Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1881.325422912031e-169
AFR043W2712347294e-97
Kwal_33.146072612357269e-97
KLLA0F27885g2562316851e-90
YNL156C2992636195e-80
CAGL0J05918g3231665225e-65
YHR133C2912364212e-50
Scas_697.14*2942463107e-34
Scas_654.19*2022121613e-13
CAGL0H05577g223870720.45
KLLA0B02585g26574680.82
CAGL0A01221g293143680.91
CAGL0M03003g55849662.1
Scas_604.1151158634.0
Scas_654.1827231608.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1881.3
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1881.3 YNL156C, Contig c1881 3706-4470                           468   e-169
AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH] co...   285   4e-97
Kwal_33.14607                                                         284   9e-97
KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces...   268   1e-90
YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protei...   243   5e-80
CAGL0J05918g complement(558615..559586) similar to sp|P53898 Sac...   205   5e-65
YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein...   166   2e-50
Scas_697.14*                                                          124   7e-34
Scas_654.19*                                                           67   3e-13
CAGL0H05577g complement(545740..552456) similar to sp|P48415 Sac...    32   0.45 
KLLA0B02585g 226764..227561 similar to sgd|S0004406 Saccharomyce...    31   0.82 
CAGL0A01221g 125780..126661 similar to sp|P53386 Saccharomyces c...    31   0.91 
CAGL0M03003g complement(337942..339618) similar to sp|Q03263 Sac...    30   2.1  
Scas_604.11                                                            29   4.0  
Scas_654.18                                                            28   8.5  

>Sklu_1881.3 YNL156C, Contig c1881 3706-4470
          Length = 254

 Score =  468 bits (1203), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 229/229 (100%), Positives = 229/229 (100%)

Query: 1   MARKKSKAGNELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTPAGVM 60
           MARKKSKAGNELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTPAGVM
Sbjct: 1   MARKKSKAGNELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTPAGVM 60

Query: 61  ERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKLSF 120
           ERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKLSF
Sbjct: 61  ERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKLSF 120

Query: 121 GMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIRKIEWSS 180
           GMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIRKIEWSS
Sbjct: 121 GMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIRKIEWSS 180

Query: 181 SLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229
           SLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ
Sbjct: 181 SLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229

>AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH]
           complement(511018..511833) [816 bp, 271 aa]
          Length = 271

 Score =  285 bits (729), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 181/234 (77%), Gaps = 7/234 (2%)

Query: 3   RKKSKAGNEL--SNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTP---- 56
           R   K G+ +  + S +S++ LTKPQLFG+YDEEIV+SED EIYEEAKKSAG++      
Sbjct: 13  RAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGS 72

Query: 57  AGVMER-RSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLS 115
            G   R R+  QK +HL+ S ++LG++GIAYH+LSRNLHDN  LH +  S+PL+LGV+L 
Sbjct: 73  VGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLC 132

Query: 116 QKLSFGMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIRK 175
           Q+LSFGM+PTWA Y++EGILFGSLLP VD+ R       + S V+R+INAMLGV FGIR+
Sbjct: 133 QQLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSINAMLGVSFGIRR 192

Query: 176 IEWSSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229
           +EWSSSLQASGAWFLL+ ILW+FFDG+ S+ L+G A+G  T +TCY+++T++SQ
Sbjct: 193 VEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEEITDFSQ 246

>Kwal_33.14607
          Length = 261

 Score =  284 bits (726), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 176/235 (74%), Gaps = 7/235 (2%)

Query: 1   MARKKSKAGN-ELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTPAGV 59
           MARKKSK  N   S SNESI+ LT+PQL+G+YD +I  SED E YE+AKKS GK  P  V
Sbjct: 1   MARKKSKMANGNYSTSNESISNLTRPQLYGIYDADITHSEDAEAYEQAKKSVGKF-PDEV 59

Query: 60  MER-----RSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQL 114
           + +     RS FQK  HLLFS  VLGVAGI+Y+ELS+ LHDNH LH E AS+PL LGV++
Sbjct: 60  LNKSKHRHRSWFQKGTHLLFSLCVLGVAGISYNELSKQLHDNHELHAEFASRPLALGVEI 119

Query: 115 SQKLSFGMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIR 174
            + LSFG+VP W AY+LEG+LFG+ LPL+D L G    +T+ +S +R+ +AMLGV FGIR
Sbjct: 120 CRTLSFGVVPGWMAYALEGVLFGAFLPLLDTLWGGPMKTTTFTSFLRSTHAMLGVAFGIR 179

Query: 175 KIEWSSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229
           KI+WSSSLQASGAWFLLNI+LW+FFDGT S LL    IG    +T Y+DVTE+SQ
Sbjct: 180 KIQWSSSLQASGAWFLLNIVLWLFFDGTPSTLLGCLGIGTIASVTSYRDVTEFSQ 234

>KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces
           cerevisiae YNL156c, start by similarity
          Length = 256

 Score =  268 bits (685), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 129/231 (55%), Positives = 168/231 (72%), Gaps = 2/231 (0%)

Query: 1   MARKKSKAGNELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKK-SAGKLTPAGV 59
           M    S +      S+ES   LTKP L+GLYD +++KSED+EIYEE KK S+GK    G+
Sbjct: 1   MTESASNSTGSKYGSSESSNLLTKPALYGLYDADVLKSEDSEIYEEVKKASSGKELENGI 60

Query: 60  MERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKLS 119
           ++R       V++  +W+VL +AGIAYHELS+NLHDNH LH +  S+PLLLG  ++Q LS
Sbjct: 61  VQRAKKIPSSVNVALAWVVLSIAGIAYHELSKNLHDNHELHNDFTSRPLLLGATIAQSLS 120

Query: 120 FGMVPTWAAYSLEGILFGSLLPLVDHLRGK-KTASTSSSSVMRAINAMLGVEFGIRKIEW 178
           FG +P W  Y++EGILFGS++P V+ + G      T+ SSV+R+ NAMLGV FGIR+IEW
Sbjct: 121 FGYLPPWTFYAIEGILFGSIVPFVNWILGTFDRQPTTISSVLRSTNAMLGVSFGIRRIEW 180

Query: 179 SSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229
           SSSLQASGAWFLLNIILW+FFD + +ML  G AIG  TC+TCYQD+T+ +Q
Sbjct: 181 SSSLQASGAWFLLNIILWLFFDSSFTMLASGLAIGLVTCVTCYQDITDSAQ 231

>YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protein
           of unknown function, has moderate similarity to
           uncharacterized S. cerevisiae Yhr133p [900 bp, 299 aa]
          Length = 299

 Score =  243 bits (619), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 169/263 (64%), Gaps = 48/263 (18%)

Query: 15  SNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKS------------------------ 50
           S ESI +LTKPQL+ LYD+++V+SEDNEIYEE K+S                        
Sbjct: 12  STESICSLTKPQLYSLYDDDVVRSEDNEIYEELKRSVSIDSTKYSRDQTIDSTFYLAHKV 71

Query: 51  AGKLTPAGV----MER---------------RSIFQKVVHLLFSWLVLGVAGIAYHELSR 91
            G L    V    +ER               R   Q ++H L + L+L ++G AYHELSR
Sbjct: 72  GGSLPRNTVSSNNLERILSASSIHENFPSRTRQTRQNILHYLQAVLILSLSGFAYHELSR 131

Query: 92  NLHDNHALHPELASKPLLLGVQLSQKLSFGMVPTWAAYSLEGILFGSLLPLVDHLRGKKT 151
           NLHDNH LHP+ AS+PLLLGV+L   LS G++P W  Y +EG+LFGS++P++D++   + 
Sbjct: 132 NLHDNHLLHPDFASRPLLLGVKLCNWLSNGVLPNWLGYGVEGLLFGSVVPILDNIFQTEV 191

Query: 152 ASTSS-----SSVMRAINAMLGVEFGIRKIEWSSSLQASGAWFLLNIILWMFFDGTLSML 206
             +S      +SV+R+INAMLGV FGIRKI+W+SSLQA+GAW LLNIILW+FFDG++SML
Sbjct: 192 VKSSVHHDSLTSVIRSINAMLGVTFGIRKIQWNSSLQAAGAWGLLNIILWLFFDGSISML 251

Query: 207 LIGAAIGAGTCITCYQDVTEYSQ 229
           +    IG G CI+CY+D+ + SQ
Sbjct: 252 MSCICIGVGCCISCYKDIIDGSQ 274

>CAGL0J05918g complement(558615..559586) similar to sp|P53898
           Saccharomyces cerevisiae YNL156c or sp|P38837
           Saccharomyces cerevisiae YHR133c, hypothetical start
          Length = 323

 Score =  205 bits (522), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 94/166 (56%), Positives = 128/166 (77%), Gaps = 2/166 (1%)

Query: 66  FQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKLSFGMVPT 125
           FQ+  + +F+ +VL ++G+AYH+LSRNLHDNH LH + AS+PLL GV + QKLS G++P 
Sbjct: 133 FQRFTNFVFAIVVLSISGVAYHQLSRNLHDNHLLHEDFASRPLLWGVTIQQKLSCGILPD 192

Query: 126 WAAYSLEGILFGSLLPLVDHLRGKKTASTSS--SSVMRAINAMLGVEFGIRKIEWSSSLQ 183
           W  Y+LEGI+FGS++PL+DH+   K   TS   SSV+R+INAMLGV FGIRKI+W+SS Q
Sbjct: 193 WFGYALEGIIFGSIIPLMDHITKVKLRPTSYSLSSVIRSINAMLGVTFGIRKIQWASSGQ 252

Query: 184 ASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229
           A+GAW LLN+ILW+FFDGTLSM    + +G   C +C+ ++T+ SQ
Sbjct: 253 AAGAWGLLNVILWLFFDGTLSMFSNCSVLGLLCCASCFHEITDVSQ 298

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (73%)

Query: 1  MARKKSKAGNELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEE 46
          M + + K   +   S+ESI++LT PQL+ +YD++IVKSED EIYEE
Sbjct: 1  MVKGRKKKAVKTVESSESISSLTTPQLYSIYDQDIVKSEDAEIYEE 46

>YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein
           that contains four potential transmembrane segments [876
           bp, 291 aa]
          Length = 291

 Score =  166 bits (421), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 96/236 (40%), Positives = 142/236 (60%), Gaps = 17/236 (7%)

Query: 9   GNEL-SNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEA---KKSAGKLTPAGVMER-- 62
           GN+L S S  +I TLTKP LF  YD++I K+E N +Y++A     S  ++ P     R  
Sbjct: 32  GNKLGSASFTAINTLTKPALFSFYDDDITKNEGN-VYDKALLSNASQLEMVPPSATARHE 90

Query: 63  RSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKL--SF 120
           RS++ K+++ + ++ +L +AGI +  +S  L DN  L        L  G+++  K+    
Sbjct: 91  RSLYAKIINTIAAFFILFIAGILFPMISECLFDNDQLAKGDIVSFLKHGIEIKNKIVAEP 150

Query: 121 GMVPTWAAYSLEGILFGSLLPLVD-HLRGKKTASTSSS-------SVMRAINAMLGVEFG 172
            MVP WA +  EG++FGS++P +D  +R +    T SS       S +R  N +LG+ FG
Sbjct: 151 DMVPDWAVFGTEGVIFGSIVPFIDSFVRYQHQPKTRSSVYKNTLGSFIRCANTLLGLIFG 210

Query: 173 IRKIEWSSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYS 228
           IRK+EWSSSLQA+GAW LLNI+LW+FFDGTL++   G  IGA +  TC Q  ++ S
Sbjct: 211 IRKLEWSSSLQAAGAWSLLNIVLWLFFDGTLTVFFPGLVIGALSAFTCSQCFSQLS 266

>Scas_697.14*
          Length = 294

 Score =  124 bits (310), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 131/246 (53%), Gaps = 32/246 (13%)

Query: 15  SNESITTLTKPQLFGLYDEEIVKSEDN---EIYEEA-----KKSAGKLTPAG-------- 58
           S +SI+TLTKP L+ LY  +++KS ++   ++Y++A     +K    + P+         
Sbjct: 26  STDSISTLTKPALYSLYSNDVLKSNEDKTSQLYKQANNRWRRKGGDFMDPSSEDLDELDE 85

Query: 59  --------VMERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLL 110
                   V      + +++HL +S+ +L   GI + EL+ NL DN  L+  + +  L  
Sbjct: 86  DHTDVDMDVEFNGKWYVRLIHLTYSFFILFTCGIVFGELAENLFDNDKLYKGMTAVILED 145

Query: 111 GVQLSQKL-SFGMVPTWAAYSLEGILFGSLLPLVDHL-RGKK-----TASTSSSSVMRAI 163
           GV+L  K+     V  +  + +EGIL   +L + D+L R  K     +   S  S++R  
Sbjct: 146 GVKLIDKVVPKSSVTNYIGFGIEGILLSLVLRVSDYLIRPNKDKIGQSKKNSFRSIVRIS 205

Query: 164 NAMLGVEFGIRKIEWSSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQD 223
           NA+LG+  G+R++ W+SSLQ S  W L+N+I+W+FFDGTLS+L  G       C+T Y  
Sbjct: 206 NAILGISLGVRRLPWTSSLQGSMLWLLVNVIVWLFFDGTLSILTSGVIQALLICLT-YSR 264

Query: 224 VTEYSQ 229
             E SQ
Sbjct: 265 GIETSQ 270

>Scas_654.19*
          Length = 202

 Score = 66.6 bits (161), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 95/212 (44%), Gaps = 43/212 (20%)

Query: 3   RKKSKAGNELS-----NSNESITTLTKPQLFGLYDEEIVKSE---DNEIYEEAKKSAGKL 54
           R+ S   ++L      +   +   LT+P LF +YD++I++S    D+ I    +K   + 
Sbjct: 4   RRSSSTSSDLEAYVYFDQFRAFQVLTRPTLFSIYDDDIIRSSGDVDSRI-GGIRKRVLRG 62

Query: 55  TPAGVMERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQL 114
                  RR   Q     LF+ +VL + GIAY+EL+  L+ +  ++      PL      
Sbjct: 63  KRRWKYRRR---QGTARKLFNLIVLSLFGIAYNELAFYLYQSTIIN---KMSPL------ 110

Query: 115 SQKLSFGMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGI- 173
            + + F  +P W  YSLEG+  G L+PL+D L  KKT +         I   +G EF   
Sbjct: 111 -RFMMFYGLPRWMNYSLEGVSLGFLVPLLDVLLFKKTVTVEYPETETEIG--IGTEFDYG 167

Query: 174 ------------------RKIEWSSSLQASGA 187
                             RK+EW S++Q++ A
Sbjct: 168 WGFMLAIINIIMGIIYGIRKLEWDSAMQSAEA 199

>CAGL0H05577g complement(545740..552456) similar to sp|P48415
            Saccharomyces cerevisiae YPL085w SEC16, start by
            similarity
          Length = 2238

 Score = 32.3 bits (72), Expect = 0.45,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 126  WAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIRKIEWSSSLQAS 185
            WAA +  GI+   L+ + DH + K+TAS  +     A+     +EFGI   +   +L AS
Sbjct: 1276 WAAENWRGIVAAVLINITDHSQPKQTASIQTPP---AVVTEFLIEFGIFLKKLGMNLPAS 1332

Query: 186  GAWFLLNIIL 195
              + + N+ L
Sbjct: 1333 ILFVIANVPL 1342

>KLLA0B02585g 226764..227561 similar to sgd|S0004406 Saccharomyces
           cerevisiae YLR414c, hypothetical start
          Length = 265

 Score = 30.8 bits (68), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 12  LSNSNESITTLTKPQLFGLYD-EEIVKS--EDNEIYEEAKKSAGKLTPAGVMERRSIFQK 68
           L+NS + IT+ TKP     +D E+++K   E+N++ E   +      P  + ++ S +  
Sbjct: 83  LANSEKQITSCTKPAGIEQFDLEKLLKDNVENNQVTELIDQVISLALPDELDDKMSYYNA 142

Query: 69  VVHLLFSWLVLGVA 82
           ++  +   LV+G+A
Sbjct: 143 LIKCMSITLVIGIA 156

>CAGL0A01221g 125780..126661 similar to sp|P53386 Saccharomyces
           cerevisiae YPR192w AQY1, hypothetical start
          Length = 293

 Score = 30.8 bits (68), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 53/143 (37%), Gaps = 17/143 (11%)

Query: 33  EEIVKSEDNEIYEEAKKSAGKLTPAGVMERRSIFQKVVHLL--------FSWLVLGVAGI 84
           E + K  D+++ E    SA  L     +   S+   V+  +        F W    +A I
Sbjct: 14  EHVDKMGDSDVPESVSNSANMLRSRFNIGPDSVRNHVIAFMGELCGTFMFLWCAYVIANI 73

Query: 85  AYHELSRNLHDNHALHPELASKPLLLGVQLSQKLSFGMVPTWAAYSLEGILFGSLLPLVD 144
           A H++S      H  HP         G  +   L FG    ++ +   G+  G+L P V 
Sbjct: 74  ANHDVSLKDSPPHGSHP---------GQLIMIALGFGFSVMFSIWCFVGVSGGALNPAVS 124

Query: 145 HLRGKKTASTSSSSVMRAINAML 167
                  A T +  V+  I  +L
Sbjct: 125 LSLALARAITPTRCVVMWIAQIL 147

>CAGL0M03003g complement(337942..339618) similar to sp|Q03263
           Saccharomyces cerevisiae YMR279c or sp|P13090
           Saccharomyces cerevisiae YML116w ATR1, hypothetical
           start
          Length = 558

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 20/49 (40%)

Query: 46  EAKKSAGKLTPAGVMERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLH 94
           E K +   L P  V+E + I   +  L F W   G+    Y+    NL 
Sbjct: 332 EIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLR 380

>Scas_604.11
          Length = 511

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 11  ELSNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTPAGVMERRSIFQK 68
           E+ NS+ S   L K  L   Y EE+ +  +NE+YE  +  + KL   G+ +  S+F++
Sbjct: 362 EVDNSSHSDFNLLKDLLIKNYLEELRERTNNELYENYR--SNKLIKLGIKQDNSVFKE 417

>Scas_654.18
          Length = 272

 Score = 27.7 bits (60), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 12  LSNSNESITTLTKPQLFGLYDEEIVKSEDNE 42
           + N N S    TK +L+ LY EEIVK++ NE
Sbjct: 208 VKNINNSFKATTKEKLY-LYKEEIVKAKTNE 237

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,100,167
Number of extensions: 276068
Number of successful extensions: 898
Number of sequences better than 10.0: 26
Number of HSP's gapped: 884
Number of HSP's successfully gapped: 28
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)