Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1881.41301164734e-62
Kwal_33.14612129883996e-51
AFR044C126893404e-42
KLLA0F27907g1501143182e-38
YHR132W-A131973032e-36
Scas_697.15142962981e-35
CAGL0G06094g138922852e-33
YNL157W168952638e-30
AFR341C92862621.7
YBL019W (APN2)52072594.6
ABR112C214137586.6
CAGL0F05885g71247577.5
CAGL0A02145g39196578.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1881.4
         (130 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement      186   4e-62
Kwal_33.14612                                                         158   6e-51
AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH] ...   135   4e-42
KLLA0F27907g complement(2581760..2582212) some similarities with...   127   2e-38
YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the...   121   2e-36
Scas_697.15                                                           119   1e-35
CAGL0G06094g 583297..583713 highly similar to tr|Q9P305 Saccharo...   114   2e-33
YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with sim...   105   8e-30
AFR341C [3533] [Homologous to ScYDR495C (VPS3) - SH] (1055397..1...    28   1.7  
YBL019W (APN2) [176] chr2 (184318..185880) DNA repair protein th...    27   4.6  
ABR112C [704] [Homologous to ScYCR093W (CDC39) - SH] (594241..60...    27   6.6  
CAGL0F05885g 588828..590966 similar to sp|Q05080 Saccharomyces c...    27   7.5  
CAGL0A02145g join(219334..219344,220588..221752) similar to sp|P...    27   8.3  

>Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement
          Length = 130

 Score =  186 bits (473), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 95/116 (81%), Positives = 95/116 (81%)

Query: 1   MNNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYA 60
           MNNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYA
Sbjct: 1   MNNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYA 60

Query: 61  LSKAGVKSDDLQSDSIGSSHLPVTNPSGLXXXXXXXXXXXXXXXXXXXXXQQLNRQ 116
           LSKAGVKSDDLQSDSIGSSHLPVTNPSGL                     QQLNRQ
Sbjct: 61  LSKAGVKSDDLQSDSIGSSHLPVTNPSGLRESIIRRRMSSSAGSVDAAASQQLNRQ 116

>Kwal_33.14612
          Length = 129

 Score =  158 bits (399), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 85/88 (96%)

Query: 2  NNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYAL 61
          +ND+SPTSS+++L   VDTSK+TPQELKLYK+YGKLPSKKDLFKHKLQERKYFDSGDYAL
Sbjct: 4  DNDLSPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYAL 63

Query: 62 SKAGVKSDDLQSDSIGSSHLPVTNPSGL 89
          +KAGVKSDDLQSDSIG+SHLPVTNPSGL
Sbjct: 64 NKAGVKSDDLQSDSIGNSHLPVTNPSGL 91

>AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH]
          (511998..512378) [381 bp, 126 aa]
          Length = 126

 Score =  135 bits (340), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%)

Query: 1  MNNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYA 60
          M+   SPT+S +     VD S LTPQELKLYKLYGKLP KKDLFKHKL ERKYFDSGDYA
Sbjct: 1  MSKSPSPTNSTLADTGDVDLSALTPQELKLYKLYGKLPGKKDLFKHKLHERKYFDSGDYA 60

Query: 61 LSKAGVKSDDLQSDSIGSSHLPVTNPSGL 89
          LSKAGVKS+DL S ++GSSHLPVTNPSGL
Sbjct: 61 LSKAGVKSEDLGSAAVGSSHLPVTNPSGL 89

>KLLA0F27907g complement(2581760..2582212) some similarities with
           sgd|S0007496 Saccharomyces cerevisiae YHR132wa Pi,
           hypothetical start
          Length = 150

 Score =  127 bits (318), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 66/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)

Query: 9   SSNIDLKNPV------DTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYALS 62
           S ++D K PV      D SKL+PQELK+YK+YGKLPSKKDLF+HKLQERKYFDSGDYAL 
Sbjct: 22  SESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALR 81

Query: 63  KAGVKSDDLQSDSIGSSHLPVTNPSGLXXXXXXXXXXXXXXXXXXXXXQQLNRQ 116
           +AGVKSDDLQS  + +++LP+TNPSGL                     Q+LNRQ
Sbjct: 82  RAGVKSDDLQSSPVANNNLPLTNPSGLRESIIKRRMSSSANGPSNVDAQRLNRQ 135

>YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the
          cAMP-regulated phosphoprotein or endosulfine conserved
          region containing family, has high similarity to
          uncharacterized S. cerevisiae Ynl157p [396 bp, 131 aa]
          Length = 131

 Score =  121 bits (303), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 79/97 (81%), Gaps = 9/97 (9%)

Query: 1  MNNDISPTSSNIDLKNP-------VDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKY 53
          M+ D+SPTSS +DL NP       VD SKL+PQELKLYK+YGKLPSKKDL +HK+Q+R+Y
Sbjct: 1  MSEDLSPTSSRVDLSNPHGFTKEGVDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQY 60

Query: 54 FDSGDYALSKAGV-KSDDLQSDSIGSSHLPVTNPSGL 89
          FDSGDYAL KAGV KSDD+  ++  S++LPVTNPSGL
Sbjct: 61 FDSGDYALKKAGVIKSDDVIVNN-SSNNLPVTNPSGL 96

>Scas_697.15
          Length = 142

 Score =  119 bits (298), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 64/96 (66%), Positives = 75/96 (78%), Gaps = 12/96 (12%)

Query: 5   ISPTSSNIDLKN----------PVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYF 54
           +SPT+S +DLKN           VD SKLTPQELKL+K+YGKLPSK+DL KHK+QERKYF
Sbjct: 6   LSPTTSRVDLKNLAHTKDKDGNMVDLSKLTPQELKLFKMYGKLPSKRDLLKHKMQERKYF 65

Query: 55  DSGDYALSKAGV-KSDDLQSDSIGSSHLPVTNPSGL 89
           DSGDYAL KAGV K DD+ S S  S+++PVTNPSGL
Sbjct: 66  DSGDYALRKAGVIKKDDVMS-SNSSNNMPVTNPSGL 100

>CAGL0G06094g 583297..583713 highly similar to tr|Q9P305
           Saccharomyces cerevisiae YHR132wa, start by similarity
          Length = 138

 Score =  114 bits (285), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 7/92 (7%)

Query: 5   ISPTSSNIDL------KNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGD 58
           ISPT+S ++L      KN VD S+L+ QELKLYK+YGKLPSKKD+FKH++  RKYFDSGD
Sbjct: 13  ISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSGD 72

Query: 59  YALSKAGV-KSDDLQSDSIGSSHLPVTNPSGL 89
           YAL KAGV +SDD+  ++  S++LPVTNPSGL
Sbjct: 73  YALKKAGVIRSDDVIDENNSSNNLPVTNPSGL 104

>YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with
          similarity to Yhr132w-ap and with weak similarity to
          human ENSA alpha-endosulfine and human ARPP-19
          cAMP-regulated phosphoprotein [507 bp, 168 aa]
          Length = 168

 Score =  105 bits (263), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 71/95 (74%), Gaps = 9/95 (9%)

Query: 2  NNDISPTSSNIDL-------KNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYF 54
          N ++SP SSN DL          +DTSK +P E+KLYK+YGKLPSKKD+FKH +Q+RKYF
Sbjct: 3  NENLSPNSSNPDLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYF 62

Query: 55 DSGDYALSKAGVKSDDLQSDSIGSSHLPVTNPSGL 89
          DSGDYAL KAG++++D    + G ++LP+TNPS L
Sbjct: 63 DSGDYALQKAGIQNND--PINYGKNNLPLTNPSKL 95

>AFR341C [3533] [Homologous to ScYDR495C (VPS3) - SH]
           (1055397..1058183) [2787 bp, 928 aa]
          Length = 928

 Score = 28.5 bits (62), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 4   DISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYALSK 63
           DISPT   I +K+  D  +L  ++L+L  LY   P+ +   +    ER++ +S D  L  
Sbjct: 344 DISPTPYEI-VKS--DQRELVIEKLRLMPLYAAKPAFRIEHERMFVERQFKESSDIVLFY 400

Query: 64  AG 65
           +G
Sbjct: 401 SG 402

>YBL019W (APN2) [176] chr2 (184318..185880) DNA repair protein that
           functions as a 3' to 5' exodeoxyribonuclease, 3'
           phosphodiesterase, AP endonuclease, DNA apurinic- or
           apyrimidinic-site lyase [1563 bp, 520 aa]
          Length = 520

 Score = 27.3 bits (59), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 14/72 (19%)

Query: 18  VDTSKL--TPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYALS----KAGVKSDDL 71
           +DT++L  T   LK+Y ++  L +        L+   Y    D+ L     +  +K+ D+
Sbjct: 294 IDTTRLIQTRNRLKMYTVWNMLKN--------LRPSNYGSRIDFILVSLKLERCIKAADI 345

Query: 72  QSDSIGSSHLPV 83
             D +GS H PV
Sbjct: 346 LPDILGSDHCPV 357

>ABR112C [704] [Homologous to ScYCR093W (CDC39) - SH] (594241..600666)
            [6426 bp, 2141 aa]
          Length = 2141

 Score = 26.9 bits (58), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 5    ISPTSSNIDLKNP----VDTSKLTPQELKLYKLYGKL 37
            ++P +SN  L  P    + T+ +TPQ+ ++Y+ + KL
Sbjct: 1290 LAPNASNYALSLPEPLGLKTTGITPQQFRIYEEFAKL 1326

>CAGL0F05885g 588828..590966 similar to sp|Q05080 Saccharomyces
           cerevisiae YMR032w HOF1 involved in cytokinesis, start
           by similarity
          Length = 712

 Score = 26.6 bits (57), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 43  LFKHKLQERKYFDSGDYALSKAGVKSDDLQSDSIGSSHLPVTNPSGL 89
           L   + QE   F+ GDY L    V  D  + +  G+S+   T+ +GL
Sbjct: 653 LINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTTTHGNGL 699

>CAGL0A02145g join(219334..219344,220588..221752) similar to
           sp|P32793 Saccharomyces cerevisiae YHR016c YSC84 or
           gi|15530184|sgd|S0002968 Saccharomyces cerevisiae
           YFR024ca
          Length = 391

 Score = 26.6 bits (57), Expect = 8.3,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 18/96 (18%)

Query: 1   MNNDISPTSSNIDLKNPVDTSKLTPQELKLYKL--YGKLPSKKD---------------L 43
           +N ++ P  S   L   +++   TPQ  + Y+   Y +  ++ D               L
Sbjct: 196 LNGEVEPLPSMDRLYRILESPNFTPQPGEGYRTSSYSEEQARPDERYGRERYDRRYDEAL 255

Query: 44  FKHKLQERKYFDSGDYALSKAGV-KSDDLQSDSIGS 78
           +  K + R  +DSGD   S+ GV + D LQ +   S
Sbjct: 256 YDEKPRSRARWDSGDMPHSRGGVERQDHLQRNDYDS 291

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.128    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,540,021
Number of extensions: 142707
Number of successful extensions: 398
Number of sequences better than 10.0: 24
Number of HSP's gapped: 394
Number of HSP's successfully gapped: 24
Length of query: 130
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 40
Effective length of database: 13,480,489
Effective search space: 539219560
Effective search space used: 539219560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 55 (25.8 bits)