Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1881.125925913940.0
Kwal_33.146032572557094e-94
KLLA0D10978g2702656532e-85
AFR041C2572566522e-85
Scas_654.182722705784e-74
CAGL0J05962g2932855682e-72
YNL155W2742675272e-66
AGR296W9823830.003
YOR052C15023860.003
Kwal_55.2166811423800.010
KLLA0F16214g11823800.010
CAGL0L10186g17323770.051
Scas_698.4412335730.089
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1881.1
         (259 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1881.1 YNL155W, Contig c1881 336-1115 reverse complement         541   0.0  
Kwal_33.14603                                                         277   4e-94
KLLA0D10978g 936863..937675 similar to sp|P53899 Saccharomyces c...   256   2e-85
AFR041C [3233] [Homologous to ScYNL155W - SH] (508245..509018) [...   255   2e-85
Scas_654.18                                                           227   4e-74
CAGL0J05962g complement(562367..563248) similar to sp|P53899 Sac...   223   2e-72
YNL155W (YNL155W) [4442] chr14 (342516..343340) Protein predicte...   207   2e-66
AGR296W [4607] [Homologous to ScYOR052C - SH] complement(1289161...    37   0.003
YOR052C (YOR052C) [4862] chr15 complement(426773..427225) Protei...    38   0.003
Kwal_55.21668                                                          35   0.010
KLLA0F16214g complement(1503855..1504211) some similarities with...    35   0.010
CAGL0L10186g complement(1094808..1095329) some similarities with...    34   0.051
Scas_698.44                                                            33   0.089

>Sklu_1881.1 YNL155W, Contig c1881 336-1115 reverse complement
          Length = 259

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/259 (100%), Positives = 259/259 (100%)

Query: 1   MTSTKRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQ 60
           MTSTKRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQ
Sbjct: 1   MTSTKRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQ 60

Query: 61  NACNLGRNGNGEYFQALLPEKSNIRLKQNNESHSNSTSIKDHLVKNKNKSALEKLKKFFS 120
           NACNLGRNGNGEYFQALLPEKSNIRLKQNNESHSNSTSIKDHLVKNKNKSALEKLKKFFS
Sbjct: 61  NACNLGRNGNGEYFQALLPEKSNIRLKQNNESHSNSTSIKDHLVKNKNKSALEKLKKFFS 120

Query: 121 KNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADENDKPTKH 180
           KNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADENDKPTKH
Sbjct: 121 KNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADENDKPTKH 180

Query: 181 EIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPASPLLLDPSCRVANT 240
           EIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPASPLLLDPSCRVANT
Sbjct: 181 EIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPASPLLLDPSCRVANT 240

Query: 241 LHDGDTLYLVRGEDGFPTV 259
           LHDGDTLYLVRGEDGFPTV
Sbjct: 241 LHDGDTLYLVRGEDGFPTV 259

>Kwal_33.14603
          Length = 257

 Score =  277 bits (709), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 135/255 (52%), Positives = 181/255 (70%), Gaps = 10/255 (3%)

Query: 7   ETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQNACNLG 66
           ETGML+VGTHC +CRQ+DFLPFHC +C GDFC +HR +E+H C  +L++     N    G
Sbjct: 2   ETGMLDVGTHCTFCRQLDFLPFHCKFCEGDFCGSHRSQEAHRCPKILKESSAAGNTTKSG 61

Query: 67  ---RNGNGEYFQALLPEKSNIRLKQNNESHS----NSTSIKDHLVKNKNKSALEKLKKFF 119
              RN NGEYF  LLPEK++IR+KQ  E+ S    N++S++  L  + N+SALEKLK FF
Sbjct: 62  EPVRNSNGEYFSTLLPEKAHIRVKQAVEAPSVAKGNNSSVRSRLEASGNRSALEKLKSFF 121

Query: 120 SKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADENDKPTK 179
            +  ++ SK    TK  P+N+ I ++K+K+TAKGD KIPV NR+YV+ + V +  D+  K
Sbjct: 122 GR--RSGSKAGSLTKARPANRIIEVAKLKKTAKGDPKIPVVNRVYVFCFSV-EAQDENVK 178

Query: 180 HEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPASPLLLDPSCRVAN 239
           HE+FINKVWP+GR LDY+A QL V+NVN+   +S KE+LFLY +   +P  LD + R+AN
Sbjct: 179 HELFINKVWPVGRALDYIASQLAVRNVNNHVQSSDKERLFLYCDKNGTPSNLDTASRIAN 238

Query: 240 TLHDGDTLYLVRGED 254
            + DGDTLYLVRGED
Sbjct: 239 IIKDGDTLYLVRGED 253

>KLLA0D10978g 936863..937675 similar to sp|P53899 Saccharomyces
           cerevisiae YNL155w singleton, start by similarity
          Length = 270

 Score =  256 bits (653), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 172/265 (64%), Gaps = 18/265 (6%)

Query: 6   RETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQNA--- 62
           +E GML+VGTHC +CRQ DFLPFHC+ CNGDFC+ HRLKE HHC  L   + ++ +    
Sbjct: 3   KEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVTVS 62

Query: 63  --------CNLGRNGNGEYFQALLPEKSNIRLK---QNNESHSNSTSIKDHLVKNKNKS- 110
                       ++  G +FQ+LLP ++  R+K   Q + S     ++K  L  +K  S 
Sbjct: 63  IPAAAAAAVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTSSS 122

Query: 111 --ALEKLKKFFSKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVY 168
             A++KL+ FF+KN K F   K +TK S +NK I ++KMKRTAKGD  IPV+NRIY W Y
Sbjct: 123 RVAIDKLRHFFAKNGKLFESKKSTTKFSSANKLIQVTKMKRTAKGDDSIPVANRIYAWCY 182

Query: 169 LVADENDK-PTKHEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPAS 227
           +VAD +DK P  +E+FINK+WP+GR LD +A  L+VKN N  H  ST EKLFLYK D ++
Sbjct: 183 VVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDAST 242

Query: 228 PLLLDPSCRVANTLHDGDTLYLVRG 252
             LL  S RV  T+ +GDTLYLVRG
Sbjct: 243 QHLLPSSARVNATIQEGDTLYLVRG 267

>AFR041C [3233] [Homologous to ScYNL155W - SH] (508245..509018) [774
           bp, 257 aa]
          Length = 257

 Score =  255 bits (652), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 130/256 (50%), Positives = 172/256 (67%), Gaps = 12/256 (4%)

Query: 5   KRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQ-EKTKQNAC 63
           +RETGML+VG HC YCRQIDFLPFHCT CN DFCS HR +E+HHC  LL     T  +  
Sbjct: 3   ERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAATPASRS 62

Query: 64  NLGRNGNGE---YFQALLPEKSNIRLKQ-NNESHSNSTSIKDHLVKNKNKSALEKLKKFF 119
                  GE   YF+ALLP+K+ +R+KQ  +E  +  TSIKD LV+  + +AL+KLK+FF
Sbjct: 63  RSSSQAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSIKDRLVQRNSTNALDKLKRFF 122

Query: 120 SKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADENDKPTK 179
           +K    +S  + +   S SNK I ++K+KRTAKGD KIP  NR+Y+W Y + + N  P +
Sbjct: 123 AK----YSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESN--PKE 176

Query: 180 HEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPASPL-LLDPSCRVA 238
           H+IFIN+ WP+GRVLDY++  +DVKNVN    A + EKL+LYK    +   +LDPS RV 
Sbjct: 177 HDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKENEWKMLDPSGRVN 236

Query: 239 NTLHDGDTLYLVRGED 254
             + +GD LYL+RG D
Sbjct: 237 GNIEEGDALYLIRGND 252

>Scas_654.18
          Length = 272

 Score =  227 bits (578), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 175/270 (64%), Gaps = 29/270 (10%)

Query: 6   RETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQNACN- 64
           RETGML+VGTHC +CR++DFLPFHC+ C+ DFCS HRL+ESH+C  L ++++ K ++ + 
Sbjct: 8   RETGMLDVGTHCAFCRELDFLPFHCSGCDKDFCSNHRLRESHYCESLQQRQEEKPSSTSH 67

Query: 65  --LGRNGNGEYFQALLPEKSNIRLKQNNESH--------SNSTSIKDHLVKNKNKSALEK 114
             +  NG G++F++LLPEK  IR+     +         +   +I+  L    N SAL K
Sbjct: 68  VKVADNG-GKFFKSLLPEKGYIRVNNVPNNSNNNTVPRKTEGRTIRSTL----NNSALTK 122

Query: 115 LKKFFSKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADEN 174
           LK FF KN    +K +   K    NK + L+ +K+ AKGDSKIP+SNRIY+W Y V + N
Sbjct: 123 LKHFFQKNHNKQNKLQ-RMKIFKPNKIVELNNLKKLAKGDSKIPLSNRIYIWCYCVENGN 181

Query: 175 DKPTKHEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKE----------D 224
           D   K  +FINK+WP+GRVLDY+A+QL+VKN+N+   A+TKEKL+LYKE          D
Sbjct: 182 D--NKSAVFINKIWPLGRVLDYLAKQLNVKNINNSFKATTKEKLYLYKEEIVKAKTNESD 239

Query: 225 PASPLLLDPSCRVANTLHDGDTLYLVRGED 254
             +  +++ S R +  L D D +YLVRGE+
Sbjct: 240 EVNFHMVNLSGRASEELKDLDVIYLVRGEE 269

>CAGL0J05962g complement(562367..563248) similar to sp|P53899
           Saccharomyces cerevisiae YNL155w, hypothetical start
          Length = 293

 Score =  223 bits (568), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/285 (45%), Positives = 174/285 (61%), Gaps = 38/285 (13%)

Query: 1   MTSTKRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQ 60
           M + ++ETGML+VGTHC YCRQ+DFLPFHC  C+GDFCS HR KESHHC WLL+  +  +
Sbjct: 14  MNNKEKETGMLDVGTHCQYCRQLDFLPFHCKLCDGDFCSEHRSKESHHCKWLLDHPEELE 73

Query: 61  N-----ACNLGRNGNGEYFQALLPEKSNIRLKQNNESH--------------------SN 95
           N       +  ++  G++FQ+LLPEK++IR+K  + S                     S 
Sbjct: 74  NNGARSPPSSSKSNGGKFFQSLLPEKAHIRVKSPSPSSTTSQSPVKLGSSGVTTKNKPSE 133

Query: 96  STSIKDHLVKNKNKSALEKLKKFFSKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDS 155
           +T I+  L    N +AL KL  FF K  K+  K K    TS SN+ + LS +K+TAKGDS
Sbjct: 134 TTKIRSTL----NPAALNKLLNFF-KRTKSDPKTKKKVSTS-SNRLVELSTLKKTAKGDS 187

Query: 156 KIPVSNRIYVWVYLVADENDKP-----TKHEIFINKVWPMGRVLDYVAQQLDVKNVNSKH 210
           KIPV NRIY++  ++  E++       TK  ++INK+WP+GR LDY++QQL V NVN   
Sbjct: 188 KIPVQNRIYIYCQVILGEDETSDTLGLTKVPLYINKIWPVGRALDYLSQQLHVTNVNGNV 247

Query: 211 DASTKEKLFLYKEDPA--SPLLLDPSCRVANTLHDGDTLYLVRGE 253
           D +  EKLFLYK D      + ++ S RV   + D DTLYLVRG+
Sbjct: 248 DTTKGEKLFLYKYDEKLNEYVGIETSGRVNVLVKDLDTLYLVRGQ 292

>YNL155W (YNL155W) [4442] chr14 (342516..343340) Protein predicted
           to have structural similarity to disulfide
           oxidoreductases [825 bp, 274 aa]
          Length = 274

 Score =  207 bits (527), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 117/267 (43%), Positives = 167/267 (62%), Gaps = 22/267 (8%)

Query: 2   TSTKRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQN 61
            + ++ETGML+VG HC YCRQ+DFLPFHC++CN DFCS HRLKE HHC WLLE E+  + 
Sbjct: 3   AAIEKETGMLDVGKHCAYCRQLDFLPFHCSFCNEDFCSNHRLKEDHHCRWLLEHEEVHKT 62

Query: 62  ACNLGRNGNGE------YFQALLPEKSNIRLKQNNESH-----SNSTSIKDHLVKNKNKS 110
             +  ++ +G       YF++LLPE++++R+++ +E+      SN+  +   L    N  
Sbjct: 63  EKSPSKSRDGSSSNDEAYFKSLLPERASVRIQRVSETREPLRGSNTAKVSSTL----NSK 118

Query: 111 ALEKLKKFFSKNEKAFSKGKFSTK-TSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYL 169
            L+K+ KFF +NEK  S  K      S SNK I L+ +K+ AKGD KIP+ NRIY+W YL
Sbjct: 119 TLDKIFKFFQRNEKRKSNNKSKKNFGSSSNKIIQLANLKKIAKGDPKIPMQNRIYIWCYL 178

Query: 170 V-ADEND---KPTKHEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDAST-KEKLFLYKED 224
           V  DE D   + T+  ++INK+WP+GR +DY++ QL+VK+    + +S  K +L   KE 
Sbjct: 179 VDGDETDIAKEDTRMPLYINKMWPVGRAMDYLSIQLNVKSSTLTNSSSNDKFQLCKLKEG 238

Query: 225 PASPLL-LDPSCRVANTLHDGDTLYLV 250
                  +  S RV N + D DTLYLV
Sbjct: 239 KQVSFYNIGASLRVTNEIKDLDTLYLV 265

>AGR296W [4607] [Homologous to ScYOR052C - SH]
          complement(1289161..1289457) [297 bp, 98 aa]
          Length = 98

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 30 CTYCNGDFCSTHRLKESHHCNWL 52
          C +C+G FCS HRL E+H C  L
Sbjct: 49 CQFCDGQFCSRHRLMENHTCRGL 71

>YOR052C (YOR052C) [4862] chr15 complement(426773..427225) Protein
           containing an AN1-like zinc finger domain [453 bp, 150
           aa]
          Length = 150

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 16/23 (69%)

Query: 30  CTYCNGDFCSTHRLKESHHCNWL 52
           C +C G FCS HRL E+H CN L
Sbjct: 101 CNFCKGHFCSKHRLMENHACNGL 123

>Kwal_55.21668
          Length = 114

 Score = 35.4 bits (80), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 15/23 (65%)

Query: 30 CTYCNGDFCSTHRLKESHHCNWL 52
          C +C G FCS HRL E+H C  L
Sbjct: 65 CQFCQGHFCSRHRLMENHSCQGL 87

>KLLA0F16214g complement(1503855..1504211) some similarities with
          sgd|S0005578 Saccharomyces cerevisiae YOR052c,
          hypothetical start
          Length = 118

 Score = 35.4 bits (80), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 30 CTYCNGDFCSTHRLKESHHCNWL 52
          C +C+G FCS HRL E+H C  L
Sbjct: 69 CNFCDGHFCSKHRLLENHQCQGL 91

>CAGL0L10186g complement(1094808..1095329) some similarities with
           tr|Q08422 Saccharomyces cerevisiae YOR052c, hypothetical
           start
          Length = 173

 Score = 34.3 bits (77), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 30  CTYCNGDFCSTHRLKESHHCNWL 52
           C +C G +CS HRL E+H C  L
Sbjct: 124 CNFCKGHYCSRHRLMENHACEGL 146

>Scas_698.44
          Length = 123

 Score = 32.7 bits (73), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 30  CTYCNGDFCSTHRLKESHHCNWLL--EQEKTKQNA 62
           C +C   +CS HRL E+H C  L+  ++E  K+NA
Sbjct: 74  CRFCQRQYCSKHRLMENHACEGLVSCKEEMHKRNA 108

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,507,209
Number of extensions: 442870
Number of successful extensions: 2050
Number of sequences better than 10.0: 82
Number of HSP's gapped: 2011
Number of HSP's successfully gapped: 82
Length of query: 259
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 160
Effective length of database: 13,168,927
Effective search space: 2107028320
Effective search space used: 2107028320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)