAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSGAT 242
           WA C+            GY VIHAYEKW+WVPNFAVFLVIIARL  S  F  GEWTSG T
Sbjct: 198 WAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSKKFVLGEWTSGPT 257

Query: 243 TAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILGAA 302
           TAG VL            WTTYAADYTVYMPR TNK+KIFF+LV GLA PL F++ILGAA
Sbjct: 258 TAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLATPLYFTMILGAA 317

Query: 303 SIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIA 362
                  +  WK YY+++S+GGL +A+LV +S+HGFG+FCCVLL++ST+ANN+PNMY+IA
Sbjct: 318 VAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLSTIANNVPNMYTIA 377

Query: 363 LGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXXXX 422
           L  Q+ WEPLAKVPRV WT+ GN   L IAIPA Y F +FM+ FM+              
Sbjct: 378 LSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSIGYYLAIYIAIAC 437

Query: 423 XEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHIGE 482
            EHF YR+ F  YNVDDW+ W+RLPIG AG AAL +GAFGVA GM QTYW G+I+R IG+
Sbjct: 438 SEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQTYWVGEISRLIGD 497

Query: 483 YGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           YGGDIGFELG+ ++FI YNI RP E+KY GR
Sbjct: 498 YGGDIGFELGLSWAFIVYNIARPFELKYFGR 528

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/519 (58%), Positives = 370/519 (71%), Gaps = 13/519 (2%)

Query: 3   SSKEEYAIQDMEKQNPLELTETDSTPVVESTEY-------TTVSFIDRWAAKLKAETKGI 55
           S +++  + DME Q      E+ +   VE+  Y       T +S ++R AA + AETKGI
Sbjct: 2   SYEDKKDLYDMEMQ-----VESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGI 56

Query: 56  EPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLI 115
           EPITD+EK+DDS++NAASMWFSANMV+ A A+G LG  VFGLNF  SVLTI+FF+ LGL 
Sbjct: 57  EPITDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLF 116

Query: 116 PVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINP 175
            VAFFSVFGA+ G+RQMVLSR+L+GN+TARIFALIN +ACVGWG VNT+A++ LL+ INP
Sbjct: 117 AVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINP 176

Query: 176 GGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTG 235
           G  Q P W  CL            GY+VIH YEK+SWVPNFAVFLV+IARLKISG F  G
Sbjct: 177 GSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNG 236

Query: 236 EWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCF 295
            W SG TTAG VL            WTTYAADYTVYMPR+TN +KIFFALV GLAFPL F
Sbjct: 237 AWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFF 296

Query: 296 SLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNI 355
           ++ILG+A          W+++Y  + +GGL +AILV DSLHGFG+FCCV+LAMST+ANN+
Sbjct: 297 TMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNV 356

Query: 356 PNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXX 415
           PNMY+IAL  QS+W+P AK+PRV WT+ GNL  L I+IPA Y F +FM  FM+       
Sbjct: 357 PNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLS 416

Query: 416 XXXXXXXXEHFFYR-KGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEG 474
                   EH  YR   F  YNV+DWN + +LPIG AG  +L +GAFGVA GMSQ+YW G
Sbjct: 417 IYISIALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVG 476

Query: 475 QIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           +IARHIGEYGGDI  ELG G++FI YNI RPLE+KY GR
Sbjct: 477 EIARHIGEYGGDIAIELGAGWAFIAYNICRPLELKYFGR 515

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/476 (61%), Positives = 356/476 (74%), Gaps = 1/476 (0%)

Query: 39  SFIDRWAAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLN 98
           SF +R AA L AETKGIEP+T++EK+DDSILNAA++WFSANMVI AY++G LG  VFGLN
Sbjct: 55  SFFNRIAAALNAETKGIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLN 114

Query: 99  FWESVLTIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGW 158
           F +SVL IIFF+ LGLIPVA FS+FG ELG+RQM+LSR+L GN+TAR F+L+NVIACVGW
Sbjct: 115 FGQSVLVIIFFNILGLIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGW 174

Query: 159 GAVNTIASASLLHMINPG-GAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFA 217
             +N   SA LL+M+N G G  CP WA CL            GY V+HAYEKWSWVPNFA
Sbjct: 175 CVLNISVSAQLLNMVNEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFA 234

Query: 218 VFLVIIARLKISGNFSTGEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTN 277
            FLVIIA+L  SG F  GEW  GATTAGGVL            W TYAADYTVYMP++T+
Sbjct: 235 AFLVIIAQLSRSGKFKGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTS 294

Query: 278 KWKIFFALVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHG 337
           K+KIFF++V GLAFPL F++ILGAA       +  WK YY+ +++GG++YAILV +SL+G
Sbjct: 295 KYKIFFSVVAGLAFPLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNG 354

Query: 338 FGEFCCVLLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYY 397
           FG+FCCVLLA+STVANN+P MY++AL  Q++W PLAK+PRV WT+AGN  TL I+IPA Y
Sbjct: 355 FGQFCCVLLALSTVANNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATY 414

Query: 398 KFESFMSSFMEXXXXXXXXXXXXXXXEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALF 457
            F+ FM +FM+               EHF YR+ F  YN+DDW+ W+ LPIG AG AAL 
Sbjct: 415 YFDGFMENFMDSIGYYLAIYIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAALI 474

Query: 458 IGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
            GAFGVA GM QTYW G+I+R IGEYGGDIGFELG  ++FI YNI+RPLE+KY GR
Sbjct: 475 AGAFGVALGMCQTYWVGEISRLIGEYGGDIGFELGGSWAFIIYNIVRPLELKYFGR 530

>Scas_715.47d1
          Length = 523

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 341/523 (65%), Gaps = 10/523 (1%)

Query: 1   MSSSKEEYAIQDMEKQNPL---------ELTETDSTPVVESTEYTTVSFIDRWAAKLKAE 51
           M      +   D+EKQ+P          + T  D      S+E + ++F+ + A +L AE
Sbjct: 1   MDKLFSSFKTTDLEKQDPAFVANEAISNDTTGEDDFSKTVSSEASNIAFLQKIATRLNAE 60

Query: 52  TKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSF 111
           T+GIEP+ D+EK D +I N   +WFSAN VI+AYA+G LG  VFGLNF  + LTI+FF+ 
Sbjct: 61  TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI 120

Query: 112 LGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLH 171
           +G++PVA+FS+FG ELG+RQMVLSR+L+GN+  R F+ IN IACVGW  +N+I SA LL+
Sbjct: 121 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 180

Query: 172 MINPGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGN 231
           M+N  G +CP WA  +            G +VI A+E+WSWVPN AVFLVIIARL  SG 
Sbjct: 181 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARLHKSGQ 240

Query: 232 FSTGEWTSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAF 291
           FS G+WTSG TTAG VL            W TY+ADYTVYMPR+TNK K+FF L   L  
Sbjct: 241 FSGGKWTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLCVALTV 300

Query: 292 PLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTV 351
           PLCF++ILGAA   G   NA W +YY  + +GGL Y +LV +S+HGFGEFCCVLLA+ST+
Sbjct: 301 PLCFTMILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLLALSTI 360

Query: 352 ANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXX 411
           ANN PNMY++    Q++WEPLA+VPR F T+ GN     +   A Y F+SFM  FM+   
Sbjct: 361 ANNTPNMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKFMDTLA 420

Query: 412 XXXXXXXXXXXXEHFFYRK-GFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQT 470
                       EH  +RK  FK Y+V DW  + +LPIG AG    F+ AFGVA GM Q+
Sbjct: 421 YYGAIYISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVALGMCQS 480

Query: 471 YWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           YW G+I R IG+ GGD+GFE+G  + FI Y ++RPLE+KY GR
Sbjct: 481 YWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRPLELKYFGR 523

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/508 (52%), Positives = 345/508 (67%)

Query: 6   EEYAIQDMEKQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITDEEKDD 65
           E+  ++D+  +      +  ST   +        FI      L AETKG+EPI + EK+D
Sbjct: 33  EDLELKDITFKEKFNELDNKSTETDKDETCFKSPFIIWLKRTLNAETKGVEPINENEKND 92

Query: 66  DSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSVFGA 125
            +I  ++ +WFSAN+V+AAY +G LG  V+ LNF  SVLTI+FF+ LGL+ V+FFSVFGA
Sbjct: 93  TNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFSVFGA 152

Query: 126 ELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPPWAA 185
           ELG+RQM++SR+L+GNVTARIFA +N I CVGW  +N   +A L  +I  GG   P W  
Sbjct: 153 ELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLPLWGG 212

Query: 186 CLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSGATTAG 245
           C+            GY+ IH YEKWSW+PN AVFL+II+R+KIS  FS G WTSG+TTAG
Sbjct: 213 CIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGSTTAG 272

Query: 246 GVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILGAASIA 305
            VL            W TY+ADYTVYMPR TNK++IFF    GLAF L F++I+GAA+  
Sbjct: 273 NVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGAAAGI 332

Query: 306 GIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIALGT 365
               N+ W + Y +  +GG+ YA+LV +SLHGFG+FCCV+LAMSTVANN+P+MY+IAL  
Sbjct: 333 CAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTIALSV 392

Query: 366 QSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXXXXXEH 425
           Q++WEPL  VPR  WTI  N+V L I+IPA Y F+SFM +FM                EH
Sbjct: 393 QALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGISLAEH 452

Query: 426 FFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHIGEYGG 485
             +R+ F  YNV+D + W++LPIG+AGC AL +G+FGVA GM+QTYW G+IAR IG YGG
Sbjct: 453 CVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIGTYGG 512

Query: 486 DIGFELGMGFSFITYNILRPLEIKYTGR 513
           DIGFELGM ++F+TY I+RP+EIKY GR
Sbjct: 513 DIGFELGMSWAFLTYIIIRPIEIKYYGR 540

>Scas_715.54d
          Length = 232

 Score =  227 bits (579), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 151/231 (65%), Gaps = 9/231 (3%)

Query: 1   MSSSKEEYAIQDMEKQNPL---------ELTETDSTPVVESTEYTTVSFIDRWAAKLKAE 51
           M      +   D+EKQ+P          + T  D      S+E + ++F+ + A +L AE
Sbjct: 2   MDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAE 61

Query: 52  TKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSF 111
           T+GIEP+ D+EK D +I N   +WFSAN VI+AYA+G LG  VFGLNF  + LTI+FF+ 
Sbjct: 62  TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI 121

Query: 112 LGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLH 171
           +G++PVA+FS+FG ELG+RQMVLSR+L+GN+  R F+ IN IACVGW  +N+I SA LL+
Sbjct: 122 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 181

Query: 172 MINPGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVI 222
           M+N  G +CP WA  +            G +VI A+E+WSWVPN AVFLVI
Sbjct: 182 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>Kwal_47.17216
          Length = 542

 Score =  188 bits (477), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 142/544 (26%), Positives = 226/544 (41%), Gaps = 49/544 (9%)

Query: 14  EKQNPLELTETDST-----PVVESTEYTTVSFIDRWAAKLKAETKGIEPITDEEK-DDDS 67
           EK + +  +ET+ +       V       +S   +    L  E +GI+ I   E+     
Sbjct: 4   EKVDDVVFSETEKSRGEGNQTVFGKVLNKLSVASKRLDALGVEIRGIQRIPAYERGTSKQ 63

Query: 68  ILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAEL 127
            L+ A +W SA   +++ +   LG  +F L F +S+++ +    +G    A+ S  G + 
Sbjct: 64  FLSVAGLWLSAAGGLSSMSSYFLGPLLFELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQS 123

Query: 128 GMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPPWAACL 187
           G RQMV +R+L G    +  +L ++I  +GW  VN +    +L  I+   ++ P W   +
Sbjct: 124 GCRQMVTARYLFGWYFVKFVSLASIIGVMGWSIVNCVVGGQMLAAIS--NSKIPLWVGII 181

Query: 188 XXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIA----RLKISGNFSTGEWTSGATT 243
                       G + +   E +  VP    FL++      +  +   F   +     T 
Sbjct: 182 IVTAVSFIVAIFGIKQVLRVETFLSVPVLTCFLLLYIAASDKYYLLDTFKNDD-IDPLTI 240

Query: 244 AGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILGAAS 303
            G  L            W +  ADY +  P  T  +K+F    FG   P  F  +LG   
Sbjct: 241 KGNWLSFFSLCYSITSTWGSITADYYILFPEDTAHYKVFLLTFFGTLIPTTFVGVLGLIL 300

Query: 304 IAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIAL 363
            +       WK  Y  + +GGL+++    +  +GFG+FC V+L  S ++NNI N YS A 
Sbjct: 301 ASCAASYEPWKAAYHKYGMGGLLFSGF--ERWNGFGKFCVVVLIFSLISNNIINTYSAAF 358

Query: 364 GTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXXXXX 423
             Q     +A+VPR  W IA  +  L  A+     F   + +F+                
Sbjct: 359 NIQLSSVHMARVPRWLWAIACTIFYLVCALVGRNHFSEILGNFLPMIGYWISMYFIILLE 418

Query: 424 EHFFYRKGFK----------------------------------GYNVDDWNRWDRLPIG 449
           E+  +R  F+                                   YN + WN  + L  G
Sbjct: 419 ENLIFRSHFRHLYTEEFPPHPVEEGESPRALRDIKNKKVSSRKHAYNWEMWNNAEVLTHG 478

Query: 450 YAGCAALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIK 509
           YA   A  +G  GVA  M+Q YW G IARH G++GGD+G  + MGFS   Y  LR  E++
Sbjct: 479 YAATFAFLVGVGGVALSMAQAYWIGPIARHFGDFGGDLGMWVSMGFSGTVYPALRYWELR 538

Query: 510 YTGR 513
           + GR
Sbjct: 539 HYGR 542

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  185 bits (470), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 149/534 (27%), Positives = 233/534 (43%), Gaps = 47/534 (8%)

Query: 15  KQNPLELTETDSTPVVESTEYTTVSFIDRWAAKLKA---ETKGIEPITDEEKDD-DSILN 70
           K++ +E+TE        S    + S I +++ KL A   E +GI+ I   E+       +
Sbjct: 2   KKSEVEVTE-------RSIFVRSASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWH 54

Query: 71  AASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAELGMR 130
            A +W SA   +++ +   LG  VF L F + +++ +   ++G    A+ SV G + G R
Sbjct: 55  VAGLWLSAAGGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCR 114

Query: 131 QMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPPWAACLXXX 190
           Q+V +R+L G    +  AL  ++  +GW  VN +    +L  ++ G  + P W   +   
Sbjct: 115 QIVTARYLFGWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASVSDG--KVPLWVGIIIVT 172

Query: 191 XXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIA----RLKISGNFSTGEWTSGATTAGG 246
                    G + +   E    VP    FL++      + K    FS  +  S  T  G 
Sbjct: 173 VVSLLVSIFGIKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEFSNSDIDS-LTVKGC 231

Query: 247 VLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILGAASIAG 306
            L            W +  ADY +  P  T + ++F    FG A P  F  +LG    + 
Sbjct: 232 WLSFFSLCYSITSTWGSITADYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASC 291

Query: 307 IEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIALGTQ 366
                 W+  Y+++ +GGL+ A   +   +GFG+F  V+L +S ++NNI N YS A   Q
Sbjct: 292 SLSYEPWQAAYDEYGMGGLMNAGFSR--WNGFGKFLVVVLILSLISNNIVNTYSAAFSIQ 349

Query: 367 SMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXXXXXEHF 426
                LAKVPR  W I   +  L  A+     F + + +F+                E+ 
Sbjct: 350 LSSVMLAKVPRWIWAIGCTIFYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENV 409

Query: 427 FYRKGFKG---------------------------YNVDDWNRWDRLPIGYAGCAALFIG 459
            +R  F                             YN D+W+  + +  G A  AA  IG
Sbjct: 410 IFRNWFHHLYKLEFPNDIEVKPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIG 469

Query: 460 AFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
             GV  GM QTY+ G +A  IGEYGGD+G  LGMGF+ ++Y  LR  E+K  GR
Sbjct: 470 VAGVVLGMCQTYYVGPLAAKIGEYGGDLGMWLGMGFAGVSYPPLRYCELKKFGR 523

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  163 bits (413), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 148/545 (27%), Positives = 232/545 (42%), Gaps = 60/545 (11%)

Query: 23  ETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPITDEEK--DDDSILNAASMWFSANM 80
           + +S+P +        +++ +    +  E+ GI+ I+  E+       L+ A +W SA  
Sbjct: 41  KANSSPSILRRIINRAAWLSKKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATG 100

Query: 81  VIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMG 140
            +++ +  +LG  +FGL+F ESV + +    +G +  A+ S+ G + G RQMV +R+L G
Sbjct: 101 GLSSMSSFLLGPLLFGLSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFG 160

Query: 141 NVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPPWAACLXXXXXXXXXXXXG 200
               ++ AL ++I  +GW  VN++    +L  I+    + P W   +            G
Sbjct: 161 WWFVKLVALASIIGVMGWSVVNSVVGGEMLAAIS--NDKVPLWVGIVIVTVCSFLVAIFG 218

Query: 201 YRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTSG----ATTAGGVLXXXXXXXX 256
            + +   E +  VP    FL++        +F     + G    +T  G  +        
Sbjct: 219 IKQVIKVETYLSVPVLTAFLLLYISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYS 278

Query: 257 XXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILG--AASIAGIEKNALWK 314
               W +  ADY +  P  T   +IF    FG   P CF  ILG   AS+A   K   W 
Sbjct: 279 ITATWGSITADYYILFPEDTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKP--WS 336

Query: 315 QYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIALGTQSMWEPLAK 374
             Y+ H +GGL++A   +   +GFG+FC V+L  S V+NNI N YS A   Q      AK
Sbjct: 337 VEYDSHGMGGLLWAGFQR--WNGFGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAK 394

Query: 375 VPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXXXXXEHFFYRKGF-- 432
           +PR FW+I   ++ L  A+     F + + +F+                E+  +R+ F  
Sbjct: 395 IPRWFWSIVCTIICLVCALIGRNHFSTILGNFLPMIGYWISMYFILLFEENLVFRRFFLH 454

Query: 433 --------------------------------------------KGYNVDDWNRWDRLPI 448
                                                         YN D W  ++ L  
Sbjct: 455 LYTKEFPTVTGEINGPELVGSSKEVEKDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTH 514

Query: 449 GYAGCAALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEI 508
           GYA   A  +G  GV  GM+Q YW G IA   GEYGGD+   L M FS + Y   R LE+
Sbjct: 515 GYAATFAFIVGVAGVVVGMAQAYWIGPIAAKFGEYGGDVAMWLSMAFSGVVYPPCRYLEL 574

Query: 509 KYTGR 513
           +  GR
Sbjct: 575 RKFGR 579

>Scas_710.30
          Length = 584

 Score =  131 bits (329), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 110/438 (25%), Positives = 191/438 (43%), Gaps = 16/438 (3%)

Query: 19  LELTETDSTPVVESTEYT-----TVSFIDRWAAKLKAETKGIEPITDEEK--DDDSILNA 71
           +E+ ET+ T V +S  Y      T + + +    L  E  GIE I+  E+       ++ 
Sbjct: 9   IEVAETEFTTVKKSPSYLRRLLHTANLLSKKLDSLGVEATGIERISPYERGSKRKQFIHV 68

Query: 72  ASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAELGMRQ 131
           A  W +A   +++ +  +LG  +FGL F ES+++ I    +G +  A+ S+ G + G RQ
Sbjct: 69  AGYWLAATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIMGPQSGCRQ 128

Query: 132 MVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQCPPWAACLXXXX 191
           MV +R+L G    +  AL  +I  +GW  VN++    +L  I+    + P W   L    
Sbjct: 129 MVTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASIS--NDKVPLWVGVLIVTL 186

Query: 192 XXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIA----RLKISGNFSTGEWTSGATTAGGV 247
                   G + +   E +  +P + +F+++      +     +F +       T  G  
Sbjct: 187 FSFLVAVFGIKQVLKVETYLSIPVWLMFILLYISSSDKYHYIDDFKS-PIPDRLTLKGNW 245

Query: 248 LXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLILGAASIAGI 307
           L            W +  ADY +  P  T+K+++F     G   P  F  +LG       
Sbjct: 246 LSFFSLCYSITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFVGVLGLCLSTVA 305

Query: 308 EKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMYSIALGTQS 367
                W   Y  + +GGL++A   +   +GFG+FC V+L +S ++NNI N YS A   Q 
Sbjct: 306 ATYEPWNDDYNKYGMGGLLHAGFKR--WNGFGKFCVVVLLLSLISNNIINTYSAAFSVQL 363

Query: 368 MWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEXXXXXXXXXXXXXXXEHFF 427
                AKVPR FW+I   ++ L  A+     F + + +F+                E+  
Sbjct: 364 ASVKAAKVPRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISMYFILLLEENVI 423

Query: 428 YRKGFKGYNVDDWNRWDR 445
           +R+ F      ++  +D+
Sbjct: 424 FREYFHHLYYKEFPEFDK 441

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 425 HFFYRKGFKGYNVDDWNRWDR---LPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHIG 481
           H   R+     +  +WN+WD    L  GYA   A   G  GV  GM+Q YW G +AR  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 482 EYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513
           E GGDI   L M FS + Y  LR  E++  GR
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLRYWELRRYGR 584

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  129 bits (324), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 104/392 (26%), Positives = 178/392 (45%), Gaps = 20/392 (5%)

Query: 51  ETKGIEPITDEEK-DDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFF 109
           ET GIE +   E+      L+ A +W SA   +++ +  +LG  +F L+F +++ + +  
Sbjct: 90  ETSGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMIS 149

Query: 110 SFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASL 169
             +G +  A+ S+ G + G RQMV +R+L G    +  AL  +I  +GW   N++    +
Sbjct: 150 VTVGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEM 209

Query: 170 LHMINPGGAQCPPWAACLXXXXXXXXXXXXGYRVIHAYEKWSWVPNFAVFLVIIARLKIS 229
           L  I+    + P W   +            G + +   E +  VP    FL++      S
Sbjct: 210 LAAIS--NDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYIS---S 264

Query: 230 GN--FSTGEW----TSGATTAGGVLXXXXXXXXXXXXWTTYAADYTVYMPRSTNKWKIFF 283
           GN  +   E+        T  G  +            W +  ADY +  P  T  +++F 
Sbjct: 265 GNRDYLVREYKPIDVPSKTIKGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVFL 324

Query: 284 ALVFGLAFPLCFSLILGAASIAGIEKN-ALWKQYYEDHSVGGLVYAILVKDSLHGFGEFC 342
             + G   P  F  ILG  ++A I K+   + + Y+ H +GGL++A   +   +GFG+F 
Sbjct: 325 LTLAGTLIPTTFVGILG-LTLASIAKSYQPYGEEYDTHGMGGLLWAGFSR--WNGFGKFL 381

Query: 343 CVLLAMSTVANNIPNMYSIALGTQ--SMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFE 400
            V+L +S ++NNI N YS A G Q  ++W   A+VPR FW I   +V L  A+     F 
Sbjct: 382 VVVLILSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIVCTIVYLVCALVGRNHFA 439

Query: 401 SFMSSFMEXXXXXXXXXXXXXXXEHFFYRKGF 432
           + + +F+                E+  +R+ F
Sbjct: 440 TILGNFLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 435 YNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHI-GEYGGDIGFELGM 493
           YN D+W+  D L  GYA   A   G  GV  GM+QTYW G IAR + G YGGDI   L M
Sbjct: 552 YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSM 611

Query: 494 GFSFITYNILRPLEIKYTGR 513
           GFS I Y  LR  E+   GR
Sbjct: 612 GFSGIVYPWLRYWELVRYGR 631

>Scas_701.1
          Length = 68

 Score = 86.7 bits (213), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 50/68 (73%)

Query: 446 LPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRP 505
           LPIG AG    F+ AFGVA GM Q+YW G+I R IG+ GGD+GFE+G  + FI Y ++RP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

Query: 506 LEIKYTGR 513
           LE+KY GR
Sbjct: 61  LELKYFGR 68

>Scas_690.1*
          Length = 636

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 50/68 (73%)

Query: 446 LPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRP 505
           LPIG AG    F+ AFGVA GM Q+YW G+I R IG+ GGD+GFE+G  + FI Y ++RP
Sbjct: 569 LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 628

Query: 506 LEIKYTGR 513
           LE+KY GR
Sbjct: 629 LELKYFGR 636

>KLLA0D03454g 293313..295226 similar to sp|P05316 Saccharomyces
           cerevisiae YBR021w FUR4 uracil permease, start by
           similarity
          Length = 637

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 36/164 (21%)

Query: 12  DMEKQNPLE----LTETDSTPVVESTEYTTV--------SFIDRWAAKLKAE-----TKG 54
           DMEK   ++    LTE DS    E  EY+++          +D+  +KL  +        
Sbjct: 56  DMEKDKIVQIDETLTENDSDENTEVIEYSSIWSKIYYDYILVDKTLSKLSIKESFLYNHD 115

Query: 55  IEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTI-IFFSFLG 113
           ++P+ +E++   +  N    W +    I  + +   G  + GLN+W++ +T+ I ++ +G
Sbjct: 116 LKPV-EEQRRRWAWYNFLWFWVADCFNINTFQIAATGLQL-GLNWWQTWITVWIGYALIG 173

Query: 114 LI---------------PVAFFSVFGAELGMRQMVLSRFLMGNV 142
           ++               PVA  S FG    +   VL+R +M  V
Sbjct: 174 ILVALASRIGSMYHVSFPVAARSSFGIYFSIWS-VLNRVVMATV 216

>Scas_640.16
          Length = 505

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 42/104 (40%), Gaps = 14/104 (13%)

Query: 56  EPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFG------LNFWESVLTIIFF 109
           EP++ E KD D +     MW  A+M     +LGVLG G  G      L   + V  +   
Sbjct: 184 EPLSLEGKDIDQL--DCEMWEKADMKEKIVSLGVLGEGAGGSVEKCKLKHGKKVFALKIV 241

Query: 110 SFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVI 153
           + L   P     +F      R++  ++    +   R + + N +
Sbjct: 242 NTLNTDPEFQKQIF------RELQFNKSFKSDYIVRYYGMFNDV 279

>AGL147C [4165] [Homologous to ScYDR170C (SEC7) - SH] (420751..426441)
            [5691 bp, 1896 aa]
          Length = 1896

 Score = 30.4 bits (67), Expect = 4.4,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 93   GVFGLNFWESVLTIIFFSFLGLI 115
            G FG++FWESV T + F   G++
Sbjct: 1494 GEFGISFWESVCTRLLFPIFGVL 1516

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,788,539
Number of extensions: 560300
Number of successful extensions: 1871
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1867
Number of HSP's successfully gapped: 34
Length of query: 513
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 407
Effective length of database: 12,926,601
Effective search space: 5261126607
Effective search space used: 5261126607
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)