Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1838.358957730620.0
Kwal_56.2348658757726430.0
YER165W (PAB1)57757923720.0
AGR122C58557723660.0
CAGL0L11792g57957823000.0
Scas_576.757557622840.0
KLLA0C17600g59259321950.0
YFR023W (PES4)6113933888e-40
Kwal_0.3705602933594e-36
Sklu_1706.16722963615e-36
AEL016C6782953368e-33
YHR015W (MIP6)6592843341e-32
Scas_607.106052943118e-30
CAGL0I08943g6022993064e-29
KLLA0A08338g7663943066e-29
Scas_697.106104262656e-24
CAGL0H10604g4161952271e-19
Scas_671.44431682281e-19
YNL016W (PUB1)4532002271e-19
AGR390C3783202232e-19
CAGL0E03245g4251802191e-18
KLLA0C11495g4452092128e-18
Kwal_27.114474391672111e-17
KLLA0E08745g4751862092e-17
AFR107W3962002047e-17
ADR307W5663172041e-16
YGR159C (NSR1)4141731994e-16
Scas_637.23773201974e-16
Scas_621.104151781976e-16
YCL011C (GBP2)4271941923e-15
Sklu_1879.44211731904e-15
Kwal_55.219605971731872e-14
Sklu_2307.26971921836e-14
Kwal_55.201545223221826e-14
Scas_635.75811751828e-14
Sklu_2085.22091191721e-13
Kwal_23.39858764411821e-13
AAL018W3371871761e-13
Scas_558.14352211781e-13
ADL160W5261691754e-13
KLLA0C12925g5701821746e-13
YPR112C (MRD1)8871731756e-13
CAGL0M03795g5132341721e-12
AGL250W7291961731e-12
CAGL0B04169g8611711731e-12
AEL217W8342181721e-12
Scas_645.147172211702e-12
Scas_665.42191361595e-12
CAGL0E01947g4521791657e-12
CAGL0B04807g4193021647e-12
YNL004W (HRB1)4292981648e-12
KLLA0D11792g6852021641e-11
YOL123W (HRP1)5341691631e-11
ADR035C8384131632e-11
ABL059W2041671532e-11
Kwal_0.2502162151542e-11
KLLA0C14388g2031661523e-11
Kwal_56.247098282521604e-11
KLLA0D14949g8784401604e-11
Sklu_2442.114643021585e-11
YOR319W (HSH49)2131751507e-11
CAGL0H02123g5553381542e-10
CAGL0H03861g4432051513e-10
Kwal_27.123372091261435e-10
KLLA0A05346g8743081515e-10
KLLA0F18216g7083161481e-09
Scas_157.12321721402e-09
Kwal_27.118326861951443e-09
YHR086W (NAM8)5233571416e-09
CAGL0L12672g6822051416e-09
Scas_598.15162151407e-09
CAGL0I09900g2111671348e-09
KLLA0E11011g4322751399e-09
YPL043W (NOP4)6852051401e-08
Scas_376.14042161362e-08
YGR250C7812221363e-08
CAGL0J11154g3802171344e-08
KLLA0B00979g3421811334e-08
AAR151W481771335e-08
Sklu_905.15151981336e-08
Scas_705.228691731311e-07
CAGL0K06655g802811311e-07
YBR212W (NGR1)672771301e-07
Kwal_14.1851535771301e-07
CAGL0F08217g6784011292e-07
KLLA0F14861g5891731282e-07
ADR017W173721212e-07
KLLA0D05016g2622611234e-07
KLLA0C05522g540981265e-07
AER285C4262271246e-07
KLLA0C08019g301551219e-07
Sklu_2257.4188741171e-06
Sklu_2182.33711831211e-06
ABL134C3751901211e-06
Kwal_27.103644432541211e-06
YIR005W (IST3)148841141e-06
Sklu_1790.3473841202e-06
ADR183C320851182e-06
CAGL0H04763g3831651183e-06
Scas_717.413791681174e-06
Sklu_2353.5252611144e-06
Sklu_1715.1396911165e-06
Scas_530.46843331167e-06
Kwal_55.20972135771087e-06
YNL175C (NOP13)4032211141e-05
Kwal_55.20414284891121e-05
KLLA0F07799g524841141e-05
Kwal_26.7179456771131e-05
Scas_701.3321741121e-05
Scas_709.2*171721062e-05
ADL063W320991102e-05
KLLA0D13420g1661651062e-05
Kwal_47.185723631581103e-05
CAGL0J01914g169741053e-05
Scas_88.1256641074e-05
Kwal_23.5864278741074e-05
Kwal_33.14463393851085e-05
YOL041C (NOP12)459501085e-05
CAGL0D06182g280911075e-05
AGL038C7123331095e-05
KLLA0B10472g1981251046e-05
YIR001C (SGN1)250971048e-05
YDR432W (NPL3)4141271068e-05
KLLA0F09383g258751049e-05
AFL050W218831031e-04
Sklu_1984.32841171031e-04
CAGL0L03806g255921022e-04
Sklu_2375.5207831012e-04
Scas_621.163141201032e-04
KLLA0D13772g345941032e-04
AGR010C266781003e-04
AFR649W310761013e-04
CAGL0M12573g299751003e-04
Sklu_2213.4257641003e-04
YMR268C (PRP24)4442171014e-04
Kwal_26.752226264994e-04
KLLA0D08206g3911491005e-04
Kwal_27.111585671781005e-04
Kwal_33.1349633072995e-04
Scas_582.10283105986e-04
Scas_666.11224127976e-04
KLLA0E19118g652181997e-04
YGL044C (RNA15)29671978e-04
KLLA0E00484g242209968e-04
YNL110C (NOP15)22079968e-04
ADR001C324100970.001
Scas_643.16448104970.001
CAGL0F01023g39650970.001
ACR274W42650960.001
YIL061C (SNP1)30074950.002
CAGL0J02200g14474910.002
Scas_565.8322143950.002
Kwal_27.11096201129930.002
CAGL0C01529g236107930.002
Scas_714.5923360930.002
ADL126C466110940.002
YPL178W (CBC2)208107900.004
Scas_570.1411379850.005
Scas_316.148376910.006
Scas_720.224575890.006
YFR032C28981890.008
AFL224W206100870.008
CAGL0E03630g74672890.012
Kwal_26.845821999860.014
YDR429C (TIF35)27460870.015
Scas_241.118694850.015
Sklu_1192.1280100860.018
Sklu_2249.430989860.020
Kwal_23.520429488850.024
Kwal_55.2090314775790.056
AER349C21865810.058
Kwal_30.1289028048810.077
Kwal_55.2103911984760.081
YBL051C (PIN4)66872820.083
CAGL0A04213g63972820.089
Sklu_2060.311099750.11
KLLA0B11594g11484750.12
Kwal_26.682473964800.12
Kwal_55.2071859448800.14
Sklu_2221.828158780.16
AAR022W11484740.16
Scas_589.4530122790.16
ACL149W628102790.18
Kwal_55.22147468120780.20
Scas_537.5570103780.22
AFR149C22067760.27
Scas_683.3227271760.27
CAGL0G05401g67163770.30
CAGL0H04675g27461750.35
AFL061C523138760.35
CAGL0H03267g77575770.36
YDL167C (NRP1)71950760.46
KLLA0B14432g17379730.48
YLL046C (RNP1)24983740.53
KLLA0A03531g73255750.56
Sklu_2407.322171730.57
Sklu_2434.1473654740.77
ACL133W37123730.78
CAGL0H02211g381226730.84
Sklu_2391.176192730.95
Kwal_56.2463852776731.0
YHL024W (RIM4)71379731.1
Sklu_2063.4600101711.5
Scas_663.1575354711.6
ADR189W26959701.7
ADR399C73653711.7
CAGL0K09966g71953702.3
CAGL0G05511g67463692.7
KLLA0B00847g26959682.8
KLLA0B08976g30581682.9
KLLA0A09097g80565693.2
Kwal_14.226555541683.7
Sklu_2414.9608104683.8
AFL070C75773683.9
Sklu_2412.499683684.2
CAGL0J07546g789108675.4
KLLA0F23650g31281665.6
KLLA0D12364g63125666.7
CAGL0I05082g60474666.8
CAGL0C01419g63996667.1
CAGL0J05852g34356649.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1838.3
         (589 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement       1184   0.0  
Kwal_56.23486                                                        1022   0.0  
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...   918   0.0  
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...   915   0.0  
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...   890   0.0  
Scas_576.7                                                            884   0.0  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...   850   0.0  
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...   154   8e-40
Kwal_0.370                                                            142   4e-36
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                           143   5e-36
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...   134   8e-33
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...   133   1e-32
Scas_607.10                                                           124   8e-30
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...   122   4e-29
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...   122   6e-29
Scas_697.10                                                           106   6e-24
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    92   1e-19
Scas_671.4                                                             92   1e-19
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    92   1e-19
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    91   2e-19
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    89   1e-18
KLLA0C11495g complement(990832..992169) some similarities with s...    86   8e-18
Kwal_27.11447                                                          86   1e-17
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    85   2e-17
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    83   7e-17
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    83   1e-16
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    81   4e-16
Scas_637.2                                                             80   4e-16
Scas_621.10                                                            80   6e-16
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    79   3e-15
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         78   4e-15
Kwal_55.21960                                                          77   2e-14
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         75   6e-14
Kwal_55.20154                                                          75   6e-14
Scas_635.7                                                             75   8e-14
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            71   1e-13
Kwal_23.3985                                                           75   1e-13
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    72   1e-13
Scas_558.1                                                             73   1e-13
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    72   4e-13
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    72   6e-13
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...    72   6e-13
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    71   1e-12
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    71   1e-12
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    71   1e-12
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    71   1e-12
Scas_645.14                                                            70   2e-12
Scas_665.4                                                             66   5e-12
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    68   7e-12
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    68   7e-12
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    68   8e-12
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    68   1e-11
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    67   1e-11
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    67   2e-11
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    64   2e-11
Kwal_0.250                                                             64   2e-11
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    63   3e-11
Kwal_56.24709                                                          66   4e-11
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    66   4e-11
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      65   5e-11
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    62   7e-11
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    64   2e-10
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    63   3e-10
Kwal_27.12337                                                          60   5e-10
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    63   5e-10
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    62   1e-09
Scas_157.1                                                             59   2e-09
Kwal_27.11832                                                          60   3e-09
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    59   6e-09
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    59   6e-09
Scas_598.1                                                             59   7e-09
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    56   8e-09
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    58   9e-09
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    59   1e-08
Scas_376.1                                                             57   2e-08
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    57   3e-08
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    56   4e-08
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    56   4e-08
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    56   5e-08
Sklu_905.1 YMR268C, Contig c905 196-1743                               56   6e-08
Scas_705.22                                                            55   1e-07
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    55   1e-07
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    55   1e-07
Kwal_14.1851                                                           55   1e-07
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    54   2e-07
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    54   2e-07
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    51   2e-07
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    52   4e-07
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    53   5e-07
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    52   6e-07
KLLA0C08019g complement(704199..705104) some similarities with s...    51   9e-07
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         50   1e-06
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            51   1e-06
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    51   1e-06
Kwal_27.10364                                                          51   1e-06
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    49   1e-06
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            51   2e-06
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    50   2e-06
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    50   3e-06
Scas_717.41                                                            50   4e-06
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          49   4e-06
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          49   5e-06
Scas_530.4                                                             49   7e-06
Kwal_55.20972                                                          46   7e-06
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    49   1e-05
Kwal_55.20414                                                          48   1e-05
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    49   1e-05
Kwal_26.7179                                                           48   1e-05
Scas_701.3                                                             48   1e-05
Scas_709.2*                                                            45   2e-05
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    47   2e-05
KLLA0D13420g complement(1157491..1157991) some similarities with...    45   2e-05
Kwal_47.18572                                                          47   3e-05
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    45   3e-05
Scas_88.1                                                              46   4e-05
Kwal_23.5864                                                           46   4e-05
Kwal_33.14463                                                          46   5e-05
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    46   5e-05
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    46   5e-05
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    47   5e-05
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    45   6e-05
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    45   8e-05
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    45   8e-05
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    45   9e-05
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    44   1e-04
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         44   1e-04
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    44   2e-04
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       44   2e-04
Scas_621.16                                                            44   2e-04
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    44   2e-04
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    43   3e-04
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    44   3e-04
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    43   3e-04
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         43   3e-04
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    44   4e-04
Kwal_26.7522                                                           43   4e-04
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    43   5e-04
Kwal_27.11158                                                          43   5e-04
Kwal_33.13496                                                          43   5e-04
Scas_582.10                                                            42   6e-04
Scas_666.11                                                            42   6e-04
KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925 S...    43   7e-04
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    42   8e-04
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    42   8e-04
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    42   8e-04
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    42   0.001
Scas_643.16                                                            42   0.001
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    42   0.001
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    42   0.001
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    41   0.002
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    40   0.002
Scas_565.8                                                             41   0.002
Kwal_27.11096                                                          40   0.002
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    40   0.002
Scas_714.59                                                            40   0.002
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    41   0.002
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    39   0.004
Scas_570.14                                                            37   0.005
Scas_316.1                                                             40   0.006
Scas_720.2                                                             39   0.006
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    39   0.008
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    38   0.008
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    39   0.012
Kwal_26.8458                                                           38   0.014
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    38   0.015
Scas_241.1                                                             37   0.015
Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement          38   0.018
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         38   0.020
Kwal_23.5204                                                           37   0.024
Kwal_55.20903                                                          35   0.056
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    36   0.058
Kwal_30.12890                                                          36   0.077
Kwal_55.21039                                                          34   0.081
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    36   0.083
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    36   0.089
Sklu_2060.3 YIR009W, Contig c2060 4599-4931                            33   0.11 
KLLA0B11594g complement(1018044..1018388) some similarities with...    33   0.12 
Kwal_26.6824                                                           35   0.12 
Kwal_55.20718                                                          35   0.14 
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       35   0.16 
AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH] complement(3...    33   0.16 
Scas_589.4                                                             35   0.16 
ACL149W [900] [Homologous to ScYDL167C (NRP1) - SH] complement(8...    35   0.18 
Kwal_55.22147                                                          35   0.20 
Scas_537.5                                                             35   0.22 
AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH] (705111..70...    34   0.27 
Scas_683.32                                                            34   0.27 
CAGL0G05401g complement(508557..510572) similar to sp|P34761 Sac...    34   0.30 
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    33   0.35 
AFL061C [3132] [Homologous to ScYPL184C - SH] (317447..319018) [...    34   0.35 
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    34   0.36 
YDL167C (NRP1) [704] chr4 complement(160996..163155) Asparagine-...    34   0.46 
KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036 Saccha...    33   0.48 
YLL046C (RNP1) [3376] chr12 complement(46713..47462) Ribonucleop...    33   0.53 
KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces c...    33   0.56 
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         33   0.57 
Sklu_2434.14 YOR361C, Contig c2434 32150-34360                         33   0.77 
ACL133W [916] [Homologous to NOHBY] complement(119503..120618) [...    33   0.78 
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    33   0.84 
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          33   0.95 
Kwal_56.24638                                                          33   1.0  
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    33   1.1  
Sklu_2063.4 YDL167C, Contig c2063 1979-3781                            32   1.5  
Scas_663.15                                                            32   1.6  
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    32   1.7  
ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH] (1420640..1...    32   1.7  
CAGL0K09966g complement(974102..976261) highly similar to sp|P06...    32   2.3  
CAGL0G05511g complement(522026..524050) similar to sp|P34761 Sac...    31   2.7  
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    31   2.8  
KLLA0B08976g complement(786122..787039) weakly similar to sp|P32...    31   2.9  
KLLA0A09097g 794827..797244 some similarities with sp|P25339 Sac...    31   3.2  
Kwal_14.2265                                                           31   3.7  
Sklu_2414.9 YKL204W, Contig c2414 20547-22373                          31   3.8  
AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH] (303268..30...    31   3.9  
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           31   4.2  
CAGL0J07546g complement(731562..733931) similar to sp|P13134 Sac...    30   5.4  
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    30   5.6  
KLLA0D12364g complement(1051765..1053660) some similarities with...    30   6.7  
CAGL0I05082g complement(473462..475276) some similarities with s...    30   6.8  
CAGL0C01419g complement(153063..154982) similar to sp|Q08925 Sac...    30   7.1  
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    29   9.0  

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score = 1184 bits (3062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/577 (98%), Positives = 569/577 (98%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60
           MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF
Sbjct: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180
           SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS
Sbjct: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
           AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL
Sbjct: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300

Query: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360
           ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA
Sbjct: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360

Query: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420
           GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR
Sbjct: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420

Query: 421 YQQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480
           YQQVT        GMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF
Sbjct: 421 YQQVTAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480

Query: 481 GRPNGPMYGVPPQGAPQGGFPRNGGNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKITG 540
           GRPNGPMYGVPPQGAPQGGFPRNGGNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKITG
Sbjct: 481 GRPNGPMYGVPPQGAPQGGFPRNGGNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKITG 540

Query: 541 MILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKD 577
           MILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKD
Sbjct: 541 MILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKD 577

>Kwal_56.23486
          Length = 587

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/577 (87%), Positives = 536/577 (92%), Gaps = 4/577 (0%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60
           MSDVTDKTAEQLEQL+I D+Q T PTST+SE+ K + SSASLYVGELDP+VTEALLYDLF
Sbjct: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAITKTSLGYAYVNFHDH+AG TAI+KLNYT IKGRPCRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180
           SLRKKGSGN+FIKNLHPAIDNKALHDTFSVFGNILSCKIATDE G S+ FGFVHFEEE +
Sbjct: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEA 180

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
           AKEA+DAINGMLLNG EVYVAPHVSKKDRQSKL+E KSNFTN+YVKNID ET Q+EFE L
Sbjct: 181 AKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           F+Q+G ITSAVLE D+EGK RGFGF+NFEDH +AAKAV+ELNDTDF  Q+LYVGRAQKKY
Sbjct: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300

Query: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360
           ERLQEL+KQYE SR+EKLAKYQGVNLFVKNLDDSIDDEKL++EFAPFG ITS KVMRDDA
Sbjct: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360

Query: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420
           G+SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQARNQMR
Sbjct: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420

Query: 421 YQQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480
           YQQ T        GMPGQFM PMFYGVMPPRGVPFNGPNPQQMAAM GMPKNGV PPQQF
Sbjct: 421 YQQAT-AAAAAAAGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGV-PPQQF 478

Query: 481 GRPNGPMYGVPPQGAPQGGFPRNGGNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKITG 540
           GRPNGPMYGVPPQG PQG FPRN GNQF+HQKQRQALGEQLYK+VSAKTQDEEAAGKITG
Sbjct: 479 GRPNGPMYGVPPQG-PQGAFPRN-GNQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITG 536

Query: 541 MILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKD 577
           MILDLPPQEVVPLLEND+LF+QHFKEAFAAY+SFKKD
Sbjct: 537 MILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFKKD 573

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score =  918 bits (2372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/579 (77%), Positives = 505/579 (87%), Gaps = 12/579 (2%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60
           M+D+TDKTAEQLE L I DDQ+ A T +ES++  V+ SSASLYVG+L+P+V+EA LYD+F
Sbjct: 1   MADITDKTAEQLENLNIQDDQKQAATGSESQS--VENSSASLYVGDLEPSVSEAHLYDIF 58

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAITKTSLGYAYVNF+DH+AGR AI++LNYT IKGR CRIMWSQRDP
Sbjct: 59  SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDP 118

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180
           SLRKKGSGNIFIKNLHP IDNKAL+DTFSVFG+ILS KIATDE G SKGFGFVHFEEE +
Sbjct: 119 SLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGA 178

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
           AKEA+DA+NGMLLNGQE+YVAPH+S+K+R S+LEE K+++TN+YVKNI+ ETT E+F+ L
Sbjct: 179 AKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEL 238

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           F +FG I SA LE+D++GK +GFGF+N+E HE A KAV+ LND++   ++LYVGRAQKK 
Sbjct: 239 FAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298

Query: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360
           ER+  L+KQYE  RLEK+AKYQGVNLFVKNLDDS+DDEKL +EFAP+G ITSAKVMR + 
Sbjct: 299 ERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN 358

Query: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR
Sbjct: 359 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 418

Query: 421 YQQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480
           YQQ T        GMPGQFMPPMFYGVMPPRGVPFNGPNPQQM  MGGMPKNG +PPQ  
Sbjct: 419 YQQATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNG-MPPQ-- 475

Query: 481 GRPNGPMYGVPPQGAPQGGFPRNG--GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKI 538
              NGP+YGVP    PQGGFPRN    NQFY QKQRQALGEQLYKKVSAKT +EEAAGKI
Sbjct: 476 -FRNGPVYGVP----PQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKI 530

Query: 539 TGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKD 577
           TGMILDLPPQEV PLLE+D+LFEQH+KEA AAYESFKK+
Sbjct: 531 TGMILDLPPQEVFPLLESDELFEQHYKEASAAYESFKKE 569

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/577 (79%), Positives = 511/577 (88%), Gaps = 13/577 (2%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60
           MSD+TDKTAEQLEQLKI  ++QTAPT+TESE  KV+TS ASLYVGEL+PTV+EALLYD+F
Sbjct: 1   MSDITDKTAEQLEQLKI--EEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIF 58

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAIT TSLGYAYVNFHDH+AG  AI++LNYT IKG+PCRIMWSQRDP
Sbjct: 59  SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDP 118

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180
           SLRKKGSGNI+IKNLHPAIDNK+LH+TFS FGNILSCK+ATDE G S+GFGFVHFE E  
Sbjct: 119 SLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESD 178

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
           A++A++A++GML+N QEVYVA HVSKKDRQSKLEE K+ FTN+YVKNID ET+QEEFE L
Sbjct: 179 ARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           F ++GKITSAVLE+DSEGK RGFGF+NFEDH +AAKAVDELN+ +FK Q+LYVGRAQKKY
Sbjct: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY 298

Query: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360
           ERLQEL+KQYE +RLEKLAKYQGVNLFVKNLDDSIDDEKL++EFAPFG ITSAKVMRD+ 
Sbjct: 299 ERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDET 358

Query: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420
           GNS+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQARNQMR
Sbjct: 359 GNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMR 418

Query: 421 YQQVTXXXXXXXXGMPGQFM-PPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQ 479
           +Q           G+PGQFM PPM+YG +PPR VPF GPNPQ    M GMPKNG +PPQQ
Sbjct: 419 FQHANAAAAAAVAGLPGQFMPPPMYYGGIPPR-VPFQGPNPQ----MAGMPKNGAMPPQQ 473

Query: 480 FGRPNGPMYGVPPQGAPQGGFPRNG-GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKI 538
           FGRP GPMYG     APQG FPRNG   QFY QKQRQALGEQLY+KV AKTQD+EAAGKI
Sbjct: 474 FGRP-GPMYG---GFAPQGQFPRNGQQQQFYQQKQRQALGEQLYQKVFAKTQDDEAAGKI 529

Query: 539 TGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFK 575
           TGMILDLPPQ+V+ LLEND+L EQHF+EA AAY+ FK
Sbjct: 530 TGMILDLPPQQVIQLLENDELLEQHFQEAHAAYQKFK 566

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/578 (74%), Positives = 492/578 (85%), Gaps = 16/578 (2%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60
           M+D+T+KTAEQLE L + D Q+      +SE     T SASLYVG+LDP+V+EA LYD+F
Sbjct: 1   MADITEKTAEQLENLSLQDKQEGTNEENQSE-----TVSASLYVGDLDPSVSEAHLYDIF 55

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
           SPIG+VSSIRVCRDAITKTSLGYAYVNF+DHDA +TAI+KLN+T IKG+ CRIMWSQRDP
Sbjct: 56  SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP 115

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180
           SLRKKG+GNIFIKNLHP IDNKAL+DTFSVFGNILS K+ATDE G SKGFG+VHFEE+ S
Sbjct: 116 SLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDES 175

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
           A EA+DA+NGMLLNGQE+YV PH+SKK+R+SK EE K+NFTN+Y+KNI+ ETT +EFE L
Sbjct: 176 ASEAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEEL 235

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
             +FGK  S VLER  EG+ +GFGF+NF +HE A K V+ELN+T+FK Q LYV RAQKKY
Sbjct: 236 VAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295

Query: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360
           ER QEL+KQYE +R+EK+AKYQG+NLF+KNLDDSIDD+KL +EFAP+G ITSAKVM  + 
Sbjct: 296 ERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN 355

Query: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR
Sbjct: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 415

Query: 421 YQQ-VTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQ 479
           +QQ           GMPGQFMPPMFYGVMPPRGVPFNGPNP QMA MG MPKNG +PP Q
Sbjct: 416 FQQASAAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNP-QMANMGAMPKNG-MPPHQ 473

Query: 480 FGRPNGPMYGVPPQGAPQGGFPRNG--GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGK 537
           F   NGP+YGVP    PQGGF RNG   NQFY QKQRQALGE+LYK++ ++T DEEAAGK
Sbjct: 474 FR--NGPVYGVP----PQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGK 527

Query: 538 ITGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFK 575
           ITGMILDLPPQEVVPLLEND+LFEQHFKEA AAYESFK
Sbjct: 528 ITGMILDLPPQEVVPLLENDELFEQHFKEASAAYESFK 565

>Scas_576.7
          Length = 575

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/576 (76%), Positives = 493/576 (85%), Gaps = 21/576 (3%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60
           MSD+T+KT EQLE LKI++ +    T+T +E     TS ASLYVGELDPTV+EALLYD+F
Sbjct: 1   MSDITEKTVEQLENLKISESEDQPSTTTSTE-----TSPASLYVGELDPTVSEALLYDIF 55

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDA+TKTSLGYAYVNF+DH+AG+ AI++LNYT IKGR CRIMWSQRDP
Sbjct: 56  SPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRDP 115

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180
           +LRKKGSGNIFIKNLHP IDNKAL +TFSVFGNILS KIATDE G SKGFGFVHFE E S
Sbjct: 116 ALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESS 175

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
           AKEA+DA+NGMLLNGQE+YVAPH+++K+R S+LEE K++FTN+YVKNI+LETT EEF  L
Sbjct: 176 AKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNEL 235

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           F ++G + S+ LE+  +GK +GFGF++FE HE AAKAV+ELN T+FK Q L+V RAQKKY
Sbjct: 236 FAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY 295

Query: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360
           ER+QEL+KQYE SRLEK+AKYQGVNLFVKNLDDSIDDEKL++EFAP+G ITS +VMR D 
Sbjct: 296 ERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDN 355

Query: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR QMR
Sbjct: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQMR 415

Query: 421 YQQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480
           YQQ T        G+PGQFMPPMFYGVMPPRGVPFNGPNPQQM        NGV PPQQF
Sbjct: 416 YQQATAAAAAAAAGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM--------NGV-PPQQF 466

Query: 481 GRPNGPMYGVPPQGAPQGGFPRNG-GNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKIT 539
              NGP YG+P    PQGGFPRNG  NQFY + QRQALGE+LYKKVSAK  DEEAAGKIT
Sbjct: 467 R--NGPGYGMP----PQGGFPRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKIT 520

Query: 540 GMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFK 575
           GMILDLPPQEVV LLEND+LFEQHFKEA AAYESFK
Sbjct: 521 GMILDLPPQEVVSLLENDELFEQHFKEASAAYESFK 556

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/593 (72%), Positives = 497/593 (83%), Gaps = 22/593 (3%)

Query: 1   MSDVTDKTAEQLEQLKINDDQQ----------TAPTSTESENAKVDTSSASLYVGELDPT 50
           MSD+T+KTAEQLE L+INDDQQ          +A  S  S  +KV+ ++ASLYVGELDP 
Sbjct: 1   MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLYVGELDPN 60

Query: 51  VTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRP 110
           +TEALLYD+FSP+G +SSIRVCRDA+TK SLGYAYVN+ D++AG+ AIQ+LNY  I GRP
Sbjct: 61  ITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQELNYAEINGRP 120

Query: 111 CRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGF 170
           CRIMWS+RDP++RKKGSGNIFIKNLHPAIDNKALH+TFS FG +LSCK+A DE GNS+GF
Sbjct: 121 CRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGF 180

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDL 230
           GFVHF+EE  AK+A++A+NGML+NG EVYVA HV KKDR SKLEEAK+NFTNIYVKNID+
Sbjct: 181 GFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDV 240

Query: 231 ETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQR 290
           ETT EEFE LF+Q+G+I SA LE+D+EGKP+GFGF+NF DH +AAKAV+ELN  +FKSQ 
Sbjct: 241 ETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQA 300

Query: 291 LYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAI 350
           LYVGRAQKKYER +EL+KQYE  RLEKLAK+QGVNLF+KNLDDSIDDEKL++EFAP+G I
Sbjct: 301 LYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTI 360

Query: 351 TSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLA 410
           TSA+VMRD  GNSKGFGFVCFS+PEEATKA+TEKNQQIVAGKPLYVAIAQRKDVRRSQLA
Sbjct: 361 TSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLA 420

Query: 411 QQIQARNQMRY-QQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMG-G 468
           QQIQARNQ+R+ QQ          GMPGQ+MP MFYGVM PRG P  GPNP     MG G
Sbjct: 421 QQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFP--GPNPGMNGPMGAG 478

Query: 469 MPKNGVI-PPQQF-GRPNGPMY-GVPPQGAPQGGFPRN-GGNQFYHQKQRQALGEQLYKK 524
           +PKNG++ PPQQF GRPNGPMY G+PPQ      FPR+   +    QKQRQALGEQLYKK
Sbjct: 479 IPKNGMVPPPQQFAGRPNGPMYQGMPPQNQ----FPRHQQQHYIQQQKQRQALGEQLYKK 534

Query: 525 VSAKTQDEEAAGKITGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKD 577
           VSAK  DE AAGKITGMILDLPPQ+V+ LL+ND+ FEQ F+EA AAYE+FKK+
Sbjct: 535 VSAKIDDENAAGKITGMILDLPPQQVIQLLDNDEQFEQQFQEALAAYENFKKE 587

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score =  154 bits (388), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 115/393 (29%), Positives = 194/393 (49%), Gaps = 67/393 (17%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L++G+L  TVTE  L  +F    S  S +VC D++TK SLG+ Y+NF D +    A+++L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 102 NYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGNILSCK 158
           NYT + G+  RIM S R+ + RK    N+F  NL   +P +  +  +DTFS +G ILSCK
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCK 212

Query: 159 IATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDR--------Q 210
           + +      K  GFV+FE+E +A+  +   N     G+++    H  K+ R        +
Sbjct: 213 LDS-----RKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQK 267

Query: 211 SKLE---------------------EAKSNFT----NIYVKNIDLETTQEEFEALFTQFG 245
           S+L+                     E+K+ ++    +I++KN+   TT+++    F++ G
Sbjct: 268 SRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVG 327

Query: 246 KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQE 305
            I S  L   ++ K   + F+ +++   + KA+   N+  F+ ++L V RAQ K ER + 
Sbjct: 328 PIKSIYLSNATKVK-YLWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKF 386

Query: 306 LRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLR-----DEFAPFGAITSAKVMRD-- 358
           +  Q       K++      LF++NL    + E L+     +   PF      K+  D  
Sbjct: 387 IESQ-------KIS-----TLFLENLSAVCNKEFLKYLCHQENIRPF------KIQIDGY 428

Query: 359 DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
           D  +S   GF+ F   E+AT+     N ++V G
Sbjct: 429 DENSSTYSGFIKFRNFEDATRIFNFLNNRLVGG 461

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 80/187 (42%), Gaps = 25/187 (13%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVDEL 281
           +++ ++    T+E  + +F ++    SA +  DS   K  G G++NFED E A KA++EL
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNL---DDSIDDE 338
           N T    + + +  +     R    RK +            G N+F  NL   +  +   
Sbjct: 153 NYTKVNGKEIRIMPSL----RNTTFRKNF------------GTNVFFSNLPLNNPLLTTR 196

Query: 339 KLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
              D F+ +G I S K+      + K  GFV F   + A   I   N     GK +   I
Sbjct: 197 VFYDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGI 251

Query: 399 AQRKDVR 405
              K+VR
Sbjct: 252 HFDKEVR 258

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 300 YERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD 359
           + R+   +  ++  +L+     + V LF+ +L +++ +E L+  F  + +  SAKV  D 
Sbjct: 67  FLRINNNKSGHKNGKLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDS 126

Query: 360 AG-NSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 413
               S G G++ F   EEA KA+ E N   V GK + +  + R    R      +
Sbjct: 127 VTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNV 181

>Kwal_0.370
          Length = 560

 Score =  142 bits (359), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 138/293 (47%), Gaps = 40/293 (13%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           +SL++G+LDP VTE +L D F    S+ S+++C D+ T  SLGY Y+NF+      TAI+
Sbjct: 15  SSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIE 74

Query: 100 KLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGNILS 156
             +Y  + GR  RIM S R+   RK    N+F  NL    PA+  +  ++TF  +G +LS
Sbjct: 75  TFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLS 134

Query: 157 CKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQS----- 211
           CK+        K  GFV+FE + +A++A+ + N     G  V    H  K  R+S     
Sbjct: 135 CKL-----DRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEK 189

Query: 212 ------KLEEAKSNF--------------------TNIYVKNIDLETTQEEFEALFTQFG 245
                  L  AK N                      +I+VKN+      E+    F++ G
Sbjct: 190 RRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIG 249

Query: 246 KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQK 298
            + S V     E     +GF+ ++      KA+D LN   F  +RL V +A K
Sbjct: 250 PVKS-VFTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALK 301

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 92/339 (27%), Positives = 152/339 (44%), Gaps = 43/339 (12%)

Query: 114 MWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGF 172
           M +  +P +  +   ++FI +L P +  K L+DTF VF +++S KI  D E G S G+G+
Sbjct: 1   MNNSYNPCVTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGY 60

Query: 173 VHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLE- 231
           ++F     A+ A++  + + L G+EV + P +    R S     K+  TN++  N+ LE 
Sbjct: 61  LNFYSSKDAETAIETFSYVNLFGREVRIMPSM----RNSYFR--KNIGTNVFFSNLPLEQ 114

Query: 232 --TTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQ 289
              T   F   F ++GK+ S  L+R      +  GF+ FE   +A KA+   N+ ++   
Sbjct: 115 PALTTRVFYETFREYGKVLSCKLDR-----RKNIGFVYFESDAAARKAIASYNNKEYYGN 169

Query: 290 RLYVG-RAQKKYERLQELRKQYEVSRL-------EKLAKYQGVNL--------------- 326
            +  G    K   R  E  K+   SRL       E L     V L               
Sbjct: 170 IVTCGLHFDKDIRRSPEFEKRR--SRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSI 227

Query: 327 FVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQ 386
            VKNL  +I +E L + F+  G + S    + +A  S  +GFV +    +  KA+   N 
Sbjct: 228 HVKNLPFNICNEDLLNYFSRIGPVKSVFTSKLEAYRS-SWGFVTYKKGCDTRKALDSLNG 286

Query: 387 QIVAGKPLYV--AIAQRKDVRRSQLAQQIQARNQMRYQQ 423
            I   + L V  A+    D R   +++  +A N   ++ 
Sbjct: 287 AIFMDRRLEVNKALKNNGDRRDGTVSKNRRAYNDQNFRS 325

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score =  143 bits (361), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 86/296 (29%), Positives = 148/296 (50%), Gaps = 40/296 (13%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
            +L++G+LD  VTE +L D F+   S+ S+++C DAI+K SLGY Y+NF + +    A +
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 100 KLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGNILS 156
           + NY  + G+  RIM S R+   RK    N+F  NL   + ++  +A +DTF  +G ILS
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILS 221

Query: 157 CKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQS-KLEE 215
           CK+        K  GF++F+++ SAK A+D  NG    G  +    H  ++ R+S + E+
Sbjct: 222 CKL-----DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEK 276

Query: 216 AKSNF------------------------------TNIYVKNIDLETTQEEFEALFTQFG 245
            KS                                  I+VKN+ +   +++    F++ G
Sbjct: 277 RKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIG 336

Query: 246 KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYE 301
            + S V           + F+ ++     ++A+++LN   FK +++ V RAQK ++
Sbjct: 337 PVKS-VFTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQ 391

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 141/297 (47%), Gaps = 37/297 (12%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAI 188
           +FI +L   +  K L DTF+ + +++S KI  D  +  S G+G+++F  +  A++A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 189 NGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLET---TQEEFEALFTQFG 245
           N + L G+EV + P +    R S     K+  TN++  N+ LE    T   F   F ++G
Sbjct: 164 NYVPLFGKEVRIMPSL----RNSFYR--KNIGTNVFFSNLPLENLSLTTRAFYDTFKKYG 217

Query: 246 KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVG----RAQKKYE 301
           KI S  L+R      +  GFI F+   SA  A+D+ N  ++    +  G    R  +K  
Sbjct: 218 KILSCKLDR-----RKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSP 272

Query: 302 RLQELRKQYEVSRL--EKLA-----KYQGVN----------LFVKNLDDSIDDEKLRDEF 344
             ++ + + +   +  EKL      + Q V           +FVKNL  + +++ + D F
Sbjct: 273 EFEKRKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFF 332

Query: 345 APFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
           +  G + S    +    NS  + FV +    + ++AI + N +I   + + VA AQ+
Sbjct: 333 SRIGPVKSVFTSKVPKYNS-SWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQK 388

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK-PRGFGFINFEDHESAAKAVDEL 281
           +++ ++D   T++     F ++  + S  +  D+  K   G+G+INF + E A KA +E 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNL---DDSIDDE 338
           N         YV    K+   +  LR  +         K  G N+F  NL   + S+   
Sbjct: 164 N---------YVPLFGKEVRIMPSLRNSF-------YRKNIGTNVFFSNLPLENLSLTTR 207

Query: 339 KLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
              D F  +G I S K+ R      K  GF+ F     A  AI + N +   G  +   I
Sbjct: 208 AFYDTFKKYGKILSCKLDR-----RKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGI 262

Query: 399 AQRKDVRRS 407
              ++VR+S
Sbjct: 263 HFDREVRKS 271

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEE 376
           L+  + V LF+ +LD+ + ++ LRD F  + ++ S K+  D  +  S G+G++ FS  E+
Sbjct: 96  LSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDED 155

Query: 377 ATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 413
           A KA  E N   + GK + +  + R    R  +   +
Sbjct: 156 AEKATEEFNYVPLFGKEVRIMPSLRNSFYRKNIGTNV 192

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score =  134 bits (336), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 137/295 (46%), Gaps = 39/295 (13%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
            +L++G+LD  VTE  L D F+   S  S ++C D+ TK SLGY Y+NF + +     I+
Sbjct: 116 VALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIE 175

Query: 100 KLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGNILS 156
           + NY  I GR  RIM S R+   RK    N+F  NL   + A+  +  +D F  FG ILS
Sbjct: 176 EFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILS 235

Query: 157 CKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQS-KLEE 215
           CK+        K  GFV+FE++ +AK+A+   NG    G  +    H  +  R+S + E+
Sbjct: 236 CKL-----DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEK 290

Query: 216 AKSNFTN-----------------------------IYVKNIDLETTQEEFEALFTQFGK 246
            K+   +                             +++KN+ L    +     F+Q G 
Sbjct: 291 RKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDLLLDYFSQIGP 350

Query: 247 ITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYE 301
           + S +   +       + FI F+    A  A+D LN +    + + + RAQK ++
Sbjct: 351 VKS-IFTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQKNFQ 404

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 137/310 (44%), Gaps = 36/310 (11%)

Query: 116 SQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVH 174
           S+  P+L  K    +FI +L   +  K L DTF+ F + +S KI  D     S G+G+++
Sbjct: 104 SKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLN 163

Query: 175 FEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLET-- 232
           F  E  A+  ++  N + + G+EV + P +     +  +       TN++  N+ LE   
Sbjct: 164 FSNEEDAERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIG------TNVFFSNLPLENLA 217

Query: 233 -TQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRL 291
            T   F   F +FGKI S  L+R      +  GF+ FE   +A +A+ E N  +F    +
Sbjct: 218 LTTRVFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKEFFGNNI 272

Query: 292 YVG-----------RAQKKYERLQELR---------KQYEVSRLEKLAKYQGVNLFVKNL 331
             G             +K+  RL+++             E+    K+       +F+KNL
Sbjct: 273 LCGIHFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNL 332

Query: 332 DDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
             + D + L D F+  G + S     + +  S  + F+ F    +A  AI   N   + G
Sbjct: 333 PLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLG 391

Query: 392 KPLYVAIAQR 401
           +P+ ++ AQ+
Sbjct: 392 RPIELSRAQK 401

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 87/198 (43%), Gaps = 25/198 (12%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPR-GFGFINFEDHESAAKAVDEL 281
           +++ ++D + T++     F +F    SA +  DS  K   G+G++NF + E A + ++E 
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNL---DDSIDDE 338
           N         Y+    ++   +  LR  +         K  G N+F  NL   + ++   
Sbjct: 178 N---------YIPIFGREVRIMPSLRNSF-------YRKNIGTNVFFSNLPLENLALTTR 221

Query: 339 KLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
              D F  FG I S K+ R      K  GFV F     A +AI E N +   G  +   I
Sbjct: 222 VFYDAFKKFGKILSCKLDR-----RKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGI 276

Query: 399 AQRKDVRRSQLAQQIQAR 416
              ++VR+S   ++ +AR
Sbjct: 277 HFDRNVRKSPEFEKRKAR 294

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 55  LLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIM 114
           LL D FS IG V SI      ++K S  +A++ F      + AI  LN++ + GRP  + 
Sbjct: 340 LLLDYFSQIGPVKSIFTSN--VSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELS 397

Query: 115 WSQR----DPSLRKKGSGN 129
            +Q+    D      G+GN
Sbjct: 398 RAQKNFQTDIDAANAGAGN 416

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 137/284 (48%), Gaps = 32/284 (11%)

Query: 37  TSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRT 96
           + + SL++G L  TVTE +L  +F    S  S +VCRD +TK SLGY Y+NF D +   +
Sbjct: 108 SKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAES 167

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGN 153
           A ++ NYT   G+  +IM S ++   RK    N+F  NL   +P +  ++ +     +GN
Sbjct: 168 ARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGN 227

Query: 154 ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQS-- 211
           +LSC +        K  GFV+F+ + SA+  +   N     G ++    H  K+ R    
Sbjct: 228 VLSCLLE-----RRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPE 282

Query: 212 ------------KLEE---AKSNFTN------IYVKNIDLETTQEEFEALFTQFGKITSA 250
                        +E+   A +N ++      I VKN+  +TTQEE    F+  G I S 
Sbjct: 283 FTKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSV 342

Query: 251 VLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVG 294
            +       P    F+ +++ E + KA   LN T FK+  ++VG
Sbjct: 343 FISEKQANTPHK-AFVTYKNEEESKKAQKCLNKTIFKNHTIWVG 385

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 71/184 (38%), Gaps = 19/184 (10%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDEL 281
           +++ N+    T+E    +F ++    SA + RD    K  G+G++NF+D   A  A  E 
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLR 341
           N T F  Q + +  + K        RK              G N+F  NL   +++ +L 
Sbjct: 173 NYTVFFGQEVKIMPSMKN----TLFRKNI------------GTNVFFSNL--PLENPQLT 214

Query: 342 DEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
                   I    V+       K  GFV F     A   I + N Q   G  +   +   
Sbjct: 215 TRSFYLIMIEYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFD 274

Query: 402 KDVR 405
           K+VR
Sbjct: 275 KEVR 278

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           LF+ NL  ++ +E LR  F  + +  SAKV RD     S G+G++ F    +A  A  E 
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 385 NQQIVAGKPLYVAIAQRKDVRRSQLAQQI 413
           N  +  G+ + +  + +  + R  +   +
Sbjct: 173 NYTVFFGQEVKIMPSMKNTLFRKNIGTNV 201

>Scas_607.10
          Length = 605

 Score =  124 bits (311), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 135/294 (45%), Gaps = 40/294 (13%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
            SL++  L   VTE +LYD+FS   S+ S+++C D+ +K SL Y Y+NF D    + A+ 
Sbjct: 92  TSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVD 151

Query: 100 KLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGNILS 156
             NYT + G   ++M S R+   RK    N+F  NL   +  +  +A +DTF  +G ILS
Sbjct: 152 DFNYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTRAFYDTFKGYGEILS 211

Query: 157 CKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQ-SKLEE 215
           CK+        K  GFV+F+ +  A+  ++  N  +  G ++    H  K+ R     ++
Sbjct: 212 CKL-----DKRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIICGLHFDKEIRNFPNFDK 266

Query: 216 AKSNFTN------------------------------IYVKNIDLETTQEEFEALFTQFG 245
            K+N  N                              I+VKN+  +   EE    F++ G
Sbjct: 267 RKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSKLG 326

Query: 246 KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299
            + S V   +       + FI ++      +A +  N+T F+ + + V RA+ K
Sbjct: 327 PVKS-VFSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQGKTITVSRAKLK 379

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 134/312 (42%), Gaps = 39/312 (12%)

Query: 118 RDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFE 176
           R+   RK+   ++FI  L   +    L+D FS + +++S KI  D ++  S  +G+++F 
Sbjct: 82  RNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFS 141

Query: 177 EEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLET---T 233
           +E  AK+AVD  N  +L G E+ + P +     +  +       TN++  N+ LE    T
Sbjct: 142 DELEAKKAVDDFNYTILFGNEIKMMPSLRNTIYRKNIG------TNVFFANLPLENKHLT 195

Query: 234 QEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
              F   F  +G+I S  L+     K +  GF+ F++ + A   +++ N+  +   ++  
Sbjct: 196 TRAFYDTFKGYGEILSCKLD-----KRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 294 GRAQKKYER---------------------LQELRKQYEVSRLEKLAKYQGVNLFVKNLD 332
           G    K  R                     L+      +  +  +L       +FVKNL 
Sbjct: 251 GLHFDKEIRNFPNFDKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLP 310

Query: 333 DSIDDEKLRDEFAPFGAITSAKVMRDDAGNSK-GFGFVCFSTPEEATKAITEKNQQIVAG 391
             + DE++ D F+  G + S  V   +    K  + F+ +    +  +A    N     G
Sbjct: 311 FDVPDEEILDHFSKLGPVKS--VFSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQG 368

Query: 392 KPLYVAIAQRKD 403
           K + V+ A+ K+
Sbjct: 369 KTITVSRAKLKN 380

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score =  122 bits (306), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 135/299 (45%), Gaps = 41/299 (13%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           ++ +L+VG L   +T   L ++F    S  S +VC +A    SLG+ Y+NF + +    A
Sbjct: 62  NNIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERA 121

Query: 98  IQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKALHDTFSVFGNI 154
            +  NY  I G+  RIM S RD   RK    NIF  NL      + ++  +D F  +GN+
Sbjct: 122 TEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNV 181

Query: 155 LSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPH----------- 203
           LS K+ +     SK  GFV+FE++  A++ +   N     G  +    H           
Sbjct: 182 LSVKLDS-----SKNIGFVYFEDDTIARDVIKEFNNKEFLGNIISCGLHFDKELRKKPNF 236

Query: 204 ---VSKKDRQSKLEEAKSNFTN-------------------IYVKNIDLETTQEEFEALF 241
              +SK D    +E+ K  F +                   I++KN+ L+T   E  A+F
Sbjct: 237 DKQISKLDDDIIIEKEKEIFDSNKVEIKIDKDKVAIIQPNGIFIKNLPLDTNNNEILAIF 296

Query: 242 TQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           ++ G I S  L   +E +   + F+ ++D  S  KA+   N     ++ ++V  A  KY
Sbjct: 297 SEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFNGKAIGNRNVFVTHAYSKY 355

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 323 GVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
            + LFV NL + I  E+L + F  + +  SAKV  + D   S G G++ F   E+A +A 
Sbjct: 63  NIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERAT 122

Query: 382 TEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQI 413
            + N   + GK + +  + R  V R      I
Sbjct: 123 EDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score =  122 bits (306), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 108/394 (27%), Positives = 172/394 (43%), Gaps = 43/394 (10%)

Query: 27  STESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYV 86
           ST+  N        +L++G+L   VTE +L+++F+   S +S+++C D+ TK SLGY Y+
Sbjct: 125 STQQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYL 184

Query: 87  NFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNL---HPAIDNKA 143
           NF D      A+ + NY  I GR  R+M S R+   RK    N+F  NL   +  +  + 
Sbjct: 185 NFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNTKLTTRV 244

Query: 144 LHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPH 203
            +D F  FG ILSCK+        K  GF++FE + +AKEA+   NG       +    H
Sbjct: 245 FYDEFKKFGKILSCKL-----DRRKNIGFIYFENDAAAKEAIKQYNGKEFFDSTIMCGVH 299

Query: 204 VSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGF 263
             +  R+S   E K N  N      +L   +E+ E             +E D+       
Sbjct: 300 FDRNVRKSPEFEQKINRIN------NLTVVKEKLE-------------MEDDNN------ 334

Query: 264 GFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQG 323
             +  +  E+  K V   NDTD       VG A K    ++E  K+   S+  KL     
Sbjct: 335 --VTTDPSENGKKDVVAGNDTDDDDDDKAVGNATKSL--VEETNKE---SKNTKLPHPNA 387

Query: 324 VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITE 383
           +  FVKNL  +   + L + F+  G + S     D +     + F+ +   ++   AI +
Sbjct: 388 I--FVKNLPINPSHDNLLNFFSKIGPVKSV-YTSDVSKFDSSWAFITYKRIQDTKTAIEK 444

Query: 384 KNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 417
            N      + + V   +R  +  SQ     +  N
Sbjct: 445 LNGCKYMKRTIEVKKTERHHLEESQFENNTRPNN 478

>Scas_697.10
          Length = 610

 Score =  106 bits (265), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 107/426 (25%), Positives = 176/426 (41%), Gaps = 62/426 (14%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
            +L++G+L+  VT+  L  +F    S  S +VC D  T  SLG+ Y+NF D +    AI 
Sbjct: 101 TALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAID 160

Query: 100 KLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALH-----DTFSVFGNI 154
             N   +  +  RIM S R  + +K    N+F  NL P  DN+  H     + F  FG I
Sbjct: 161 DFNCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFTNL-PDEDNRLFHSRKFFEIFRQFGKI 219

Query: 155 LSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA---------PHVS 205
           LSC++  +     K  GF+ FE E  AK  V   N  +  G  +            P + 
Sbjct: 220 LSCRLDPN-----KNIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGILSEDNSKKPIME 274

Query: 206 KKDRQSK---------------LEEAKSNFTN------IYVKNIDLETTQEEFEALFTQF 244
           +K  Q+K               +  A  N  N      ++V N+    T EE    F + 
Sbjct: 275 EKQEQAKQFSQLNKKYDLNEKNMPRALLNTNNLFIENTVFVSNLPTSITVEEIRNHFNKI 334

Query: 245 GKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQ 304
           G I +  +  D       + F+ +     A +A+ ELN+T  + +++ V +A ++ E   
Sbjct: 335 GNIMNLFIS-DKISSNALWAFVKYSTAACAIRAIKELNNTFIRKKQIVVSQAFRRGE--- 390

Query: 305 ELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFA-----PFGAITSAKVMRDD 359
               Q+ +SR     K     L++K L   I D+    +F       F  I+  KV  + 
Sbjct: 391 ---TQFHLSR-----KPTKRILYLKEL-SRICDKDFVSQFCHQRRIKFDEISLTKVNLEK 441

Query: 360 AGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQM 419
           + ++      C  T E+A K     N +++AG  +  +     ++   +        NQ+
Sbjct: 442 STHTARIK--C-RTDEDARKLYNSINNRLIAGSIIKASWENSNEIENVEKDISNNVENQI 498

Query: 420 RYQQVT 425
           R  + T
Sbjct: 499 RTGKCT 504

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 104/195 (53%), Gaps = 6/195 (3%)

Query: 18  NDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAIT 77
           NDD + +     +     +TS   LYVG LD ++TE LL   F   G + ++++  D + 
Sbjct: 36  NDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MK 94

Query: 78  KTSLGYAYVNF-HDHDAGRTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNIFIKNL 135
              + YA+V +   HDA   A+Q LN   ++ +  +I W+ +   +     + N+F+ +L
Sbjct: 95  NEYVNYAFVEYIRSHDA-NVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDL 153

Query: 136 HPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLN 194
           +  +D++ L  TF  F   +   +  D + G S+G+GFV F  +  A++A+DA+ G  L+
Sbjct: 154 NVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLS 213

Query: 195 GQEVYVAPHVSKKDR 209
           G+++ +    +K++R
Sbjct: 214 GRQIRIN-WATKRER 227

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 16/182 (8%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           +YV N+D   T++  +  F   G I +  +  D + +   + F+ +     A  A+  LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342
               +++ L +  A   +E  Q                    NLFV +L+  +DDE L  
Sbjct: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164

Query: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F     A VM D   G S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224

Query: 402 KD 403
           ++
Sbjct: 225 RE 226

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 78/171 (45%), Gaps = 6/171 (3%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +++ NL  +I    L   F   G I + KI  D       + FV +   + A  A+  +N
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITS 249
           G+ L  + +     ++      +  E    F N++V +++++   E     F +F     
Sbjct: 120 GVQLENKTL----KINWAFETQQAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174

Query: 250 AVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299
           A +  D + G+ RG+GF++F + E A KA+D +   D   +++ +  A K+
Sbjct: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKR 225

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 58/126 (46%), Gaps = 13/126 (10%)

Query: 11  QLEQ--LKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSS 68
           QLE   LKIN        + E++ A  +  + +L+VG+L+  V +  L   F    +   
Sbjct: 122 QLENKTLKIN-------WAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQ 174

Query: 69  IRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSG 128
             V  D  T  S GY +V+F + +  + A+  +    + GR  RI W+ +    R++  G
Sbjct: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK----RERNMG 230

Query: 129 NIFIKN 134
           N F  N
Sbjct: 231 NNFGNN 236

>Scas_671.4
          Length = 443

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF-HDHDAG 94
           +TS   LYVG LD ++ E LL   F   G ++ +++  D     ++ YA++ +   HDA 
Sbjct: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDA- 136

Query: 95  RTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGN 153
             A+Q LN   I+G+  RI W+ Q   +     + N+F+ +L+  +D++ L   F  F +
Sbjct: 137 NVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPS 196

Query: 154 ILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
            +   +  D + G S+G+GFV F ++  A+EA++ + GM +NG+ V +
Sbjct: 197 YVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 84/178 (47%), Gaps = 6/178 (3%)

Query: 123 RKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAK 182
           R+     +++ NL  +I+   L   F V G I   KI  D+  N+  + F+ + + + A 
Sbjct: 78  RETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN 137

Query: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242
            A+  +NG+ + G+ V +         QS+      +  N++V +++++   E     F 
Sbjct: 138 VALQTLNGIQIEGKTVRI-----NWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFD 192

Query: 243 QFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299
           QF     A +  D + G+ RG+GF++F D E A +A++ +       + + +  A K+
Sbjct: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATKR 250

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 16/182 (8%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           +YV N+D    ++  +  F   G+IT   +  D +     + FI +     A  A+  LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342
               + + + +  A          + Q   +  +        NLFV +L+  +DDE L  
Sbjct: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189

Query: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F +   A VM D   G S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

Query: 402 KD 403
           ++
Sbjct: 250 RE 251

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F D +  + A+  
Sbjct: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231

Query: 101 LNYTTIKGRPCRIMWSQR 118
           +    I GR  RI W+ +
Sbjct: 232 MQGMPINGRAVRINWATK 249

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 103/200 (51%), Gaps = 4/200 (2%)

Query: 2   SDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFS 61
           S   +  +EQ E  +  +D    P +  +     +TS   LYVG LD  +TE +L   F 
Sbjct: 39  SVAVEGNSEQAEDNQGENDPSVVPANAIT--GGRETSDRVLYVGNLDKAITEDILKQYFQ 96

Query: 62  PIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPS 121
             G +++I++  D   K ++ YA+V +H       A+Q LN   I+    +I W+ +   
Sbjct: 97  VGGPIANIKIMIDKNNK-NVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQ 155

Query: 122 LRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYS 180
                + N+F+ +L+  +D++ L + F  F + LS  +  D + G+S+G+GFV F  +  
Sbjct: 156 SSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDD 215

Query: 181 AKEAVDAINGMLLNGQEVYV 200
           A+ A+D++ G  LNG+ + +
Sbjct: 216 AQNAMDSMQGQDLNGRPLRI 235

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 17/182 (9%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           +YV N+D   T++  +  F   G I +  +  D   K   + F+ +     A  A+  LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342
               ++  + +  A +                 ++ +     NLFV +L+ ++DDE LR+
Sbjct: 137 GKQIENNIVKINWAFQS----------------QQSSSDDTFNLFVGDLNVNVDDETLRN 180

Query: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F +  S  VM D   G+S+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 181 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

Query: 402 KD 403
           +D
Sbjct: 241 RD 242

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +L+VG+L+  V +  L + F    S  S  V  D  T +S GY +V+F   D  + A+  
Sbjct: 163 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDS 222

Query: 101 LNYTTIKGRPCRIMWSQR 118
           +    + GRP RI W+ +
Sbjct: 223 MQGQDLNGRPLRINWAAK 240

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 132/320 (41%), Gaps = 62/320 (19%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           +TS   LYVG LD T+ EA L   F   G +++++V  D   + +  YA+V +       
Sbjct: 31  ETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYRQPRDAN 89

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155
            A Q L+   I+    +I W+ +   +    + N+F+ +L+  +D++ L  TF  F   +
Sbjct: 90  VAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFI 149

Query: 156 SCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV-------------- 200
              +  D ++G S+G+GFV F E+  A++A+DA  G  LNG+ + V              
Sbjct: 150 QAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRESQHAARP 209

Query: 201 ---------------------APH--------------------VSKKDRQSKLEEAKSN 219
                                 PH                    V+ +  ++ +  A   
Sbjct: 210 RSNRGGFRGGSGHQPFRGMPQGPHLGGAAPAGPMQLQGPPVPSPVNPQAVEAMIRRAPQR 269

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
            T  Y+ NI     + +   L   FG I     +  +E   +G  FI ++ H+ AA  + 
Sbjct: 270 VTTAYIGNIPHFAQEPDLIPLLQNFGFIID--FKHYAE---KGCCFIKYDTHDQAALCIV 324

Query: 280 ELNDTDFKSQRLYVGRAQKK 299
            L +  F+ + L  G  ++K
Sbjct: 325 ALANFPFQGRTLRTGWGKEK 344

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 17/186 (9%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           +YV N+D    +   +  F   G I +  +  D   +   + F+ +     A  A   L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342
               ++  + +  A +                 ++++     NLFV +L+  +DDE L  
Sbjct: 97  GKQIENNVIKINWAFQS----------------QQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F     A VM D  +G S+G+GFV F   EEA KA+  K    + G+ + V  A +
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 402 KDVRRS 407
           ++ + +
Sbjct: 201 RESQHA 206

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 90/180 (50%), Gaps = 14/180 (7%)

Query: 33  AKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHD 92
           AK D   A+++VG L  ++ +  L   F  IG V + RV  +  T  S GY YV+F D  
Sbjct: 169 AKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKS 228

Query: 93  AGRTAIQKLNYTTIKGRPCRIMWSQRDPSL-----RKKGSGNI--------FIKNLHPAI 139
               A+++++   I GRP  +  S   P++     R+K  G+I        F+ NL    
Sbjct: 229 YAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNA 288

Query: 140 DNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEV 198
           D   +++ F  FG I+S +I T  E    KGFG+V +     AK+A++A+ G  ++ + V
Sbjct: 289 DRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPV 348

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 88/162 (54%), Gaps = 9/162 (5%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDA 187
            +F+  L  +ID++ L   F   G +++ ++  +   + S+G+G+V FE++  A++AV  
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 188 INGMLLNGQEVYVAPHVSK------KDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEAL 240
           ++G  ++G+ + V    SK      +DRQ +  +  S  ++ +++ N+     ++    +
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 241 FTQFGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
           F +FG+I S  +    E  +P+GFG++ +   + A KA++ L
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 84/181 (46%), Gaps = 7/181 (3%)

Query: 215 EAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESA 274
           E  + F      +ID E  ++EFE +    G + + V+      + RG+G+++FED   A
Sbjct: 174 EPATVFVGRLSWSIDDEWLKQEFEHIG---GVVAARVMYERGTDRSRGYGYVDFEDKSYA 230

Query: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDS 334
            KAV E++  +   + + V  +  K        +Q    R   +       LF+ NL  +
Sbjct: 231 EKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQ---KRFGDIPSEPSDTLFLGNLSFN 287

Query: 335 IDDEKLRDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
            D + + + F  FG I S ++    +    KGFG+V +++ ++A KA+     + +  +P
Sbjct: 288 ADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRP 347

Query: 394 L 394
           +
Sbjct: 348 V 348

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 3/89 (3%)

Query: 317 KLAKYQG--VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFST 373
           K AK  G    +FV  L  SIDDE L+ EF   G + +A+VM +   + S+G+G+V F  
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFED 226

Query: 374 PEEATKAITEKNQQIVAGKPLYVAIAQRK 402
              A KA+ E + + + G+P+ V ++  K
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMSTSK 255

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S +L++G L        +Y++F   G + S+R+     T+   G+ YV +   D  + A+
Sbjct: 276 SDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKAL 335

Query: 99  QKLNYTTIKGRPCRIMWSQRDP 120
           + L    I  RP R+ +S   P
Sbjct: 336 EALQGEYIDNRPVRLDYSTPKP 357

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 103/209 (49%), Gaps = 20/209 (9%)

Query: 16  KINDDQQTAPTSTESENAKVDTSS--ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCR 73
           K +DD++     +ES+  K + +   A+++VG L  ++ +  L   F PIG V S RV  
Sbjct: 174 KADDDEE----KSESKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMY 229

Query: 74  DAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRP--CRIMWSQ-----RDPSLRKKG 126
           +  T  S GY YV+F D      AI++++   I GRP  C +  S+     RD   +K G
Sbjct: 230 ERGTDRSRGYGYVDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFG 289

Query: 127 ------SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEY 179
                 S  +F+ NL    D   L++ F  +G I+S +I T  E    KGFG+V +    
Sbjct: 290 DVPSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIE 349

Query: 180 SAKEAVDAINGMLLNGQEVYVAPHVSKKD 208
            A +A + + G  +N + V +   + K++
Sbjct: 350 DATKAFEGLQGEYINNRPVRLDYSIPKQN 378

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 85/161 (52%), Gaps = 9/161 (5%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAI 188
           IF+  L  +ID++ L   F   G ++S ++  +   + S+G+G+V FE++  A++A+  +
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 189 NGMLLNGQEVYVAPHVSK------KDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALF 241
           +G  ++G+ +      SK       DR  K  +  S  ++ +++ N+  E  ++    +F
Sbjct: 258 HGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIF 317

Query: 242 TQFGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
            ++G+I S  +    E  +P+GFG++ +   E A KA + L
Sbjct: 318 GKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGL 358

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 324 VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAIT 382
             +FV  L  SIDDE L+ EF P G + SA+VM +   + S+G+G+V F     A KAI 
Sbjct: 196 ATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIK 255

Query: 383 EKNQQIVAGKPLYVAIAQRK 402
           E + + + G+P+   ++  K
Sbjct: 256 EMHGKEIDGRPINCDMSTSK 275

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 87/197 (44%), Gaps = 19/197 (9%)

Query: 205 SKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFG 264
           SKK +     E  + F      +ID E  + EFE +    G I++ V+      + RG+G
Sbjct: 184 SKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEPIG---GVISARVMYERGTDRSRGYG 240

Query: 265 FINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGV 324
           +++FED   A KA+ E++  +   + +    +  K              R ++  K+  V
Sbjct: 241 YVDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSK---------PAGAPRDDRAKKFGDV 291

Query: 325 ------NLFVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPEEA 377
                  LF+ NL    D + L + F  +G I S ++    +    KGFG+V + + E+A
Sbjct: 292 PSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDA 351

Query: 378 TKAITEKNQQIVAGKPL 394
           TKA      + +  +P+
Sbjct: 352 TKAFEGLQGEYINNRPV 368

>Kwal_27.11447
          Length = 439

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 93/167 (55%), Gaps = 4/167 (2%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD-HDAG 94
           +TS   LYVG LD  VTE +L   F   G+++++++  D   K +  YA+V FH  HDA 
Sbjct: 58  ETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEA-NYAFVEFHQPHDAS 116

Query: 95  RTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI 154
             A Q L+   I+    +I ++ +   +  + + N+F+ +L+  +D++ L +TF      
Sbjct: 117 -VAFQTLDGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTF 175

Query: 155 LSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           +   +  D + G S+G+GFV F E+  A++A++   G ++NG+ + +
Sbjct: 176 IQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRI 222

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           +YV N+DL  T++  +  F   G I +  +  D   K   + F+ F     A+ A   L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342
               ++  + +  A +                 ++++     NLFV +L+  +DDE L +
Sbjct: 124 GKQIENHVIKINYAFQS----------------QQVSSEDTFNLFVGDLNVDVDDETLAN 167

Query: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F        A VM D   G S+G+GFV F    +A KA+ EK   +V G+ + +  A +
Sbjct: 168 TFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

Query: 402 KD 403
           ++
Sbjct: 228 RE 229

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +L+VG+L+  V +  L + F  + +     V  D  T  S GY +V+F +    + A+++
Sbjct: 150 NLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEE 209

Query: 101 LNYTTIKGRPCRIMWSQR 118
              T + GR  RI W+ +
Sbjct: 210 KQGTVVNGRAIRINWASK 227

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 7/101 (6%)

Query: 200 VAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK 259
           + P V  +  ++ +  A S  T +Y+ NI    ++++   L   FG I       D +  
Sbjct: 303 LPPQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIV------DFKHY 356

Query: 260 P-RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299
           P RG  FI +  HE AA  +  L +  F+ + L  G  ++K
Sbjct: 357 PDRGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEK 397

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 99/186 (53%), Gaps = 4/186 (2%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVN-FHDHDAG 94
           + S   LYVG L  ++ + LL   F   GS+SS+++  D  ++    YA+V  F  HDA 
Sbjct: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDA- 150

Query: 95  RTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI 154
             A Q LN   ++G+  +I W+ +   +    + N+F+ +L+  +D+  L  TF  F + 
Sbjct: 151 NVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSF 210

Query: 155 LSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKL 213
           +   +  D ++G S+G+GFV F E+  A+ A++   G  LNG+ + +     ++ +QS+ 
Sbjct: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270

Query: 214 EEAKSN 219
            + + N
Sbjct: 271 GQRRFN 276

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 85/179 (47%), Gaps = 9/179 (5%)

Query: 123 RKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAK 182
           R+K    +++ NL  +ID+  L   F + G+I S KI  D+      + FV + E + A 
Sbjct: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151

Query: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFT-NIYVKNIDLETTQEEFEALF 241
            A   +NG  + G+       V K +   + ++  S+ T N++V +++++         F
Sbjct: 152 VAYQTLNGKEVEGK-------VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204

Query: 242 TQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299
            +F     A +  D + G+ RG+GF++F + + A  A++     +   + L +  A K+
Sbjct: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 84/191 (43%), Gaps = 17/191 (8%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           +YV N+      +  +  F   G I+S  +  D   +   + F+ + +   A  A   LN
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342
             + + + L +  A +                 +++   +  NLFV +L+  +DD  L  
Sbjct: 159 GKEVEGKVLKINWAFQS----------------QQVNSDETFNLFVGDLNVDVDDATLAG 202

Query: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F +   A VM D  +G S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262

Query: 402 KDVRRSQLAQQ 412
           ++ ++SQ  Q+
Sbjct: 263 REPQQSQQGQR 273

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 83.2 bits (204), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 97/200 (48%), Gaps = 20/200 (10%)

Query: 21  QQTAPTSTESEN------AKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRD 74
           +++   S ESE+       K D   A+++VG L  +V +  L   F  IG V   RV  +
Sbjct: 142 EESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE 201

Query: 75  AITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRP--CRIMWSQ-----RDPSLRKKG- 126
             T  S GY YV+F D      A+++++   I GR   C +  S+     R+   +K G 
Sbjct: 202 RGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGD 261

Query: 127 -----SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYS 180
                S  +F+ NL    D  AL + FS  GN++S +I T  E+   KGFG+V +     
Sbjct: 262 TPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEE 321

Query: 181 AKEAVDAINGMLLNGQEVYV 200
           A+ A+DA+ G  ++ + V +
Sbjct: 322 AQAALDALQGEYIDNRPVRI 341

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 82/161 (50%), Gaps = 9/161 (5%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAI 188
           IF+  L  ++D++ L   F   G ++  ++  +   + S+G+G+V FE+   A++AV  +
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEM 228

Query: 189 NGMLLNGQEVYVAPHVSK------KDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALF 241
           +G  ++G+ +      SK      +DR  K  +  S  ++ +++ N+     ++    LF
Sbjct: 229 HGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFELF 288

Query: 242 TQFGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
           ++ G + S  +    E  +P+GFG++ +   E A  A+D L
Sbjct: 289 SKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 88/201 (43%), Gaps = 19/201 (9%)

Query: 205 SKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSA--VLERDSEGKPRG 262
           S+ D  +K ++       I+V  +      E  +  F   G +  A  + ER ++ K RG
Sbjct: 151 SEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTD-KSRG 209

Query: 263 FGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQ 322
           +G+++FED   A KAV E++  +   + +    +           K     R ++  KY 
Sbjct: 210 YGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMS---------TSKPASAPREDRAKKYG 260

Query: 323 GV------NLFVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPE 375
                    LF+ NL  + D + L + F+  G + S ++    ++   KGFG+V + + E
Sbjct: 261 DTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVE 320

Query: 376 EATKAITEKNQQIVAGKPLYV 396
           EA  A+     + +  +P+ +
Sbjct: 321 EAQAALDALQGEYIDNRPVRI 341

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S +L++G L        L++LFS  G+V S+R+     +    G+ YV +   +  + A+
Sbjct: 267 SDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAAL 326

Query: 99  QKLNYTTIKGRPCRIMWSQRDP 120
             L    I  RP RI +S   P
Sbjct: 327 DALQGEYIDNRPVRIDFSSPRP 348

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 138/317 (43%), Gaps = 60/317 (18%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVS-SIRVCRDAITKTSLGYAYVNFHDHDAG 94
           DTSS  LY+G+LDP+ TE  +  +++ +G  +  +++ +++    + GY +V F  + A 
Sbjct: 48  DTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAA 107

Query: 95  RTAIQK--LNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTF-SVF 151
             A+ K  L       R  ++ W+    +   + S  IF+ +L P +    L + F S +
Sbjct: 108 TNALLKTGLPIPVDASRTLKLNWASFATTPGSEFS--IFVGDLAPNVTESQLFELFISRY 165

Query: 152 GNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDR- 209
            + L+ KI  D+  G SKG+GFV F  E   + ++  + G+ LNG+ + V+     K R 
Sbjct: 166 SSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSRF 225

Query: 210 -----------------------------QSKLEE----------------AKSNFTNIY 224
                                        Q+ L++                A  N T ++
Sbjct: 226 QSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTVF 285

Query: 225 VKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDT 284
           +  +    T++E  A F  FG+I   V  +   GK  G GF+ + D  SA  A+ ++   
Sbjct: 286 IGGLSSLVTEDELRAYFQPFGQI---VYVKIPVGK--GCGFVQYVDRSSAENAIAKMQGF 340

Query: 285 DFKSQ--RLYVGRAQKK 299
              +   RL  GR+ K+
Sbjct: 341 PIGNSRVRLSWGRSAKQ 357

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/297 (19%), Positives = 110/297 (37%), Gaps = 51/297 (17%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFG--NILSCKIATDEAGNSKGFGFVHFEEEYSAKEA 184
           S  +++ +L P+     +   ++  G  N+    I     G + G+ FV F         
Sbjct: 51  STQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSN------ 104

Query: 185 VDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEE-FEALFTQ 243
           + A N +L  G  + V    + K   +       +  +I+V ++    T+ + FE   ++
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWASFATTPGSEFSIFVGDLAPNVTESQLFELFISR 164

Query: 244 FGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYER 302
           +    +A +  D   G  +G+GF+ F +     +++ E+       + + V    K   R
Sbjct: 165 YSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSR 224

Query: 303 LQE-----------------------------LRKQ----YEVSRLEKLAKYQGVN---L 326
            Q                              L +Q    Y V +   L+++   N   +
Sbjct: 225 FQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTV 284

Query: 327 FVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITE 383
           F+  L   + +++LR  F PFG I   K+        KG GFV +     A  AI +
Sbjct: 285 FIGGLSSLVTEDELRAYFQPFGQIVYVKIPVG-----KGCGFVQYVDRSSAENAIAK 336

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 88/201 (43%), Gaps = 34/201 (16%)

Query: 216 AKSNFTNIYVKNIDLETTQEEFEALFTQFGK--ITSAVLERDSEGKPRGFGFINFEDHES 273
           A ++ T +Y+ ++D   T+ + + ++   G+  +   +++  S G   G+ F+ F  + +
Sbjct: 47  ADTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLA 106

Query: 274 AAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKL-----AKYQG--VNL 326
           A  A+            L  G           L    + SR  KL     A   G   ++
Sbjct: 107 ATNAL------------LKTG-----------LPIPVDASRTLKLNWASFATTPGSEFSI 143

Query: 327 FVKNLDDSIDDEKLRDEF-APFGAITSAKVMRDDA-GNSKGFGFVCFSTPEEATKAITEK 384
           FV +L  ++ + +L + F + + +  +AK++ D   G SKG+GFV F    E  +++ E 
Sbjct: 144 FVGDLAPNVTESQLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEM 203

Query: 385 NQQIVAGKPLYVAIAQRKDVR 405
               + G+ + V+   +   R
Sbjct: 204 QGVFLNGRAIRVSTTSKNKSR 224

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A+++VG L  ++ +  L   F  IG V   RV  +  T  S GY YV+F +      AIQ
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 227

Query: 100 KLNYTTIKGRPCRIMWSQRDPS-----LRKKG------SGNIFIKNLHPAIDNKALHDTF 148
           ++    I GRP     S   P+      +K G      S  +F+ NL    D  A+ + F
Sbjct: 228 EMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELF 287

Query: 149 SVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           +  G ++S +I T  E    KGFG+V F     AK+A+DA+ G  ++ + V +
Sbjct: 288 AKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 82/159 (51%), Gaps = 7/159 (4%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAI 188
           IF+  L  +ID++ L   F   G ++  ++  +   + S+G+G+V FE +  A++A+  +
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 189 NGMLLNGQEVYVAPHVSK----KDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALFTQ 243
            G  ++G+ +      SK     DR  K  +  S  ++ +++ N+     ++    LF +
Sbjct: 230 QGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAK 289

Query: 244 FGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
            G++ S  +    E  +P+GFG++ F + E A KA+D L
Sbjct: 290 HGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 90/193 (46%), Gaps = 9/193 (4%)

Query: 205 SKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFG 264
           +KK +  + EE  + F      +ID E  ++EFE +    G I + V+      + RG+G
Sbjct: 156 NKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIG---GVIGARVIYERGTDRSRGYG 212

Query: 265 FINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGV 324
           +++FE+   A KA+ E+   +   + +    +  K     +  K++  +  E        
Sbjct: 213 YVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSE-----PSD 267

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPEEATKAITE 383
            LF+ NL  + D + + + FA  G + S ++    +    KGFG+V FS  E+A KA+  
Sbjct: 268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 384 KNQQIVAGKPLYV 396
              + +  +P+ +
Sbjct: 328 LQGEYIDNRPVRL 340

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITEK 384
           +FV  L  SIDDE L+ EF   G +  A+V+ +   + S+G+G+V F     A KAI E 
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 385 NQQIVAGKPLYVAIAQRK 402
             + + G+P+   ++  K
Sbjct: 230 QGKEIDGRPINCDMSTSK 247

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 9   AEQLEQLKINDDQQTAPTSTESENAKV--DTSSA---SLYVGELDPTVTEALLYDLFSPI 63
            ++++   IN D  T+  +  ++ AK   DT S    +L++G L        +++LF+  
Sbjct: 231 GKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKH 290

Query: 64  GSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPS 121
           G V S+R+     T+   G+ YV F + +  + A+  L    I  RP R+ +S   P+
Sbjct: 291 GEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRPN 348

>Scas_637.2
          Length = 377

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 131/320 (40%), Gaps = 31/320 (9%)

Query: 110 PCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKG 169
           P R      +  + K     IFI NL      + L D FS  G +++ ++ +   G SKG
Sbjct: 60  PRRTYDRPYESGVEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS-YRGRSKG 118

Query: 170 FGFVHFEEEYSAKEAVDAINGMLLNGQEVYV----APHVSKKDRQSKLEEAKSNFTNIYV 225
            G V F     A+EA+   NG+   G++++V     P  S+++ +S   E        +V
Sbjct: 119 MGTVEFTNPADAEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSS--EPTQQGYEAFV 176

Query: 226 KNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTD 285
            N+    T +  + +F + G +  A +E D  G  RGFG + + + E   KA+D  N  +
Sbjct: 177 VNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAE 236

Query: 286 FKSQRLYVGRAQKKY----------------------ERLQELRKQYEVSRLEKLAKYQG 323
            + + L V   +  +                      E    L   +  S  E ++    
Sbjct: 237 LEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGE 296

Query: 324 VN--LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
            N  ++  NL  S     L D F   G I  A+++ D+ G S G   V +++ + A   I
Sbjct: 297 RNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCI 356

Query: 382 TEKNQQIVAGKPLYVAIAQR 401
            + N     G+ L++  A R
Sbjct: 357 NKLNGYNYGGRDLHITYASR 376

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 116/299 (38%), Gaps = 44/299 (14%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           +++G L    TE  L D FS +G V +  V   +    S G   V F +      AI++ 
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM--SYRGRSKGMGTVEFTNPADAEEAIRQY 137

Query: 102 NYTTIKGRPCRIMWSQRDPSLRKKGSGN--------IFIKNLHPAIDNKALHDTFSVFGN 153
           N     GR   +   Q  P  R++   +         F+ NL  +I  + L D F   G+
Sbjct: 138 NGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 154 ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV------------- 200
           ++   +  D  G S+GFG V +  E    +A+D+ NG  L G+ + V             
Sbjct: 198 VIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREGKFNHPRDTFD 257

Query: 201 ----------APHVSKKDRQSKLEEAKSNFT-----------NIYVKNIDLETTQEEFEA 239
                        V K++          +FT            +Y  N+ L TT  +   
Sbjct: 258 DRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDLYD 317

Query: 240 LFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQK 298
           LF   G+I  A L  D  G   G   + +   ++A   +++LN  ++  + L++  A +
Sbjct: 318 LFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYASR 376

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 307 RKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGF 366
           R+ Y+      + K+    +F+ NL     +E LRD F+  G + +A+VM    G SKG 
Sbjct: 61  RRTYDRPYESGVEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVM-SYRGRSKGM 119

Query: 367 GFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ-----RKDVRRSQLAQQ 412
           G V F+ P +A +AI + N     G+ ++V   Q     R++ + S+  QQ
Sbjct: 120 GTVEFTNPADAEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQ 170

>Scas_621.10
          Length = 415

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 85/178 (47%), Gaps = 13/178 (7%)

Query: 34  KVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDA 93
           K +   A+++VG L  ++ +  L   F  IG V S RV  +  T  S GY YV+F D   
Sbjct: 156 KTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSY 215

Query: 94  GRTAIQKLNYTTIKGRPCRIMWSQRDPSL----RKKGSGNI--------FIKNLHPAIDN 141
              AI+++    I GR   +  S   P+     R K  G++        F+ NL    D 
Sbjct: 216 AEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADR 275

Query: 142 KALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEV 198
            A+ + FS +G I+S +I T  E    KGFG+V +     AK+A++ + G  ++ + V
Sbjct: 276 DAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 86/160 (53%), Gaps = 8/160 (5%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAI 188
           IF+  L  +ID++ L   F   G ++S ++  +   + S+G+G+V FE++  A++A+  +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 189 NGMLLNGQEVYV-----APHVSKKDRQSKLEEAKSNFT-NIYVKNIDLETTQEEFEALFT 242
            G  ++G+E+ V      P     DR  K  +  S  +  +++ N+     ++    LF+
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 243 QFGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
           ++G+I S  +    E  +P+GFG++ + + E A KA++ L
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 82/175 (46%), Gaps = 8/175 (4%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSA--VLERDSEGKPRGFGFINFEDHESAAKAVDE 280
           I+V  +      E  +  F   G + SA  ++ER ++ + RG+G+++FED   A KA+ E
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTD-RSRGYGYVDFEDKSYAEKAIKE 222

Query: 281 LNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKL 340
           +   +   + + V  +  K       R +    +   +       LF+ NL  + D + +
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAK----KFGDVPSEPSETLFLGNLSFNADRDAI 278

Query: 341 RDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
            + F+ +G I S ++    +    KGFG+V ++  E+A KA+     + +  +P+
Sbjct: 279 SELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 324 VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPEEATKAIT 382
             +FV  L  SIDDE L+ EF   G + SA+V M      S+G+G+V F     A KAI 
Sbjct: 162 ATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIK 221

Query: 383 EKNQQIVAGKPLYVAIAQRK 402
           E   + + G+ + V ++  K
Sbjct: 222 EMQGKEIDGREINVDMSTSK 241

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 6/118 (5%)

Query: 9   AEQLEQLKINDDQQTA-PTSTESENAKV-----DTSSASLYVGELDPTVTEALLYDLFSP 62
            ++++  +IN D  T+ P +  ++ AK         S +L++G L        + +LFS 
Sbjct: 225 GKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFSK 284

Query: 63  IGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
            G + S+R+     T+   G+ YV + + +  + A++ L    I  RP R+ +S   P
Sbjct: 285 YGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPRP 342

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 96/194 (49%), Gaps = 7/194 (3%)

Query: 204 VSKKDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG 262
           + ++D + + +  K NF N I+V+N+  + T E+ + LF   G++  A +   S+G  RG
Sbjct: 104 IVERDLERQFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIIT-SKGHHRG 162

Query: 263 FGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQ 322
            G + F  +ES   A+ + +   F  ++L V +     E  +E  K+     ++      
Sbjct: 163 MGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEID-----N 217

Query: 323 GVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAIT 382
           G  +F+ NL  S++ + L+D F   G +  A V  D  G S+GFG V + T +E  +AI 
Sbjct: 218 GFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAID 277

Query: 383 EKNQQIVAGKPLYV 396
             N   V G+ L V
Sbjct: 278 TFNGMEVEGRVLEV 291

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 129/304 (42%), Gaps = 33/304 (10%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           IF++NL      + L + F   G ++   I T + G+ +G G V F +  S ++A+   +
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNESVQDAISKFD 182

Query: 190 GMLLNGQEVYVA-----PHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQF 244
           G L   +++ V      P  +K+  +    E   N   +++ N+      +  + +F + 
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKEC 242

Query: 245 GKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV--GRAQKK--Y 300
           G +  A +E D  G  RGFG + +   +   +A+D  N  + + + L V  GR  K+   
Sbjct: 243 GHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNN 302

Query: 301 ERLQELRKQYEVSR--------------LEKLAKY-QGVN--------LFVKNLDDSIDD 337
           +R  + R+  E +R               E  AK+ +GVN        ++  NL  S   
Sbjct: 303 DRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTAR 362

Query: 338 EKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 397
             L D F P G I +A++   + G   G   V +    +A   I + N     G  L ++
Sbjct: 363 SDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQIS 422

Query: 398 IAQR 401
            A+R
Sbjct: 423 YARR 426

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 122/310 (39%), Gaps = 58/310 (18%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHDAGRTAI 98
           S++V  L    T   L +LF  +G V    V  D IT      G   V F  +++ + AI
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEV----VEADIITSKGHHRGMGTVEFTKNESVQDAI 178

Query: 99  QKLNYTTIKGRPCRIMWSQRDP------SLRKKGSGN-------IFIKNLHPAIDNKALH 145
            K +      R  ++M  Q +P         KK +         +FI NL  +++ ++L 
Sbjct: 179 SKFDGALFMDR--KLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLK 236

Query: 146 DTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVS 205
           D F   G++L   +  D  G S+GFG V +  E     A+D  NGM + G+ + V     
Sbjct: 237 DMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRF 296

Query: 206 KK--------------------------DRQSKLEEAKSNFTN-----------IYVKNI 228
            K                          D    ++E  + FT            IY  N+
Sbjct: 297 NKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNL 356

Query: 229 DLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKS 288
              T + +   LF   GKI +A L+    G+P G   + +E+   A   + +LN+ ++  
Sbjct: 357 PFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGG 416

Query: 289 QRLYVGRAQK 298
             L +  A++
Sbjct: 417 CSLQISYARR 426

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 22  QTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSL 81
           +TA   TE  N   D  +  +Y   L  +   + L+DLF PIG +++  + +        
Sbjct: 332 ETAAKFTEGVNPGGD-RNCFIYCSNLPFSTARSDLFDLFGPIGKINNAEL-KPQENGQPT 389

Query: 82  GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRD 119
           G A V + +       IQKLN     G   +I +++RD
Sbjct: 390 GVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARRD 427

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 85/173 (49%), Gaps = 14/173 (8%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A+++VG L  ++ +  L   F  IG V S RV  +  +  S GY YV+F D      A++
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 100 KLNYTTIKGRP--CRIMWSQ-----RDPSLRKKG------SGNIFIKNLHPAIDNKALHD 146
           +++   I GRP  C +  S+     RD   +K G      S  +F+ NL    D   L +
Sbjct: 233 EMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFE 292

Query: 147 TFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEV 198
            FS  G ++S +I T  E    KGFG+V +     AK+A +A+ G  ++ + V
Sbjct: 293 IFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPV 345

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 85/161 (52%), Gaps = 9/161 (5%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAI 188
           IF+  L  +ID++ L   F   G ++S ++  +   + S+G+G+V FE+++ A++AV  +
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 189 NGMLLNGQEVYVAPHVSK------KDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALF 241
           +G  ++G+ +      SK       DR  K  +  S  ++ +++ N+     ++    +F
Sbjct: 235 HGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEIF 294

Query: 242 TQFGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
           +Q G++ S  +    E  +P+GFG++ +   + A KA + L
Sbjct: 295 SQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEAL 335

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 19/181 (10%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSA--VLERDSEGKPRGFGFINFEDHESAAKAVDE 280
           I+V  +      E  +  F   G + SA  + ER S+ + RG+G+++FED   A KAV E
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSD-RSRGYGYVDFEDKHYAEKAVKE 233

Query: 281 LNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGV------NLFVKNLDDS 334
           ++  +   + +    +           K     R ++  K+  V       LF+ NL  +
Sbjct: 234 MHGKEIDGRPINCDMSTS---------KPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFN 284

Query: 335 IDDEKLRDEFAPFGAITSAKV-MRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
            D + L + F+  G + S ++    +    KGFG+V + + ++A KA      + +  +P
Sbjct: 285 ADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRP 344

Query: 394 L 394
           +
Sbjct: 345 V 345

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S +L++G L        L+++FS  G V S+R+     T+   G+ YV +   D  + A 
Sbjct: 273 SDTLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAF 332

Query: 99  QKLNYTTIKGRPCRIMWS 116
           + L    I  RP R+ +S
Sbjct: 333 EALQGEYIDNRPVRLDYS 350

>Kwal_55.21960
          Length = 597

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 13/173 (7%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAVDAI 188
           +FI  L+       L D FS +G +   KI  D A G S+GFGF+ F E  S  E V   
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 189 NGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT 248
           +  +L+G+ +          +++   E +     I+V  I  +   +EFE  F+Q+G I 
Sbjct: 271 H--ILDGKVI--------DPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTII 320

Query: 249 SAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
            A L  D + G+ RGFGFI + D   A   V E    +FK +R+ + RA+ ++
Sbjct: 321 DAQLMLDKDTGRSRGFGFITY-DTPDAVDRVCENKFIEFKGKRIEIKRAEPRH 372

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 90/179 (50%), Gaps = 22/179 (12%)

Query: 208 DRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFI 266
           D++    +   +   +++  ++ ETT++  +  F+++G++T   + RD + G+ RGFGF+
Sbjct: 196 DQRPNKADLSRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFL 255

Query: 267 NFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNL 326
            F +    A +VDE+     K+Q +  G+       + + ++       +K  K     +
Sbjct: 256 TFAE----ASSVDEV----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----I 295

Query: 327 FVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           FV  +   +  ++  + F+ +G I  A++M D D G S+GFGF+ + TP+   +    K
Sbjct: 296 FVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCENK 354

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK- 100
           +++G L+   TE  L D FS  G V+ +++ RD  T  S G+ ++ F +  +    ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 101 --LNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCK 158
             L+   I   P R +     P   +  +G IF+  + P +  K   + FS +G I+  +
Sbjct: 271 HILDGKVID--PKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 323

Query: 159 IATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
           +  D + G S+GFGF+     Y   +AVD +
Sbjct: 324 LMLDKDTGRSRGFGFI----TYDTPDAVDRV 350

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA-GNSKGFGFVCFSTPEEATKAITEK 384
           +F+  L+    ++ L+D F+ +G +T  K+MRD+A G S+GFGF+ F+      + +  K
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVV--K 268

Query: 385 NQQIVAGK 392
            Q I+ GK
Sbjct: 269 TQHILDGK 276

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 94/192 (48%), Gaps = 8/192 (4%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           +   ++V++I  +   EEF   F+QF  I  +V+ +DSE + RGFGF++F   +   +A+
Sbjct: 24  DMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEAL 83

Query: 279 DELNDTDFKSQRLYVG------RAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLD 332
            +     FK++ L +       R+++   R +   K Y+ S  E+L K +   L ++N+ 
Sbjct: 84  AQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKP-KLIIRNMP 142

Query: 333 DSIDDEK-LRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
            S  D   L+  F+ FG +  AK+ +   G   GF FV         +AI E     + G
Sbjct: 143 WSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDG 202

Query: 392 KPLYVAIAQRKD 403
           + + +  A +K+
Sbjct: 203 RQVAIDFAIQKN 214

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 78/186 (41%), Gaps = 28/186 (15%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++++    +++   D FS F  I    I  D    S+GFGFV F  E   KEA+    
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEE------------- 236
                 + + +   ++K+  +SK  E +    +   K    E+ +EE             
Sbjct: 88  KAKFKNRLLRI--DIAKRRERSKRNEPRQESEHKSYK----ESNEEELMKGKPKLIIRNM 141

Query: 237 ---------FEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFK 287
                     + LF++FG +  A + + + GK  GF F+  +   +  +A++E  D    
Sbjct: 142 PWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKID 201

Query: 288 SQRLYV 293
            +++ +
Sbjct: 202 GRQVAI 207

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSA--VLERDSEGKPRGFGFINFEDHESAAKAVD 279
           +I+V+N+  + TQE  E+ F +FG +  A  VL++++ G  +G  F+ F+  E+ ++ VD
Sbjct: 299 SIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKET-GLAKGTAFVAFKTEEAFSECVD 357

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 316 EKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSA-KVMRDDAGNSKGFGFVCFSTP 374
           +K  K +  ++FV+N+      E L   F  FG +  A  V+  + G +KG  FV F T 
Sbjct: 290 QKKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTE 349

Query: 375 EEATKAI 381
           E  ++ +
Sbjct: 350 EAFSECV 356

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 258 GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVG 294
           G+ RG+GF+ + DH++A   +  LN  +   Q +  G
Sbjct: 558 GRSRGYGFVEYRDHKAALMGLRWLNAHEVTRQEILEG 594

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 124 KKGSGNIFIKNLHPAIDNKALHDTFSVFGNI-LSCKIATDEAGNSKGFGFVHFEEEYSAK 182
           K+ S +IF++N+      ++L   F  FG +  +  +   E G +KG  FV F+ E +  
Sbjct: 294 KQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEEAFS 353

Query: 183 EAVD 186
           E VD
Sbjct: 354 ECVD 357

>Kwal_55.20154
          Length = 522

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 137/322 (42%), Gaps = 58/322 (18%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVS-SIRVCRDAITK-TSLGYAYVNFHDHDA 93
            T S SLY+G+LDP   EA +  +++ +G  +  I++ R + +   + GY +V F  H  
Sbjct: 41  STRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTN 100

Query: 94  GRTAIQK--LNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTF-SV 150
              A+ K  L       R  ++ W+    +   + S  +F+ ++ P +    L + F S 
Sbjct: 101 ASNALLKNGLVIPNTGNRILKLNWASFATTPGNEYS--VFVGDVAPNVTEAQLFELFISR 158

Query: 151 FGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV--------- 200
           + + L+ KI  D+  G SKG+GFV F +E   + ++  + G+ LNG+ + V         
Sbjct: 159 YASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRPK 218

Query: 201 -----------------------APHVSKKDRQSKL-----------EEAKSNFTNIYVK 226
                                  AP  +    QS+            +    N T +++ 
Sbjct: 219 FQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFIG 278

Query: 227 NIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDF 286
            +    T++E  A F  FG I   V  +   GK  G GF+ + D  SA  A+ ++     
Sbjct: 279 GLSSLVTEDELRAFFQPFGSI---VYVKIPVGK--GCGFVQYVDRLSAETAIAKMQGFPI 333

Query: 287 KSQ--RLYVGRAQKKYERLQEL 306
            +   RL  GR+ K+   +Q++
Sbjct: 334 GNSRIRLSWGRSAKQAAVMQKV 355

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/295 (19%), Positives = 114/295 (38%), Gaps = 49/295 (16%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFG--NI-LSCKIATDEAGNSKGFGFVHFEEEYSAKE 183
           S ++++ +L P  D  A+   ++  G  N+ +    ++   G++ G+ FV F        
Sbjct: 44  SNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSH----- 98

Query: 184 AVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEE-FEALFT 242
             +A N +L NG  +    +   K   +       N  +++V ++    T+ + FE   +
Sbjct: 99  -TNASNALLKNGLVIPNTGNRILKLNWASFATTPGNEYSVFVGDVAPNVTEAQLFELFIS 157

Query: 243 QFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYE 301
           ++    +A +  D   G  +G+GF+ F       +++ E+       + + V    K   
Sbjct: 158 RYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRP 217

Query: 302 RLQELRKQ------------------------------YEVSRLEKLAKYQGVN---LFV 328
           + Q+++                                Y V +   L +Y   N   +F+
Sbjct: 218 KFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFI 277

Query: 329 KNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITE 383
             L   + +++LR  F PFG+I   K+        KG GFV +     A  AI +
Sbjct: 278 GGLSSLVTEDELRAFFQPFGSIVYVKIPVG-----KGCGFVQYVDRLSAETAIAK 327

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 86/207 (41%), Gaps = 26/207 (12%)

Query: 204 VSKKDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-- 260
           +S    QS   E  S  +N +Y+ ++D    +    A++   G+    +    S G P  
Sbjct: 27  MSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGH 86

Query: 261 -RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLA 319
             G+ F+ F  H +A+ A+ +          L +     +  +L               A
Sbjct: 87  NSGYCFVEFPSHTNASNALLK--------NGLVIPNTGNRILKLN----------WASFA 128

Query: 320 KYQG--VNLFVKNLDDSIDDEKLRDEF-APFGAITSAKVMRDD-AGNSKGFGFVCFSTPE 375
              G   ++FV ++  ++ + +L + F + + +  +AK++ D   G SKG+GFV F    
Sbjct: 129 TTPGNEYSVFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQES 188

Query: 376 EATKAITEKNQQIVAGKPLYVAIAQRK 402
           E  +++ E     + G+ + V+   + 
Sbjct: 189 EQQRSLLEMQGVFLNGRAIRVSTTSKN 215

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 10/94 (10%)

Query: 22  QTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSL 81
           Q  PT T+      D ++ ++++G L   VTE  L   F P GS+  +++          
Sbjct: 259 QQQPTLTQ----YTDPNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKI------PVGK 308

Query: 82  GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMW 115
           G  +V + D  +  TAI K+    I     R+ W
Sbjct: 309 GCGFVQYVDRLSAETAIAKMQGFPIGNSRIRLSW 342

>Scas_635.7
          Length = 581

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 13/175 (7%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAVDAI 188
           +FI  L+       L + FS +GN++  KI  D A G S+GFGF+ FE   S  E V   
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 189 NGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT 248
           +  +L+G+ +          ++S   E +     I+V  I  +   +EFE  F Q+G I 
Sbjct: 258 H--ILDGKVI--------DPKRSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTII 307

Query: 249 SAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYER 302
            A L  D + G+ RGFGF+ + D   A   V +    +FK +++ + RA+ ++ +
Sbjct: 308 DAQLMLDKDTGRSRGFGFVTY-DSGDAVDRVCQNKYIEFKGKQIEIKRAEPRHNQ 361

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 96/193 (49%), Gaps = 23/193 (11%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDEL 281
           +++  ++ ETT++  +  F+++G +    + +D + G+ RGFGF+ FE+  S    VDE+
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSS----VDEV 253

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLR 341
                K+Q +  G+       + + ++       +K  K     +FV  +   +  ++  
Sbjct: 254 ----VKTQHILDGK-------VIDPKRSIPREEQDKTGK-----IFVGGIGTDVRPKEFE 297

Query: 342 DEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           D FA +G I  A++M D D G S+GFGFV + + +   +    K  +   GK + +  A+
Sbjct: 298 DFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKYIEF-KGKQIEIKRAE 356

Query: 401 RKDVRRSQLAQQI 413
            +  +R+  +Q +
Sbjct: 357 PRHNQRAAASQPM 369

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 77/160 (48%), Gaps = 15/160 (9%)

Query: 33  AKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHD 92
           A +   +  +++G L+   TE  L + FS  G+V  +++ +D  T  S G+ ++ F +  
Sbjct: 189 ADISKDNCKMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPS 248

Query: 93  AGRTAIQKLNYTTIKGR---PCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFS 149
           +    ++  +   + G+   P R +     P   +  +G IF+  +   +  K   D F+
Sbjct: 249 SVDEVVKTQH--ILDGKVIDPKRSI-----PREEQDKTGKIFVGGIGTDVRPKEFEDFFA 301

Query: 150 VFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
            +G I+  ++  D + G S+GFGFV     Y + +AVD +
Sbjct: 302 QYGTIIDAQLMLDKDTGRSRGFGFV----TYDSGDAVDRV 337

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
            +LY+G +DP VT+ LLY+LF  +  +S IR  RD I  T  GYA++ F   +     ++
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 100 KLNYT------TIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFG 152
            +N T      T+K R      +   PS   +    +F+KNL   +D  AL   F  FG
Sbjct: 70  VMNNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFG 128

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 77/181 (42%), Gaps = 13/181 (7%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVD 279
           T +Y+ NID   T++    LF Q   I+     RD      +G+ FI F   E A   V 
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 280 ELNDT-DFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDE 338
            +N+T    ++ L V RA       Q   K  E+          G  LFVKNLDD +D  
Sbjct: 70  VMNNTVQLYNRTLKVRRANSNTAASQP-SKHVEI----------GAKLFVKNLDDLVDVA 118

Query: 339 KLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
            L   F  FG  +    +           ++ ++T +++ +A+ + N QIV  + + V  
Sbjct: 119 ALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLNNQIVFNRSISVDY 178

Query: 399 A 399
           A
Sbjct: 179 A 179

>Kwal_23.3985
          Length = 876

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 110/441 (24%), Positives = 176/441 (39%), Gaps = 79/441 (17%)

Query: 25  PTSTESENAKVDTSSASLYVGELDPT-----------VTEALLYDLFSPIGSVSSIRVCR 73
           P STE + +K+DT+    ++ +++ T            TE     LF+P G +  + V  
Sbjct: 307 PESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVAL 366

Query: 74  DAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIK 133
           D  T  S G+AYV F +      A  +L+    +GR   I+  ++  S R        +K
Sbjct: 367 DTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHR---LDEFDLK 423

Query: 134 NLHPAIDNKAL-------HDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186
           NL P    ++L       HDTFS     ++            G   V   +   A +A  
Sbjct: 424 NL-PLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLG---VQKSDLIDATDASA 479

Query: 187 AINGMLLNGQEVYVAPHV-----SKKDRQSKLEEAKS----NFTNIYVKNIDLETTQEEF 237
           A+   L    E +V   V     SK    +K E+ KS    + T + VKN    TT  E 
Sbjct: 480 AVKQAL---AEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSEL 536

Query: 238 EALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQ 297
             LF  FGK+   +L        +    + + D  SA  A  +L+   FK   LY+ +  
Sbjct: 537 ADLFLPFGKLQRLLLP-----PAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGP 591

Query: 298 KK-YER--------LQELRKQY-----------EVSRLEKLAKYQ-----------GVNL 326
           K  + R        + E+  Q            E+ +    +K +            V++
Sbjct: 592 KNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEDDGTDDVVDGPTVSI 651

Query: 327 FVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGNSK-----GFGFVCFSTPEEATKA 380
           FVKNL+ S   ++L ++F  FG    A+V  + D  NS      GFGF  F T E+A   
Sbjct: 652 FVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAV 711

Query: 381 ITEKNQQIVAGKPLYVAIAQR 401
           I   +  ++ G  + + ++ R
Sbjct: 712 IDAMDGAVLDGHRIQLKLSHR 732

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 100/200 (50%), Gaps = 11/200 (5%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT--DEAGNSK----GFGFVHFEEEYSAK 182
           +IF+KNL+ +   K L + F  FG  +  ++ T  D   ++K    GFGF  F+    A 
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242
             +DA++G +L+G  + +     +  + S   ++K     I VKN+  E  +++   LF+
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 243 QFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYER 302
            FG++ S  L +  +   RGF F+ F   + A  A+++L       +RL +  A+++ + 
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829

Query: 303 LQELRKQYEVSRLEKLAKYQ 322
            +E     +++R+ K  + Q
Sbjct: 830 AEE-----QIARMTKKVRSQ 844

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           LF++N+  +  ++  R  FAPFG +    V  D   G SKGF +V F  P +A  A  E 
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 385 NQQIVAGKPLYVAIAQRKDVRR 406
           ++QI  G+ L++   ++K   R
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR 416

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/371 (20%), Positives = 135/371 (36%), Gaps = 68/371 (18%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           D     L V       T + L DLF P G +  +      +   +   A V + D  + R
Sbjct: 516 DRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRL------LLPPAQTIAVVQYRDATSAR 569

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155
            A  KL+Y   K     I++ +       KG  N F +   P  D   + +  +   N+ 
Sbjct: 570 AAFSKLSYKRFKDG---ILYLE-------KGPKNCFSR--EPEGDETMVDEIVAQSTNVK 617

Query: 156 SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEE 215
             +                                    G E+      SK +     + 
Sbjct: 618 EARTT----------------------------------GDEIMQTATASKPEDDGTDDV 643

Query: 216 AKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK------PRGFGFINFE 269
                 +I+VKN++  TT +E    F  FG    A ++   + K        GFGF  F+
Sbjct: 644 VDGPTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFK 703

Query: 270 DHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVK 329
             E A   +D ++       R+          +L+   +Q   S     +K     + VK
Sbjct: 704 TREQALAVIDAMDGAVLDGHRI----------QLKLSHRQGGQSSSSGKSKKGTGKIIVK 753

Query: 330 NLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIV 389
           NL   ++ +++ + F+ FG + S ++ +    +++GF FV F  P+EA  A+ +     +
Sbjct: 754 NLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHL 813

Query: 390 AGKPLYVAIAQ 400
            G+ L +  A+
Sbjct: 814 LGRRLVMQHAE 824

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGA-----------ITSAKVMRDDAGNSKGFGFVCFSTP 374
           + VK +   + ++KL+D F    A           +T  K++++ AG S+ F FV F + 
Sbjct: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63

Query: 375 EEATKAITEKNQQIVAGKPLYVAIAQ 400
           E+A  A+   +Q  +    + V++A+
Sbjct: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 86/187 (45%), Gaps = 4/187 (2%)

Query: 219 NFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKA 277
           N++N +++ N+  +TT E+   LF + G +  A +   S G  RG G + + + +   +A
Sbjct: 4   NYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADI-ITSRGHHRGMGTVEYTNAQDVDEA 62

Query: 278 VDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDD 337
           +   N  DF  + L+V R       + E R++     L +     G  +FV NL  SI  
Sbjct: 63  IRRFNGMDFMHRELFVRRDNPP--PVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISW 120

Query: 338 EKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 397
           + L+D F     +  A V  D  G S+GFG V  +T E    AI   N   + G+ L V 
Sbjct: 121 QTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEVR 180

Query: 398 IAQRKDV 404
             +  DV
Sbjct: 181 EGKGTDV 187

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/335 (19%), Positives = 123/335 (36%), Gaps = 58/335 (17%)

Query: 122 LRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSA 181
           + +  S ++FI NL      + L   F   G+++   I T   G+ +G G V +      
Sbjct: 1   MSRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSR-GHHRGMGTVEYTNAQDV 59

Query: 182 KEAVDAINGMLLNGQEVYV-----APHVSKKDRQSKLEEAKSNFTN---IYVKNIDLETT 233
            EA+   NGM    +E++V      P   +++R+      +        I+V N+    +
Sbjct: 60  DEAIRRFNGMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSIS 119

Query: 234 QEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRL-- 291
            +  + +F +  ++  A +  D++G  RGFG +     E+   A++  N  + + + L  
Sbjct: 120 WQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

Query: 292 ----------------YVGRAQKKYERLQELR--------------------------KQ 309
                           YV +    Y+   E R                          +Q
Sbjct: 180 REGKGTDVGSAGRGDSYVPKQIPSYDYDGEYRGTEVRAELPHSENASVSVSGKASPEYEQ 239

Query: 310 YEVSRLEKLAK-----YQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSK 364
           Y  S +E  +K      +   ++ +N+  +  +  L D F   G +  A +  D  GN  
Sbjct: 240 YTPSDVEFTSKAAPGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPT 299

Query: 365 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 399
           G     F T  +A + I   N     G  L ++ A
Sbjct: 300 GSSVCEFETVADAQECIERLNNYHYGGCDLKMSYA 334

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 67/176 (38%), Gaps = 24/176 (13%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYA-YVNFHDHDAGRTA 97
           S S+++G L    T   L  LF  +G V    +         +G   Y N  D D    A
Sbjct: 6   SNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGHHRGMGTVEYTNAQDVDE---A 62

Query: 98  IQKLNYTTIKGRPCRIMWSQRD-----------------PSLRKKGSGNIFIKNLHPAID 140
           I++ N      R    ++ +RD                 P     G   IF+ NL  +I 
Sbjct: 63  IRRFNGMDFMHRE---LFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSIS 119

Query: 141 NKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQ 196
            + L D F     ++   ++ D  G S+GFG V+     +   A++  NG  L G+
Sbjct: 120 WQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGR 175

>Scas_558.1
          Length = 435

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 102/221 (46%), Gaps = 17/221 (7%)

Query: 214 EEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHE 272
           E+   N+ N I+V N+  + T E+    F+  G++  A +   S+G  RG G + F +  
Sbjct: 97  EKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADII-TSKGHHRGMGTVEFTNSR 155

Query: 273 SAAKAVDELNDTDFKSQRLYVGRAQ-----KKYERLQELRKQYEVSRLEKLAK------- 320
              +A+ + + + F  ++++V +        + ER    R     SR + ++        
Sbjct: 156 DVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQS 215

Query: 321 --YQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEAT 378
              QG  +FV NL  SI+ + L+D F   G +  A V  D AG S+GFG V F T ++  
Sbjct: 216 NMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDME 275

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQM 419
           +AI   N+  V G+ L V      + R   +  Q Q +N M
Sbjct: 276 RAIDRYNRFEVDGRTLDVREGHSNN-RNDDMNIQHQTQNAM 315

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/333 (20%), Positives = 123/333 (36%), Gaps = 60/333 (18%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186
           + +IF+ NL      + L D FS  G ++   I T + G+ +G G V F      +EA+ 
Sbjct: 104 ANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSK-GHHRGMGTVEFTNSRDVEEAIR 162

Query: 187 AINGMLLNGQEVYV---------------------APHVSKKDRQSKLEEAKSNFT---N 222
             +      ++++V                     AP   ++D  S     +SN      
Sbjct: 163 QYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYE 222

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282
           I+V N+      +  + +F + G +  A +E D  G+ RGFG + F   +   +A+D  N
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMERAIDRYN 282

Query: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEV----------------------------SR 314
             +   + L V R      R  ++  Q++                             +R
Sbjct: 283 RFEVDGRTLDV-REGHSNNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSEPASNR 341

Query: 315 LEKLAK------YQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGF 368
                +       +   ++  NL  S     L D F   G + +A++  D  G + G   
Sbjct: 342 TSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAI 401

Query: 369 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
           V F + ++A   I   N+    G  L ++ A+R
Sbjct: 402 VEFISQDDADVCIERLNKYNYGGCDLEISYAKR 434

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 304 QELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNS 363
           +EL   YE    EK+ +    ++FV NL      E LRD F+  G +  A ++    G+ 
Sbjct: 89  RELDSTYE----EKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADII-TSKGHH 143

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           +G G V F+   +  +AI + +      + ++V
Sbjct: 144 RGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFV 176

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 85/169 (50%), Gaps = 11/169 (6%)

Query: 23  TAPTSTESENAKVDTSS--ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS 80
           T     E++  K D S     +++G L+   TE  L + FS  G+V+ +++ RD  T  S
Sbjct: 144 TQQQQQEAKQVKADLSRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRS 203

Query: 81  LGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAID 140
            G+ +++F D  +    ++  +    K     I   + DP+ R + +G IF+  + P + 
Sbjct: 204 RGFGFLSFADASSVDEVVKTQHILDGK----VIDPKESDPTGRARKAGKIFVAGIGPDVR 259

Query: 141 NKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
            K   + FS +G+I+  ++  D + G S+GFGF+     Y + +AVD +
Sbjct: 260 PKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFI----TYDSPDAVDRV 304

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 86/168 (51%), Gaps = 22/168 (13%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKA 277
           +   +++  ++ ETT++     F+++G +T   + RD + G+ RGFGF++F D    A +
Sbjct: 161 DINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFAD----ASS 216

Query: 278 VDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDD 337
           VDE+     K+Q +  G+       + + ++     R  K  K     +FV  +   +  
Sbjct: 217 VDEV----VKTQHILDGK-------VIDPKESDPTGRARKAGK-----IFVAGIGPDVRP 260

Query: 338 EKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           ++  + F+ +G+I  A++M D D G S+GFGF+ + +P+   +    K
Sbjct: 261 KEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNK 308

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           +F+  L+    ++ LR+ F+ +G +T  K+MRD   G S+GFGF+ F+      + +  K
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVV--K 222

Query: 385 NQQIVAGK 392
            Q I+ GK
Sbjct: 223 TQHILDGK 230

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 89/182 (48%), Gaps = 18/182 (9%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAVDAI 188
           +FI  L+     + L D FS +G +   KI  D A G S+GFGF+ FE   S  E V   
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 189 NGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT 248
           +  +L+G+ +     + +        E +     I+V  I  +   +EFE  F+Q+G I 
Sbjct: 248 H--ILDGKVIDPKRAIPR--------EEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSII 297

Query: 249 SAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELR 307
            A L  D + G+ RGFGFI + D   A   V +    +FK +++ + RA+ +     +L+
Sbjct: 298 DAQLMLDKDTGRSRGFGFITY-DTPDAVDRVCQNKFIEFKGKQIEIKRAEPR-----QLQ 351

Query: 308 KQ 309
           KQ
Sbjct: 352 KQ 353

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 108/233 (46%), Gaps = 23/233 (9%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKA 277
           +   +++  ++ ETT+E     F+++G +    + +D+  G+ RGFGF+ FE+    A +
Sbjct: 184 DINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN----ASS 239

Query: 278 VDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDD 337
           VDE+     K+Q +  G+       + + ++       +K  K     +FV  +   +  
Sbjct: 240 VDEV----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGPDVRP 283

Query: 338 EKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           ++  + F+ +G+I  A++M D D G S+GFGF+ + TP+   +    K  +   GK + +
Sbjct: 284 KEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNKFIEF-KGKQIEI 342

Query: 397 AIAQRKDVRRSQLAQQIQARNQMRYQQVTXXXXXXXXGMPGQFMPPMFYGVMP 449
             A+ + +++ +  Q  Q   Q     +          M G F P M  G  P
Sbjct: 343 KRAEPRQLQKQKQPQMTQPMGQNMSNPMQQYQMFQNPMMAGGFNPMMATGFNP 395

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 94/186 (50%), Gaps = 20/186 (10%)

Query: 11  QLEQLK--INDDQQTAPTSTESENAKVDTSS--ASLYVGELDPTVTEALLYDLFSPIGSV 66
           QL+QL+  ++  QQTA +  E +  K D S     +++G L+   TE  L D FS  G+V
Sbjct: 154 QLQQLQQTMSQLQQTA-SQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAV 212

Query: 67  SSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGR---PCRIMWSQRDPSLR 123
           + +++ +D  T  S G+ ++ F +  +    ++  +   + G+   P R +     P   
Sbjct: 213 AEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQH--ILDGKVIDPKRAI-----PREE 265

Query: 124 KKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAK 182
           +  +G IF+  + P +  K   + FS +G+I+  ++  D + G S+GFGF+     Y   
Sbjct: 266 QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFI----TYDTP 321

Query: 183 EAVDAI 188
           +AVD +
Sbjct: 322 DAVDRV 327

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 297 QKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM 356
           Q+   +LQ+   Q+E   ++         +F+  L+    +E LRD F+ +GA+   K+M
Sbjct: 159 QQTMSQLQQTASQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIM 218

Query: 357 RDDA-GNSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
           +D A G S+GFGF+ F       + +  K Q I+ GK
Sbjct: 219 KDTATGRSRGFGFLTFENASSVDEVV--KTQHILDGK 253

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 89/173 (51%), Gaps = 9/173 (5%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD----EAGN--SKGFGFVHFEEEYSAK 182
           +IFIKNL+ +  N+ L D F VF   +  ++ T       G   S GFGFV F  +  A 
Sbjct: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723

Query: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTN--IYVKNIDLETTQEEFEAL 240
             + A++G +++G ++ +     ++  QS   + KSN  +  I VKN+  E T+++   L
Sbjct: 724 AVIAAMDGTVIDGHKIQLKLS-HRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFEL 782

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
           F  FG++ S  + +  +   RGF F+ F   + A  A+D+L+      +RL +
Sbjct: 783 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 112/460 (24%), Positives = 176/460 (38%), Gaps = 88/460 (19%)

Query: 9   AEQLEQLKINDDQQ---TAPTSTESENA--KVDTSSASLYVGELDPTVTEALLYDLFSPI 63
            EQ E L    ++Q     P  T+ E A  K++  +  L++  +  T  E     LFSP 
Sbjct: 310 TEQNESLDTKKEEQPERAVPQKTDEELAIEKIN-QTGRLFLRNILYTSKEEDFRKLFSPF 368

Query: 64  GSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLR 123
           G +  + V  D  T  S G+AYV F D      A  +L+    +GR   I+  +   S R
Sbjct: 369 GELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428

Query: 124 KKGSGNIFIKNLHPAIDNKAL-------HDTFSVFGNILSCKIATDEAGNSKGFGFVHFE 176
                   +KN+ P    K L         TFS + ++   + A          G V  +
Sbjct: 429 ---LDEFDLKNM-PLKKQKELKRKAAASRQTFS-WNSLYMNQDAV--------LGSVAAK 475

Query: 177 EEYSAKEAVDAINGMLLNGQ---EVYVAPHV-----SKKDRQSKLEEAKSNFTN------ 222
                 + +DA N      Q   E +V   V     SK    +K  + KS  TN      
Sbjct: 476 LGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS--TNQRDDKV 533

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281
           I VKN    TT+EE   +F  +GK+   ++       P G    + F D  SA  A  +L
Sbjct: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLM------PPAGTIAIVQFRDTTSARAAFTKL 587

Query: 282 NDTDFKSQRLYVGRAQKK---------------------------------YERLQELRK 308
           +   FK   +Y+ R  K                                   E  +++ +
Sbjct: 588 SYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTE 647

Query: 309 QYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGN----- 362
               +  E +     V++F+KNL+ S  ++ L D F  F     A+V  + D  +     
Sbjct: 648 GSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTL 707

Query: 363 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
           S GFGFV F T E+A   I   +  ++ G  + + ++ R+
Sbjct: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ 747

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 88/198 (44%), Gaps = 13/198 (6%)

Query: 15  LKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGS--VSSIRVC 72
           ++ N D     ++   E+  +D  + S+++  L+ + T   L D F       V+ ++  
Sbjct: 639 MEANKDVTEGSSNAHDEDV-IDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTK 697

Query: 73  RDAITK---TSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLR------ 123
            D   +    S+G+ +V F   +     I  ++ T I G   ++  S R  S        
Sbjct: 698 PDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTK 757

Query: 124 -KKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAK 182
             K SG I +KNL      K + + F+ FG + S ++      +++GF FV F     A+
Sbjct: 758 SNKKSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAE 817

Query: 183 EAVDAINGMLLNGQEVYV 200
            A+D ++G+ L G+ + +
Sbjct: 818 NAMDQLHGVHLLGRRLVM 835

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           LF++N+  +  +E  R  F+PFG +    V  D   G SKGF +V F   + A  A  E 
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 385 NQQIVAGKPLYVAIAQRKDVRR 406
           ++QI  G+ L++   + K   R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHR 428

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 78/182 (42%), Gaps = 15/182 (8%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG------FGFINFEDHESA 274
            +I++KN++  TT +     F  F     A ++   + K +G      FGF+ F   E A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDS 334
              +  ++ T     ++ +  +          R+  +    +  +  +   + VKNL   
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSH---------RQASQSGNTKTKSNKKSGKIIVKNLPFE 773

Query: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
              + + + F  FG + S +V +    +++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833

Query: 395 YV 396
            +
Sbjct: 834 VM 835

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 11/101 (10%)

Query: 101 LNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160
           ++   +KG P  +     D +LR+  +  +  K+ H A+ N +  D       I   KI 
Sbjct: 1   MSRIIVKGLPVYLT----DDNLREHFTKRLRQKHSHQAV-NGSGPDL------ITDVKIL 49

Query: 161 TDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
            D  G S+ FGF+ +  E  A +AV+  NG  +N  ++ V+
Sbjct: 50  RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 350 ITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           IT  K++RD  G S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 116/234 (49%), Gaps = 37/234 (15%)

Query: 194 NGQEVYVAPHVSKKDRQSK----LEEA-----KSNFTN----IYVKNIDLETTQEEFEAL 240
           NG  V   P VS + + S+    +EEA     K++ +     +++  ++ ETT++     
Sbjct: 90  NGSNVSSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREY 149

Query: 241 FTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299
           F+++G +    + +D + G+ RGFGF++F+    A  +VDE+     K+Q +  G+    
Sbjct: 150 FSKYGNVVELKIMKDPNTGRSRGFGFLSFD----APSSVDEV----VKTQHILDGK---- 197

Query: 300 YERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD- 358
              + + ++       +K  K     +FV  L   +  ++  + F+ +G I  A++M D 
Sbjct: 198 ---VIDPKRAIPREEQDKTGK-----IFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDK 249

Query: 359 DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQ 412
           D G S+GFGFV + +P+ A K + E   +   GK + +  A+ +  ++ Q  QQ
Sbjct: 250 DTGRSRGFGFVTYDSPDAAEK-VCESRYREFKGKQIEIKRAEPRHQQK-QAGQQ 301

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 87/183 (47%), Gaps = 13/183 (7%)

Query: 11  QLEQLKINDDQQTAPTSTESENAKVDTS--SASLYVGELDPTVTEALLYDLFSPIGSVSS 68
           Q+     N +Q+ +         K D S  +  +++G L+   TE  L + FS  G+V  
Sbjct: 99  QVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREYFSKYGNVVE 158

Query: 69  IRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGR---PCRIMWSQRDPSLRKK 125
           +++ +D  T  S G+ +++F D  +    + K  +  + G+   P R +     P   + 
Sbjct: 159 LKIMKDPNTGRSRGFGFLSF-DAPSSVDEVVKTQH-ILDGKVIDPKRAI-----PREEQD 211

Query: 126 GSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEA 184
            +G IF+  L   +  K   + FS +G I+  ++  D + G S+GFGFV ++   +A++ 
Sbjct: 212 KTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAAEKV 271

Query: 185 VDA 187
            ++
Sbjct: 272 CES 274

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 88/196 (44%), Gaps = 12/196 (6%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           +   ++V+NI  + T  E    F+QF  I  AV+ +D+ G  RGFGF++F        A+
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAAL 73

Query: 279 DELNDTDFKSQ--RLYVGRAQKKYERLQELRKQYEVSRLEK--------LAKYQGV-NLF 327
           D+   T FK +  R+ V + +++ ++  E   Q      EK         A  +G   L 
Sbjct: 74  DKGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLI 133

Query: 328 VKNLDDSIDD-EKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQ 386
           ++N+  S  D  KL+  F  FG +  A + R   G   GF FV         KAI E   
Sbjct: 134 IRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKG 193

Query: 387 QIVAGKPLYVAIAQRK 402
             + G+ + V  A +K
Sbjct: 194 LKIDGREVAVDFAVQK 209

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++N+     +  L D FS F  I    I  D AG+S+GFGFV F  E   + A+D   
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFT----------------------NIYVKN 227
                G+ + V     +++R  K +EA++  +                       + ++N
Sbjct: 78  KTQFKGRLLRVDV-AKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIRN 136

Query: 228 IDLETTQ-EEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDEL 281
           +        + + +F +FG +  A + R ++GK  GF F+  +   +  KA++E 
Sbjct: 137 MPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEEC 191

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (58%), Gaps = 2/90 (2%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKN 385
           LFV+N+     D +L D F+ F  I  A +++D+AG+S+GFGFV F+   +   A+ +  
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 386 QQIVAGKPLYVAIAQRKDVRRSQLAQQIQA 415
           +    G+ L V +A+R++  RS+   + +A
Sbjct: 78  KTQFKGRLLRVDVAKRRE--RSKKGDEAEA 105

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 82/205 (40%), Gaps = 33/205 (16%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +L+V  +    T+A L D FS    +    + +D    +S G+ +V+F      + A+ K
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAG-SSRGFGFVSFAVESDTQAALDK 75

Query: 101 LNYTTIKGRPCRIMWSQRDPSLRK---------------------------KGSGNIFIK 133
              T  KGR  R+  ++R    +K                           +G   + I+
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIR 135

Query: 134 NL-HPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGML 192
           N+     D   L   F  FG +    I     G   GF FV  ++  + ++A++   G+ 
Sbjct: 136 NMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLK 195

Query: 193 LNGQEVYVAPHVSKKDRQSKLEEAK 217
           ++G+EV V   V K    SK E+ K
Sbjct: 196 IDGREVAVDFAVQK----SKWEDYK 216

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 217 KSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHES 273
           + NF+ ++V+N+  + TQE  EA F++FG +  A+  +D E G P+G  F+ F+D  +
Sbjct: 285 RENFS-VFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDEST 341

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 85/171 (49%), Gaps = 7/171 (4%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSK------GFGFVHFEEEYSAK 182
           +IFIKNL+    ++ L D F VF   +  ++ T      K      GFGFV F  +  A 
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242
             + A++G +++G ++ +     + +  S+ E+ K+    I VKN+  E T+++   LF 
Sbjct: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EKKKAKNGKIIVKNLPFEATRKDVFELFN 759

Query: 243 QFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
            FG++ S  + +  +   RGF F+ F   + A  A+D+L       +RL +
Sbjct: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 100/227 (44%), Gaps = 24/227 (10%)

Query: 35  VDTSSASLYVGELDPTVTEALLYDLFSPIGS--VSSIRVCRDAITKT---SLGYAYVNFH 89
           VD  + S+++  L+   T   L D F       V+ ++   D   K    S+G+ +V F 
Sbjct: 635 VDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFR 694

Query: 90  DHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSL-----RKKGSGNIFIKNLHPAIDNKAL 144
             +     I  ++ T I G   ++  S R  +      +K  +G I +KNL      K +
Sbjct: 695 TKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKDV 754

Query: 145 HDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAP-- 202
            + F+ FG + S ++      +++GF FV F     A+ A+D + G+ L G+ + + P  
Sbjct: 755 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPAE 814

Query: 203 -----------HVSKKDR-QSKLEEAKSNFTNIYVKNIDLETTQEEF 237
                       ++KK R Q+ + E  +   N   + +D+E  +EEF
Sbjct: 815 QEAANAEEELERMTKKVRKQAAVSEIAAMTRNAGKRKLDMEDEEEEF 861

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 3/91 (3%)

Query: 318 LAKYQGV-NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPE 375
           +AK Q    LF++N+  S  ++  +  F+P+G +    V  D   GNSKGF +V F+ PE
Sbjct: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377

Query: 376 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 405
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 74/337 (21%), Positives = 133/337 (39%), Gaps = 70/337 (20%)

Query: 51  VTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRP 110
            T   L +LF P G +  +      +   +   A V F D  +GR+A  KL +   KG  
Sbjct: 523 TTREELGELFVPFGKLERL------LMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGT- 575

Query: 111 CRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGF 170
             +++ ++ P                         D F+        K A++E       
Sbjct: 576 --VIYLEKGP------------------------KDCFT--------KAASNEDA----- 596

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDL 230
             +  +EE SAKEA  +   +L   + V       K+D   ++ +  +   +I++KN++ 
Sbjct: 597 --MEHDEEKSAKEAGPSSADLL---ESVSSKKTEDKEDEDEQVVDGPT--VSIFIKNLNF 649

Query: 231 ETTQEEFEALFTQFGKITSAVLERDSEGKPR------GFGFINFEDHESAAKAVDELNDT 284
           +TT ++    F  F     A ++   + K +      GFGF+ F   E A   +  ++ T
Sbjct: 650 KTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGT 709

Query: 285 DFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEF 344
                ++          +L+   +Q      EK     G  + VKNL      + + + F
Sbjct: 710 VIDGHKI----------QLKLSHRQGNAGSQEKKKAKNG-KIIVKNLPFEATRKDVFELF 758

Query: 345 APFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
             FG + S +V +    +++GF FV F  P+EA  A+
Sbjct: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAM 795

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 43/217 (19%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281
           I VKN    TT+EE   LF  FGK+   ++       P G    + F D  S   A  +L
Sbjct: 514 ILVKNFPFGTTREELGELFVPFGKLERLLM------PPAGTIAIVQFRDIASGRSAFSKL 567

Query: 282 NDTDFKSQRLYVGRAQKK------------------------------YERLQELRKQYE 311
               FK   +Y+ +  K                                E +   + + +
Sbjct: 568 AFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADLLESVSSKKTEDK 627

Query: 312 VSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM------RDDAGNSKG 365
               E++     V++F+KNL+     ++L D F  F     A+V       + +   S G
Sbjct: 628 EDEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMG 687

Query: 366 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
           FGFV F T E+AT  I+  +  ++ G  + + ++ R+
Sbjct: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 55/99 (55%), Gaps = 9/99 (9%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           ++++NI   +T+++F+ LF+ +G++    +  D+  G  +GF ++ F   E A +A  EL
Sbjct: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386

Query: 282 NDTDFKSQRLYVGRA-QKKYERLQE-------LRKQYEV 312
           +   F+ + L++  A + K  RL E       L+KQ E+
Sbjct: 387 DKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQREL 425

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 1/113 (0%)

Query: 2   SDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFS 61
           ++V DK +E+  Q    ++ Q      E   AK+   +  L++  +  + TE     LFS
Sbjct: 288 TNVQDKESEENSQATPAEELQEEIPDEEQAIAKI-QKTGRLFLRNILYSSTEDDFKKLFS 346

Query: 62  PIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIM 114
           P G +  + V  D  T  S G+AYV F   +    A  +L+    +GR   I+
Sbjct: 347 PYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHIL 399

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAV 185
           +G +F++N+  +         FS +G +    +A D   GNSKGF +V F +   A +A 
Sbjct: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383

Query: 186 DAINGMLLNGQEVYVAPHVSKKDRQ 210
             ++  +  G+ +++      KD +
Sbjct: 384 IELDKQIFQGRLLHILAADEMKDHR 408

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 145 HDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEV------ 198
           H T +V G I   +I  +  G S+ F F+ ++ E  A +AV+  +G  +   ++      
Sbjct: 30  HATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89

Query: 199 -YVAPHVSKKDRQSKLE 214
            +  P V K  ++ K E
Sbjct: 90  SFADPRVPKSMKEKKRE 106

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 92/218 (42%), Gaps = 51/218 (23%)

Query: 128 GNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSK---GFGFVHFEEEYSAKEA 184
           GN++I+ +   +    L   FS FG +LS KI  D  GN++   G+GF+ +     A   
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIID--GNTRESLGYGFISYPLGSQAARC 274

Query: 185 VDAINGMLLNGQEVYVAPHVSKKDRQS-KLEEAKSN-----FTNIYVKNIDLETTQEEF- 237
           +  +NG L+NG  +++  HV +K+R+   L+  K +     F  ++V N+  E       
Sbjct: 275 IKELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLI 334

Query: 238 --EALFTQFGKITSAV------------------------------------LERDSEGK 259
             E +F +F  I   V                                     +  +E  
Sbjct: 335 TPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDS 394

Query: 260 P-RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRA 296
           P +G+GFI F  H+ A KA+D+LN   +    L V +A
Sbjct: 395 PLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 17/98 (17%)

Query: 322 QGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR--------------DDA--GNSKG 365
           Q  NL+VK++  S  DE L D ++ +G I SAK++               +D   G S+G
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 366 FGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 402
           +GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 657 YGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSK---GFGFVCFSTPEEATKAI 381
           NL+++ +   +  + L   F+ FG + S K++ D  GN++   G+GF+ +    +A + I
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIID--GNTRESLGYGFISYPLGSQAARCI 275

Query: 382 TEKNQQIVAGKPLYVAI-AQRKDVRRSQLAQQIQARNQMRYQQV 424
            E N  ++ G PL++    +RK+  R  L    +  +  R++ V
Sbjct: 276 KELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGV 319

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 89/220 (40%), Gaps = 53/220 (24%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPR-GFGFINFEDHESAAKAVDE 280
           N+Y++ I  + + ++   +F++FG + S  +  D   +   G+GFI++     AA+ + E
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 281 LNDTDFKSQRLYVGRAQKKYER----LQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSID 336
           LN        L++    ++ ER    L  L++  +  R      ++GV  FV NL    +
Sbjct: 278 LNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDER------FRGV--FVGNLPTEYE 329

Query: 337 D------EKLRDEFA----PFGAITSAKVMRDDAGNS----------------------- 363
           D      E++ ++F     P   ++     R+   N                        
Sbjct: 330 DGTLITPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDS 389

Query: 364 -------KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
                  KG+GF+ FST + A KAI + N     G  L V
Sbjct: 390 QNEDSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVV 429

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 17/96 (17%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSA----------------VLERDSEGKPRGFG 264
           +N+YVK+I L    E+    ++Q+G+I SA                 LE    G  RG+G
Sbjct: 599 SNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYG 658

Query: 265 FINFEDHESAAKAVDELNDTDFKSQR-LYVGRAQKK 299
           F+ F++   A++A+   +     +   LYV  AQK+
Sbjct: 659 FVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%)

Query: 30  SENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89
           S+N    T   +LY+  +   ++   L  +FS  G+V S+++  D  T+ SLGY ++++ 
Sbjct: 207 SQNPHALTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYP 266

Query: 90  DHDAGRTAIQKLNYTTIKGRPCRIMW 115
                   I++LN   + G P  I +
Sbjct: 267 LGSQAARCIKELNGNLMNGSPLFINY 292

 Score = 36.2 bits (82), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 16/83 (19%)

Query: 123 RKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT-----DEAGNSK--------- 168
           R +   N+++K++  +  ++ L+D +S +G I+S KI T     +E G SK         
Sbjct: 594 RDQQESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGT 653

Query: 169 --GFGFVHFEEEYSAKEAVDAIN 189
             G+GFV F+    A  A+ A +
Sbjct: 654 SRGYGFVCFKNPLDASRAMMATD 676

>Scas_645.14
          Length = 717

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 95/221 (42%), Gaps = 35/221 (15%)

Query: 111 CRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSK-- 168
           C   WS           GNIFI  ++  ID   +   F  FG+ILS K+  D   NS   
Sbjct: 164 CIEKWSISINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTN 223

Query: 169 --------GFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQ----SKLEEA 216
                   G+GF+ F     A E ++  NG ++ G ++++  HV +K+R+    S ++E 
Sbjct: 224 NSTSSNPIGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKEN 283

Query: 217 KSN--FTNIYVKNIDLETTQEEFEALFTQFGKITSAVL------------------ERDS 256
             +  F  I++ N+    T    + +  +     S VL                    ++
Sbjct: 284 NDDEKFKCIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINN 343

Query: 257 EGKP-RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRA 296
           +  P +G+GF+N   HE A K +  L+  ++K  RL V +A
Sbjct: 344 KSSPLKGYGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 11/98 (11%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSK----------GFGFVCFSTP 374
           N+F+  ++  ID+ K+R  F  FG+I S K+  D   NS           G+GF+ F   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 375 EEATKAITEKNQQIVAGKPLYVAI-AQRKDVRRSQLAQ 411
            +A++ I E N +I+ G  L++    +RK+  R Q + 
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSH 279

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 104/238 (43%), Gaps = 38/238 (15%)

Query: 175 FEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQ 234
           F  E   ++  D+I+   L+ +E    P+  +K   S  + A ++  NI++  I+ +  +
Sbjct: 136 FHNEAKLEKCRDSID-TFLHSKEDPSFPNCIEKWSISINKHALTHPGNIFIGGINHKIDE 194

Query: 235 EEFEALFTQFGKITSAVLERD----------SEGKPRGFGFINFEDHESAAKAVDELNDT 284
            +  ALF +FG I S  L  D          +   P G+GFI+F     A++ ++E N  
Sbjct: 195 SKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGSQASECINEFNGK 254

Query: 285 DFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDD------- 337
             +  +L++    ++ ER  E  +   +       K++ +  F+ NL  ++ D       
Sbjct: 255 IIEGTKLFLNYHVERKER--ERIQWSHIKENNDDEKFKCI--FIGNLPTTLTDLTIDLIL 310

Query: 338 EKLRDEFAPFGAITSAKVMR--------------DDAGNSKGFGFVCFSTPEEATKAI 381
           +K++ E +    + S +++               + +   KG+GFV   + E+A K I
Sbjct: 311 DKIKTELS--EVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQALKVI 366

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 50/131 (38%)

Query: 322 QGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM------------------------- 356
           Q  NL+VK++  S  D++L D F+ FG I S+KV+                         
Sbjct: 522 QESNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQE 581

Query: 357 ---RDD---------------------AGNSKGFGFVCFSTPEEATKAITEKNQQIVA-G 391
              ++D                      G S+G+GFVCF  P +A++AI   +  I++  
Sbjct: 582 HNDKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPN 641

Query: 392 KPLYVAIAQRK 402
             L V+ AQ++
Sbjct: 642 NILNVSFAQKR 652

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/211 (18%), Positives = 78/211 (36%), Gaps = 40/211 (18%)

Query: 30  SENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS--------- 80
           S N    T   ++++G ++  + E+ +  LF   GS+ SI++  D +  ++         
Sbjct: 171 SINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNP 230

Query: 81  LGYAYVNFHDHDAGRTAIQKLNYTTIKGRPC------------RIMWSQRDPSLRKKGSG 128
           +GY +++F         I + N   I+G               RI WS    +   +   
Sbjct: 231 IGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFK 290

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT-------------------DEAGNSKG 169
            IFI NL   + +  +          LS  + +                   +++   KG
Sbjct: 291 CIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKG 350

Query: 170 FGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           +GFV+      A + +  ++G+   G  + V
Sbjct: 351 YGFVNLGSHEQALKVIQTLDGLEWKGNRLVV 381

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSA 250
           +N+YVK+I L    +E    F+QFG I S+
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISS 553

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 164 AGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEV 198
            G S+G+GFV FE    A  A+ A +G++++   +
Sbjct: 609 VGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

>Scas_665.4
          Length = 219

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 15/136 (11%)

Query: 32  NAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDH 91
           NA ++    ++YVG +DP VT+  LY+LF  +  +S +R  +D I +   GYA++ F+  
Sbjct: 2   NASLNNPETTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTA 61

Query: 92  DAGRTAIQKLNYTT-IKGRPCRIMWSQRDPSLRKKGS--------------GNIFIKNLH 136
              +  IQ +N T  +  R  ++  S ++P+    G+                +F+KNL 
Sbjct: 62  KDVQYVIQVMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLD 121

Query: 137 PAIDNKALHDTFSVFG 152
            +I+N  L   F  FG
Sbjct: 122 ESIENPQLIKLFQKFG 137

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 83/195 (42%), Gaps = 24/195 (12%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK-PRGFGFINFEDHESAAKAVD 279
           T +YV NID + T+E+   LF Q   I+     +D   +  +G+ FI F   +     + 
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 280 ELNDTDFKSQRLYVGRAQKKYERLQELRK--QYEVSRLEKLAKYQGVN---------LFV 328
            +N+T               Y+R  ++R+  Q   S +      +  N         LFV
Sbjct: 70  VMNNT------------VALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFV 117

Query: 329 KNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQI 388
           KNLD+SI++ +L   F  FG +     +   +       ++ F   E +  AI + N ++
Sbjct: 118 KNLDESIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRCAYIYFKFYENSDMAIAKLNNEL 177

Query: 389 VAGKPLYVAIAQRKD 403
           +  K + V  A +++
Sbjct: 178 IVNKRINVDYAFKEN 192

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 91/179 (50%), Gaps = 23/179 (12%)

Query: 208 DRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFI 266
           DR  K + +K +   +++  ++ ETT++     F+++GK+    + +D + G+ RGFGF+
Sbjct: 110 DRTVKADLSKDS-CKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFL 168

Query: 267 NFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNL 326
            FE    +A +VDE+     K+Q +  G+       + + ++       +K  K     +
Sbjct: 169 TFE----SASSVDEV----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----I 208

Query: 327 FVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           FV  +   +  ++  + FA +G I  A++M D D G S+GFGF+ + TP+   K    K
Sbjct: 209 FVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNK 267

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 79/171 (46%), Gaps = 15/171 (8%)

Query: 22  QTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSL 81
           Q+  T   +  A +   S  +++G L+   TE  L D FS  G V  +++ +D  T  S 
Sbjct: 104 QSGNTGDRTVKADLSKDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSR 163

Query: 82  GYAYVNFHDHDAGRTAIQKLNYTTIKGR---PCRIMWSQRDPSLRKKGSGNIFIKNLHPA 138
           G+ ++ F    +    ++  +   + G+   P R +     P   +  +G IF+  + P 
Sbjct: 164 GFGFLTFESASSVDEVVKTQH--ILDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPD 216

Query: 139 IDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
           +  K   + F+ +G I+  ++  D + G S+GFGF+     Y   +AVD +
Sbjct: 217 VRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFIT----YDTPDAVDKV 263

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 112/302 (37%), Gaps = 49/302 (16%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSL--GYAYVNFHDHDAGRTAI 98
           S+++G L    T   L+D F   G V    +  D IT      G   V F   +    AI
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEV----LRADIITSRGRHRGMGTVEFTSPEGVDNAI 175

Query: 99  QKLNYTTIKGRPCRIMWS-------QRDPSLRKKGSG----------NIFIKNLHPAIDN 141
           +  N     GRP  +          +  P +R++ +            +FI NL  ++  
Sbjct: 176 RDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTW 235

Query: 142 KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQ----- 196
           + L D F   G+++   I  D  G S+GFG V +  +     A++  NG  ++G+     
Sbjct: 236 QTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVR 295

Query: 197 ---------------------EVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQE 235
                                E+ + P          +       T IY  N+ L T   
Sbjct: 296 EGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTATG 355

Query: 236 EFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
           +   LF   G++  A L+ D  G P G   I +E+ E A   +  LN+ ++    L +  
Sbjct: 356 DLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDISY 415

Query: 296 AQ 297
           A+
Sbjct: 416 AK 417

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 89/197 (45%), Gaps = 3/197 (1%)

Query: 202 PHVSKKDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP 260
           P ++++      E+   N+ N I++ N+  + T E+    F Q G++  A +   S G+ 
Sbjct: 99  PMMAREMEPPYEEKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADI-ITSRGRH 157

Query: 261 RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYE-VSRLEKLA 319
           RG G + F   E    A+ + N  +F  + L+V +     E ++ L    E  +      
Sbjct: 158 RGMGTVEFTSPEGVDNAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEG 217

Query: 320 KYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATK 379
           +     +F+ NL  S+  + L+D F   G +  A +  D  G S+GFG V + T EE   
Sbjct: 218 RPPMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFN 277

Query: 380 AITEKNQQIVAGKPLYV 396
           AI   N   V G+ L V
Sbjct: 278 AIERFNGFDVDGRILQV 294

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 117/298 (39%), Gaps = 42/298 (14%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHDAGRT 96
           S S++VG L    T   L + FS IG V    V  D IT      G   V F + D    
Sbjct: 135 SNSIFVGNLTYDSTPEDLTEFFSQIGKV----VRADIITSRGHHRGMGTVEFTNSDDVDR 190

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDPS-------------LR-KKGSGNIFIKNLHPAIDNK 142
           AI++ +      R   +      PS             LR  + +  + +KNL  +++ +
Sbjct: 191 AIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNWQ 250

Query: 143 ALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAP 202
           AL D F   GN+    +  D  G S G G V F +      A++  NG  + G  + V  
Sbjct: 251 ALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKS 310

Query: 203 HVSKKDRQ-----------SKLEEAKSNFTN-----------IYVKNIDLETTQEEFEAL 240
             S  +             S + E    FT            IY  N+   T + +   L
Sbjct: 311 KESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNRLIYCSNLPFSTAKSDLYDL 370

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQK 298
           F   GK+ +A L  DS+G P G   + +++ + A   ++ LN+ ++    L +  A++
Sbjct: 371 FETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVCIERLNNYNYGGCDLDISYAKR 428

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 88/184 (47%), Gaps = 4/184 (2%)

Query: 214 EEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHE 272
           E+   N++N I+V N+  ++T E+    F+Q GK+  A +   S G  RG G + F + +
Sbjct: 128 EKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT-SRGHHRGMGTVEFTNSD 186

Query: 273 SAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLD 332
              +A+ + +   F  ++++V   Q        ++++  + R E     +   + VKNL 
Sbjct: 187 DVDRAIRQYDGAFFMDRKIFV--RQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLP 244

Query: 333 DSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
            S++ + L+D F   G +  A V  D  G S G G V F   ++  +AI + N   + G 
Sbjct: 245 ASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGN 304

Query: 393 PLYV 396
            L V
Sbjct: 305 VLDV 308

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 304 QELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNS 363
           +EL   YE    EK+ +    ++FV NL      E L + F+  G +  A ++    G+ 
Sbjct: 120 RELDSTYE----EKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT-SRGHH 174

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA---------IAQRKDVRRSQLAQQ 412
           +G G V F+  ++  +AI + +      + ++V          I +RK + R +L   
Sbjct: 175 RGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHN 232

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 93/202 (46%), Gaps = 18/202 (8%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           +   ++V+ +  E+T EEF   F+QF  I  AV+ +D EG  RGFGF++F   +    A+
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTAL 72

Query: 279 DELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVS--------RLEKLAKYQGVN----- 325
           ++   T F  + L +  A K+ ER +  +   EVS        + E+ +K +  N     
Sbjct: 73  NQARKTKFMGRLLRIDIA-KRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKG 131

Query: 326 ---LFVKNLDDSIDD-EKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
              L ++N+  S  D  KL+  F  +G +  A + R   G   GF FV  +       AI
Sbjct: 132 KPKLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAI 191

Query: 382 TEKNQQIVAGKPLYVAIAQRKD 403
                  + G+ + V  A +K+
Sbjct: 192 EGTKDLKIDGRKVAVDFAIQKN 213

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 54/96 (56%), Gaps = 3/96 (3%)

Query: 316 EKLAKYQGVNL---FVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFS 372
           +K+ K +G++L   FV+ +     DE+  + F+ F  I  A +++D  G S+GFGFV F+
Sbjct: 4   KKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFA 63

Query: 373 TPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQ 408
             ++   A+ +  +    G+ L + IA+R++  R +
Sbjct: 64  VEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGK 99

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 64/177 (36%), Gaps = 36/177 (20%)

Query: 56  LYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMW 115
            +  FSPI     ++    A    S G+ +V+F   D  +TA+ +   T   GR  RI  
Sbjct: 34  FFSQFSPIKHAVIVKDGEGA----SRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDI 89

Query: 116 SQRDPSLR-------------------------------KKGSGNIFIKNL-HPAIDNKA 143
           ++R    R                                KG   + I+N+     D   
Sbjct: 90  AKRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPTK 149

Query: 144 LHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           L   F ++G ++   I     G   GF FV      + K A++    + ++G++V V
Sbjct: 150 LKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAV 206

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 67/172 (38%), Gaps = 26/172 (15%)

Query: 148 FSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN-----GMLL--------- 193
           FS F  I    I  D  G S+GFGFV F  E   K A++        G LL         
Sbjct: 35  FSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRRE 94

Query: 194 ------NGQEVYVAPHVS--KKDRQSKLEEAKSNFT---NIYVKNIDLETTQ-EEFEALF 241
                 +  EV  AP V   K + +SK E+          + ++N+        + + +F
Sbjct: 95  RSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPTKLKKIF 154

Query: 242 TQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
             +G +  A + R  +G+  GF F+      +   A++   D     +++ V
Sbjct: 155 GLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAV 206

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 256 SEGKPRGFGFINFEDHESAAKAVDELN 282
           S G+ RG+GF+ F DH++A   +  LN
Sbjct: 554 SGGRSRGYGFVEFRDHKAALMCLRWLN 580

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 217 KSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHES 273
           K +F+ I+V+N+  + TQE  E  F  FG +  A+   D E G  +G  F+ F   ++
Sbjct: 293 KEDFS-IFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRSEDA 349

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 84/169 (49%), Gaps = 17/169 (10%)

Query: 26  TSTESENAKVDTS--SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           T T+ E +K D S  S  +++G L+   TE  L + F   G+V+ +++ +D  T  S G+
Sbjct: 143 TQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGF 202

Query: 84  AYVNFHDHDAGRTAIQKLNYTTIKGR---PCRIMWSQRDPSLRKKGSGNIFIKNLHPAID 140
            +++F    +    ++  +   + G+   P R +     P   +  +G IF+  + P + 
Sbjct: 203 GFLSFEKPSSVDEVVKTQH--ILDGKVIDPKRAI-----PRDEQDKTGKIFVGGIGPDVR 255

Query: 141 NKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
            K   + FS +G I+  ++  D + G S+GFGFV     Y + +AVD +
Sbjct: 256 PKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFV----TYDSADAVDRV 300

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 90/181 (49%), Gaps = 26/181 (14%)

Query: 210 QSKLEEAKSNFTN----IYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFG 264
           Q+K E +K++ +     +++  ++ +TT++     F ++G +T   + +D + G+ RGFG
Sbjct: 144 QTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFG 203

Query: 265 FINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGV 324
           F++FE       +VDE+     K+Q +  G       ++ + ++       +K  K    
Sbjct: 204 FLSFE----KPSSVDEV----VKTQHILDG-------KVIDPKRAIPRDEQDKTGK---- 244

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITE 383
            +FV  +   +  ++  + F+ +G I  A++M D D G S+GFGFV + + +   +    
Sbjct: 245 -IFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQN 303

Query: 384 K 384
           K
Sbjct: 304 K 304

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 322 QGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA-GNSKGFGFVCFSTPEEATKA 380
           +   +F+  L+    ++ LR+ F  +G +T  K+M+D A G S+GFGF+ F  P    + 
Sbjct: 157 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV 216

Query: 381 ITEKNQQIVAGK 392
           +  K Q I+ GK
Sbjct: 217 V--KTQHILDGK 226

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 170/413 (41%), Gaps = 63/413 (15%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           ++  L++  +    TE     LFSP G +  + V  D  T  S G+AYV F D +    A
Sbjct: 299 ATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANA 358

Query: 98  IQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKAL-------HDTFS- 149
             +L+    +GR   I+ +    + R        +KNL P    + L         TFS 
Sbjct: 359 YIELDKQIFQGRLLHILPADAKKTHR---LDEFDLKNL-PLKKQRELKRKATAAQQTFSW 414

Query: 150 --VFGN---ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHV 204
             +F N   +LS   A  + G  K    +  E   SA +   A   ++ + ++ + A  V
Sbjct: 415 NSLFMNQDAVLSSVAA--KLGMEKS-QLIDPENSGSAVKQALAEAHVIGDVRKYFEARGV 471

Query: 205 --SKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG 262
             ++ ++  K+ E       I VKN    TT+EE   LF  FGKI   ++       P G
Sbjct: 472 DLTQFEKFKKVTERDDRI--ILVKNFPHGTTREELAELFLPFGKIERMLM------PPSG 523

Query: 263 -FGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY-----------------ERLQ 304
               I + D  +A  A  +L+   FK+  LY+ +  K                   E ++
Sbjct: 524 TIAIIQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPRGDELLEGDAAPEDVK 583

Query: 305 ELRKQYE--VSRLEKLAKYQG-------VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKV 355
           E++K  E  +    K    +        V++FVKNL+ S    +L ++F PF     A+V
Sbjct: 584 EIKKSVEDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQV 643

Query: 356 ------MRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
                    D   S GFGF+ F T E+A   I   +  ++ G  + + I+ ++
Sbjct: 644 KTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQ 696

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 98/205 (47%), Gaps = 15/205 (7%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT------DEAGNSKGFGFVHFEEEYSAK 182
           +IF+KNL+ +  +  L + F  F   +  ++ T       +   S GFGF+ F  +  A 
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 183 EAVDAINGMLLNGQEVYVA-PHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALF 241
             + A++G +++G ++ +   H      ++     K     I VKN+  E T+++   LF
Sbjct: 673 AVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELF 732

Query: 242 TQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYE 301
           + FG++ S  + +  +   RGF F+ F     A  A+D+L       +RL +  A+++ +
Sbjct: 733 SSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESD 792

Query: 302 RLQE--------LRKQYEVSRLEKL 318
            ++E        ++KQ  VS++  L
Sbjct: 793 DVEEQISKMTMKMKKQAAVSKMGAL 817

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 95/209 (45%), Gaps = 14/209 (6%)

Query: 6   DKTAEQLEQLK--INDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSP- 62
           D   E ++++K  + D       +  SE   +D  + S++V  L+ + T A L + F P 
Sbjct: 576 DAAPEDVKEIKKSVEDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPF 635

Query: 63  ----IGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR 118
               +  V +    +++  K S+G+ ++ F   +     I  ++   I G   ++  S +
Sbjct: 636 SGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHK 695

Query: 119 DPSLRK-------KGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFG 171
             SL K       K SG I +KNL      K + + FS FG + S ++      +++GF 
Sbjct: 696 QSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFA 755

Query: 172 FVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           FV F     A+ A+D + G+ L G+ + +
Sbjct: 756 FVEFLLPSEAENAMDQLQGVHLLGRRLVM 784

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           LF++N+     +E  +  F+P+G +    V  D   G SKGF +V F  PE A  A  E 
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 385 NQQIVAGKPLYVAIAQRKDVRR 406
           ++QI  G+ L++  A  K   R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR 384

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 103/240 (42%), Gaps = 37/240 (15%)

Query: 125 KGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKE 183
           + +G +F++N+      +     FS +G +    +A D   G SKGF +V F++   A  
Sbjct: 298 RATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAAN 357

Query: 184 AVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQE-------- 235
           A   ++  +  G+ +++ P  +KK    +L+E         +KN+ L+  +E        
Sbjct: 358 AYIELDKQIFQGRLLHILPADAKK--THRLDE-------FDLKNLPLKKQRELKRKATAA 408

Query: 236 ----EFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAK-AVDELNDTDFKSQR 290
                + +LF     + S+V  +    K +    I+ E+  SA K A+ E +        
Sbjct: 409 QQTFSWNSLFMNQDAVLSSVAAKLGMEKSQ---LIDPENSGSAVKQALAEAH-------- 457

Query: 291 LYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAI 350
             +G  +K +E       Q+E  + +K+ +     + VKN       E+L + F PFG I
Sbjct: 458 -VIGDVRKYFEARGVDLTQFE--KFKKVTERDDRIILVKNFPHGTTREELAELFLPFGKI 514

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 23/192 (11%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLE-----RDSEGK-PRGFGFINFEDHESA 274
            +I+VKN++  TT  +    F  F     A ++     ++S+ K   GFGFI F   E A
Sbjct: 612 VSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQA 671

Query: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLF----VKN 330
              +  ++       ++             +L+  ++ S L K +K     +     VKN
Sbjct: 672 GAVIAAMDGAVIDGHKI-------------QLKISHKQSSLPKTSKGSKKKISGKIIVKN 718

Query: 331 LDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVA 390
           L      + + + F+ FG + S +V +    +++GF FV F  P EA  A+ +     + 
Sbjct: 719 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLL 778

Query: 391 GKPLYVAIAQRK 402
           G+ L +  A+++
Sbjct: 779 GRRLVMQYAEQE 790

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 154 ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
           I   KI  D++GNS+ F F+ +  E  A +A++  NG  ++   + VA
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVA 84

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 350 ITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           IT  K+++D +GNS+ F F+ + + ++A  AI   N   +    + VA+A+
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAK 87

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 82/167 (49%), Gaps = 5/167 (2%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           +  ++YVG LDP V++ LLY+LF  +  VS IR  +D + +   G+A+V          A
Sbjct: 5   TECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFA 64

Query: 98  IQKLNYT-TIKGRPCRIMWSQRDP--SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI 154
           I+ LN T ++ G+  ++  +  +   S        +F+KNL   ID   L   F  FG +
Sbjct: 65  IKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFGPL 124

Query: 155 LS-CKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
               ++ T + G  +   +V+F     + EA++ +N  ++  Q + +
Sbjct: 125 AKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISI 170

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 78/180 (43%), Gaps = 14/180 (7%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVD 279
             +YV N+D + ++E    LF Q   ++     +D  + + +GF F+          A+ 
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIK 66

Query: 280 ELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEK 339
            LN+T      L+ G+  K    L+  +    V        +    LFVKNLD +ID  +
Sbjct: 67  SLNNT----VSLF-GKVLKVRRTLENAKNSAPV--------FARAKLFVKNLDSTIDAVQ 113

Query: 340 LRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 399
           L+  F  FG +     +      +    +V F+T   + +A+ + N QIVA + + +  A
Sbjct: 114 LQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNNQIVANQIISIDYA 173

>Kwal_0.250
          Length = 216

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 89/215 (41%), Gaps = 34/215 (15%)

Query: 86  VNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP-SLRKKGSG-------------NIF 131
           V F + +    AIQK +  T  GR   +   +  P S+R + SG              IF
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 132 IKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDA---- 187
           I NL  +   ++L D F   GN     +  D  G SKGFG V FE    A+ A+D     
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQHF 123

Query: 188 -INGMLLNGQEVY-------------VAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETT 233
            + G +L  +  Y             V+  ++ +   +  E  KSN   IYV N+   T 
Sbjct: 124 DLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSN--TIYVDNLPYATA 181

Query: 234 QEEFEALFTQFGKITSAVLERDSEGKPRGFGFINF 268
           Q +   LF   G +  A L+ D + KP G   +++
Sbjct: 182 QSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 2/118 (1%)

Query: 264 GFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQG 323
           G + F + E  +KA+ + +   F  + L+V   +     ++      +   LE+   + G
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERF--HPG 59

Query: 324 VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
             +F+ NL  S   + L+D F   G  T A V  D  G SKGFG V F T +EA  A+
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTAL 117

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 87/219 (39%), Gaps = 22/219 (10%)

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYV----APHVSKKDRQS-----KLEEAKSNFT 221
           G V F       +A+   +G    G+E++V     P  S +  +S      LE     + 
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGY- 60

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDEL 281
            I++ N+   T+ +  + LF   G  T A ++ D  G+ +GFG + FE  + A  A+D+ 
Sbjct: 61  EIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKF 120

Query: 282 NDTDFKSQRLYVGRAQKKYER---------LQELRKQYEVSRLEKLAKYQGVNLFVKNLD 332
              D + + L + R    +E             +  Q E +  E    ++   ++V NL 
Sbjct: 121 QHFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGE---GHKSNTIYVDNLP 177

Query: 333 DSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCF 371
            +     L D F   G +  A++  D      G   V +
Sbjct: 178 YATAQSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 59/158 (37%), Gaps = 27/158 (17%)

Query: 42  LYVGELDPTVTEALLYDLFSPIG--SVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           +++  L  + +   L DLF   G  + + +++ R+  +K   G+  V F   D  RTA+ 
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSK---GFGTVIFETIDEARTALD 118

Query: 100 KLNYTTIKGRPCRIM-----WSQ-----------------RDPSLRKKGSGNIFIKNLHP 137
           K  +  ++GR   +      W +                  + S     S  I++ NL  
Sbjct: 119 KFQHFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSNTIYVDNLPY 178

Query: 138 AIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHF 175
           A     L+D F   G +   ++  D      G   V +
Sbjct: 179 ATAQSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 75/166 (45%), Gaps = 4/166 (2%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCR---DAITKTSLGYAYVNFHDHDAGR 95
           S ++YVG LD  V ++LLY+LF   G +S I+  +   D        YA++ F + D   
Sbjct: 2   SNTVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDY 61

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSG-NIFIKNLHPAIDNKALHDTFSVFGNI 154
                 N  ++ G+P ++  S + P       G  +F+KNL  +ID   L + F +FG +
Sbjct: 62  VCKLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKL 121

Query: 155 LSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           L           +    +V F     + EA+  +N   L  + +Y+
Sbjct: 122 LRKPEVFYLQNGTLRCAYVWFTTFKHSDEALQQLNETNLANKLIYI 167

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 85/191 (44%), Gaps = 23/191 (12%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERD----SEGKPRGFGFINF--EDHESAAK 276
           +YV N+D    +     LF Q G I+     ++     + +   + FI F  +D +   K
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 277 AVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSID 336
             D  N      + L V R+ K+ E        ++V          G  LFVKNLD+SID
Sbjct: 65  LFD--NRVSLYGKPLKVRRSNKQPET-----TDFDV----------GAKLFVKNLDESID 107

Query: 337 DEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
             +L + F  FG +     +      +    +V F+T + + +A+ + N+  +A K +Y+
Sbjct: 108 VPQLSNIFKIFGKLLRKPEVFYLQNGTLRCAYVWFTTFKHSDEALQQLNETNLANKLIYI 167

Query: 397 AIAQRKDVRRS 407
             A + D++++
Sbjct: 168 DYAYKDDMQKT 178

>Kwal_56.24709
          Length = 828

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 103/252 (40%), Gaps = 46/252 (18%)

Query: 91  HDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSV 150
           H A    ++      ++  P    WS    +      GN++++ +   +    L   FS 
Sbjct: 204 HWADLEVVRDSAVAALRASPIVSKWSVSVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSK 263

Query: 151 FGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDR 209
           FG +LS KI  D  +G+S G+GF+ +     A   +  +NG L+NG  +++  HV +K+R
Sbjct: 264 FGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFINYHVERKER 323

Query: 210 QS------KLEEAKSNFTNIYVKNID--------------LETTQEEFEALFTQFGKITS 249
           +       K +     F  +++ N+               +   Q++  +   Q   I S
Sbjct: 324 ERIHWDHFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEHVIAKFQDQLRSKGEQPVHIVS 383

Query: 250 AVL-ERDSEG-----------------------KP-RGFGFINFEDHESAAKAVDELNDT 284
             L +R+SE                         P +G+GFI F  H+ A  A+D  N+ 
Sbjct: 384 YYLPKRNSESDIEYRDDDDKTDDIETCISKHEESPLKGYGFIKFVSHDQALTAIDLFNNF 443

Query: 285 DFKSQRLYVGRA 296
           ++   +L V +A
Sbjct: 444 EWLGNKLVVNKA 455

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (52%), Gaps = 22/102 (21%)

Query: 322 QGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM-----RDDA--------------GN 362
           Q  NL+VK+L  S  DE     +  FG I SAK++     ++D               G+
Sbjct: 608 QESNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGS 667

Query: 363 SKGFGFVCFSTPEEATKA--ITEKNQQIVAGKPLYVAIAQRK 402
           SKG+GFVCF  P +A++A  IT++  Q+     LYV+ AQ++
Sbjct: 668 SKGYGFVCFKNPLDASRAMMITDR-YQVDENHTLYVSFAQKR 708

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITE 383
           NL+V+ +   +  + L   F+ FG + S K++ D  +G+S G+GF+ +    +A++ I E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 384 KNQQIVAGKPLYVAI-AQRKDVRR 406
            N  ++ G  L++    +RK+  R
Sbjct: 302 LNGNLMNGSALFINYHVERKERER 325

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDE 280
           N+YV+ I  + T ++   +F++FG + S  +  DS  G   G+GF+++     A++ + E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 281 LNDTDFKSQRLYVGRAQKKYER 302
           LN        L++    ++ ER
Sbjct: 302 LNGNLMNGSALFINYHVERKER 323

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 21/126 (16%)

Query: 30  SENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89
           S NA   T   +LYV  +   +T   L  +FS  G V S+++  D+ +  SLGY ++++ 
Sbjct: 231 SVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYP 290

Query: 90  DHDAGRTAIQKLNYTTIKGRPC------------RIMWS---QRDPSLRKKGSGNIFIKN 134
                   I++LN   + G               RI W    + +   R KG   +FI N
Sbjct: 291 LGSQASRCIKELNGNLMNGSALFINYHVERKERERIHWDHFKEDNDDDRFKG---VFIGN 347

Query: 135 L---HP 137
           L   HP
Sbjct: 348 LPTNHP 353

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 22/104 (21%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVL----------------ERDSE---GKPR 261
           +N+YVK++ +    E+F   +  FG+I SA +                 + SE   G  +
Sbjct: 610 SNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSK 669

Query: 262 GFGFINFEDHESAAKA--VDELNDTDFKSQRLYVGRAQKKYERL 303
           G+GF+ F++   A++A  + +    D ++  LYV  AQK+ + +
Sbjct: 670 GYGFVCFKNPLDASRAMMITDRYQVD-ENHTLYVSFAQKRAKSI 712

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 49/118 (41%), Gaps = 25/118 (21%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT-----------DEA--------GNSKG 169
           N+++K+L  +  ++     +  FG I+S KI T           D A        G+SKG
Sbjct: 611 NLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKG 670

Query: 170 FGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKN 227
           +GFV F      K  +DA   M++  +      H        K  ++ SN  +I V N
Sbjct: 671 YGFVCF------KNPLDASRAMMITDRYQVDENHTLYVSFAQKRAKSISNADSISVAN 722

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 105/440 (23%), Positives = 180/440 (40%), Gaps = 75/440 (17%)

Query: 22  QTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSL 81
           +T+  S E ++ K    +  L++  +  T TE     LFSP G +  + +  D  T  S 
Sbjct: 312 ETSQESEEEKSLKKIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSK 371

Query: 82  GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGS--GNIFIKNLHPAI 139
           G+AYV F + D   TA  +L+    +GR   I+     P+  KK        +KNL P  
Sbjct: 372 GFAYVLFKNADNAATAFVELDKQIFQGRLLHIL-----PADAKKSHKLDEFDLKNL-PLK 425

Query: 140 DNKAL-------HDTF---SVFGN---ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186
             + L         TF   S++ N   +LS     D+ G  K    +  E   SA +   
Sbjct: 426 KQRELKRKANSAQQTFSWNSLYMNQDAVLSS--VADKLGMKKS-ELIDAENSSSAVKQAL 482

Query: 187 AINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGK 246
           A   ++ + ++ +    V    + ++L+ ++ +   I VKN    TT+EE   LF  FGK
Sbjct: 483 AEASVIGDVRKFFETRGVDLT-KFAQLKNSERDDRVILVKNFPYGTTREEIAELFLPFGK 541

Query: 247 ITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDELNDTDFKSQRLYVGRA-----QKKY 300
           +   +L       P G    + F D  +A  A  +++   FK   +Y+ +       +  
Sbjct: 542 LQRLLL------PPSGTIAILQFRDVPAARAAFSKISYKRFKDGIIYLEKGPSDCFTRDA 595

Query: 301 ERLQELRKQYEVSR-LEKLAKYQG-------------------------------VNLFV 328
           +  + +  + ++ +   K AK  G                               V++F+
Sbjct: 596 QGDELVESETDIQKATAKEAKISGADLLEAQSLPAADKDDHDDDDDDDDVQAGPTVSIFI 655

Query: 329 KNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGN-----SKGFGFVCFSTPEEATKAIT 382
           KNL+ S   ++L ++F PF     A+V  + D        S GFGF  F T E+A   I+
Sbjct: 656 KNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQANAVIS 715

Query: 383 EKNQQIVAGKPLYVAIAQRK 402
                I+ G  L + ++ R+
Sbjct: 716 AMEGTILDGHKLQLKLSHRQ 735

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 85/173 (49%), Gaps = 8/173 (4%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD----EAGN--SKGFGFVHFEEEYSAK 182
           +IFIKNL+ +  ++ L + F  F   +  ++ T     + G   S GFGF  F+ +  A 
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 183 EAVDAINGMLLNGQ--EVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
             + A+ G +L+G   ++ ++         +  ++ K N   I VKN+  E T+++   L
Sbjct: 712 AVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFEL 771

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
           F+ FG++ S  + +  +   RGF F+ F   + A  A+D+L       +RL +
Sbjct: 772 FSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 78/175 (44%), Gaps = 13/175 (7%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGS--VSSIRVCRDAIT--KT-SLGYAYVNFHDHDA 93
           + S+++  L+ + T   L + F P     V+ ++   D     KT S+G+ +  F   + 
Sbjct: 650 TVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQ 709

Query: 94  GRTAIQKLNYTTIKGRPCRIMWSQRDPS--------LRKKGSGNIFIKNLHPAIDNKALH 145
               I  +  T + G   ++  S R  +         +KK  G I +KNL      K + 
Sbjct: 710 ANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVF 769

Query: 146 DTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           + FS FG + S ++      +++GF FV F     A+ A+D + G+ L G+ + +
Sbjct: 770 ELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           LF++N+  +  ++  R  F+P+G +    +  D   G SKGF +V F   + A  A  E 
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 385 NQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 417
           ++QI  G+ L++  A   D ++S    +   +N
Sbjct: 392 DKQIFQGRLLHILPA---DAKKSHKLDEFDLKN 421

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 94/212 (44%), Gaps = 21/212 (9%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQF-GKITSAVLERDSEGKP-----RGFGFINFEDHESA 274
            +I++KN++  TT ++    F  F G + + V  +    +P      GFGF  F+  E A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDS 334
              +  +  T     +L +  + ++             +  +K  K QG  + VKNL   
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQGTSTTN-------ASSKKKKKNQG-KIIVKNLPFE 762

Query: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
              + + + F+ FG + S +V +    +++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 822

Query: 395 YVAIAQR--KDVRRSQLAQQIQARNQMRYQQV 424
            +   ++  +DV      QQI+   +   +QV
Sbjct: 823 VMEFVEQDPEDVE-----QQIEKMTRKVKKQV 849

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 14  QLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCR 73
           QLK++  Q T  ++T + + K   +   + V  L    T   +++LFS  G + S+RV +
Sbjct: 728 QLKLSHRQGT--STTNASSKKKKKNQGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPK 785

Query: 74  DAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120
               K++ G+A+V F        A+ +L    + GR   + + ++DP
Sbjct: 786 -KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQDP 831

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 28/57 (49%)

Query: 145 HDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
           H +  V   +   K+  +  G S+ F F+ F +E  A + V+  NG  ++  ++ V+
Sbjct: 30  HQSTDVQSYLSDVKLMKNRDGESRRFAFIGFRDEEDAFDCVNYFNGTFVDTSKIEVS 86

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 247 ITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQ 297
           ++   L ++ +G+ R F FI F D E A   V+  N T   + ++ V  A+
Sbjct: 39  LSDVKLMKNRDGESRRFAFIGFRDEEDAFDCVNYFNGTFVDTSKIEVSMAK 89

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 119/302 (39%), Gaps = 55/302 (18%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHDAGRT 96
           S S++VG L        L + FS IG V    V  D IT      G   V F + D    
Sbjct: 161 SNSIFVGNLTYDCQPEDLKEYFSQIGEV----VRADIITSRGHHRGMGTVEFTNADDVDE 216

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDP--------------SLRKKGSG-NIFIKNLHPAIDN 141
           AI++ + +T+  R   I   Q +P               ++    G  +FI NL  +++ 
Sbjct: 217 AIRRFDGSTLLDR--EIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNW 274

Query: 142 KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV- 200
           +AL D F   G++L   +  D  G S+G+G V+++ +   + A++  NG  L G+ + V 
Sbjct: 275 QALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

Query: 201 ----------------------------APHVSKKDRQSKLEEAK---SNFTNIYVKNID 229
                                       AP + +       E A       + I+V N+ 
Sbjct: 335 EGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGGGDQSSTIFVDNLP 394

Query: 230 LETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQ 289
             T Q +   LF   GK+  A L+    GKP G   + +++   A   +  LN  ++  +
Sbjct: 395 WSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISRLNSYNYGGR 454

Query: 290 RL 291
            L
Sbjct: 455 DL 456

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 93/197 (47%), Gaps = 5/197 (2%)

Query: 201 APHVSKKDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK 259
            P ++++   +  E+   N++N I+V N+  +   E+ +  F+Q G++  A +   S G 
Sbjct: 141 GPRLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGH 199

Query: 260 PRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLA 319
            RG G + F + +   +A+   + +    + ++V +     E ++   ++    R    A
Sbjct: 200 HRGMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRE---RRPRIQA 256

Query: 320 KYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATK 379
              G  +F+ NL  S++ + L+D F   G +  A V  D  G S+G+G V + T EE   
Sbjct: 257 SAPGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQV 316

Query: 380 AITEKNQQIVAGKPLYV 396
           AI   N   + G+ L V
Sbjct: 317 AIERYNGYELEGRVLDV 333

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 85/175 (48%), Gaps = 13/175 (7%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           S  ++YVG +DP +T+  LY+LF  I  V  I+  +D + +   GYA++ F++    + A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 98  IQKLNYTT-IKGRPCRI------MWSQRDPSLRKKGS----GNIFIKNLHPAIDNKALHD 146
           I+ +N T  +  R  ++        +   PS   K        +FIKNL  +ID+  L  
Sbjct: 67  IKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVK 126

Query: 147 TFSVFGNIL-SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
            F+ FG ++   +I     G  K   +V+FE+   A  A+ ++N  L+    + V
Sbjct: 127 IFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITV 180

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 76/179 (42%), Gaps = 8/179 (4%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAVDEL 281
           +YV NID   T+E+   LF Q   +      +D   +  +G+ FI F +   A  A+  +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLR 341
           N+T     RL   R          L        +  +AK     LF+KNL DSID ++L 
Sbjct: 71  NNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAK-----LFIKNLADSIDSDQLV 125

Query: 342 DEFAPFG-AITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 399
             F  FG  I   ++     G  K   +V F   E+A  AI   N Q+VA   + V  A
Sbjct: 126 KIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYA 183

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 135/338 (39%), Gaps = 77/338 (22%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVS-SIRVCRDA---ITKTSLGYAYVNFHDH 91
            T  + LY+G+LDP+  EA++  +++ +G  +  +R+         + +LGY +V F   
Sbjct: 80  STPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSP 139

Query: 92  DAGRTAIQKLNYTTIKG---RPCRIMWSQRDPSLRKKGSG---------------NIFIK 133
                A+ K N   I G   +  ++ WS +       GSG               +IF+ 
Sbjct: 140 AHASNALMK-NGMEIPGFVHKKLKLNWSAQS---VNNGSGASVANGAVANQQTNNSIFVG 195

Query: 134 NLHPAIDNKALHDTF-SVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGM 191
           +L P++    L D F + + + +  K+  D+  G SKG+GFV F+     + A+  + G 
Sbjct: 196 DLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGC 255

Query: 192 LLNGQEVYVA-----------------------------------------PHVSKKDRQ 210
            LNG+ + +                                            V+   +Q
Sbjct: 256 FLNGRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQ 315

Query: 211 SKLEE-AKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFE 269
             L      N T ++V  +    T++E  + F  FG I   +  +   GK  G GF+ + 
Sbjct: 316 PVLNHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTI---IYVKIPAGK--GCGFVQYV 370

Query: 270 DHESAAKAVDELNDTDFKSQ--RLYVGRAQKKYERLQE 305
           +  SA  A+ ++      +   RL  GR+ KK   +Q+
Sbjct: 371 ERSSAETAITKMQGFPIANSRVRLSWGRSAKKTALIQK 408

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 326 LFVKNLDDSIDDEKLRDEFA-PFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITE 383
           +FV +L  S+ + +L D F   + +   AKVM D   G SKG+GFV F +  +  +A+ E
Sbjct: 192 IFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVE 251

Query: 384 KNQQIVAGKPLYVAIA 399
                + G+ + + IA
Sbjct: 252 MQGCFLNGRAIKIGIA 267

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 32  NAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDH 91
           N   D ++ +++VG L P VTE  L   F P G++  +++          G  +V + + 
Sbjct: 319 NHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKI------PAGKGCGFVQYVER 372

Query: 92  DAGRTAIQKLNYTTIKGRPCRIMWSQ 117
            +  TAI K+    I     R+ W +
Sbjct: 373 SSAETAITKMQGFPIANSRVRLSWGR 398

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 67/340 (19%), Positives = 126/340 (37%), Gaps = 62/340 (18%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFG--NI-LSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186
           +++ +L P+ D   +   ++  G  NI +      D   + K  G+   E    A     
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAH---- 141

Query: 187 AINGMLLNGQEV-----------YVAPHVSKKDRQSKLEEAKSN---FTNIYVKNIDLET 232
           A N ++ NG E+           + A  V+     S    A +N     +I+V ++    
Sbjct: 142 ASNALMKNGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAPSV 201

Query: 233 TQEEFEALFTQF--GKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQR 290
           T+ +   LF       + + V+     G  +G+GF+ F+      +A+ E+       + 
Sbjct: 202 TEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRA 261

Query: 291 LYVGRA---------------------------QKKYERLQELRKQYEVSR-----LEKL 318
           + +G A                           Q+      +L +Q+  +      L   
Sbjct: 262 IKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHF 321

Query: 319 AKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEAT 378
                  +FV  L   + +++LR  F PFG I   K+    AG  KG GFV +     A 
Sbjct: 322 TDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKI---PAG--KGCGFVQYVERSSAE 376

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQ 418
            AIT+     +A     V ++  +  +++ L Q+   R++
Sbjct: 377 TAITKMQGFPIANS--RVRLSWGRSAKKTALIQKALLRSR 414

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 91/205 (44%), Gaps = 10/205 (4%)

Query: 201 APHVSKKDRQSKLEEAKSNFTN-IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK 259
            P ++++   +  E+   N+TN I+V N+  + T E+ +  F+Q GK+  A +   S G 
Sbjct: 86  GPRLARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIIT-SRGH 144

Query: 260 PRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQY------EVS 313
            RG G + F   E   +A+ + +     +++++V +     E                V+
Sbjct: 145 HRGMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVT 204

Query: 314 RLEKLAKYQ--GVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCF 371
           + +K  K Q  G  L + NL  SI  + L+  F  FG +  A V  D  G S G G V F
Sbjct: 205 KPKKAVKPQKKGYELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIF 264

Query: 372 STPEEATKAITEKNQQIVAGKPLYV 396
              E+  KA    N   + GK L V
Sbjct: 265 KNQEDMVKAYEHFNGFEIEGKVLEV 289

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 73/193 (37%), Gaps = 36/193 (18%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHDAGRTAI 98
           S++VG L    T   L D FS +G V    V  D IT      G   V F   +    AI
Sbjct: 108 SIFVGNLTYDCTPEDLKDFFSQVGKV----VRADIITSRGHHRGMGTVEFTSGEEVDEAI 163

Query: 99  QKLNYTTIKGRPCRIMWSQRDP---------------------------SLRKKGSGNIF 131
           +K +   +  R  +I   Q +P                             +KKG   + 
Sbjct: 164 RKFDGAYLMNR--QIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGY-ELM 220

Query: 132 IKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGM 191
           I NL  +I  + L   F  FG++L   +  D  G S G G V F+ +    +A +  NG 
Sbjct: 221 ILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGF 280

Query: 192 LLNGQEVYVAPHV 204
            + G+ + V   +
Sbjct: 281 EIEGKVLEVRGQI 293

>Kwal_27.12337
          Length = 209

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 22/126 (17%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           ++YVG +DP VT  +LY+LF  I  V+ IR  +D I +T  G+A+V F++      A + 
Sbjct: 11  TVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKC 70

Query: 101 LNYTTIKGRPCRIMWSQRDPSLRK-KGSGN-------------IFIKNLHPAIDNKALHD 146
           LN +        +    R   +RK  G+G+             +F+KN+   +D  AL  
Sbjct: 71  LNNS--------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTR 122

Query: 147 TFSVFG 152
            FS FG
Sbjct: 123 IFSKFG 128

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 80/176 (45%), Gaps = 17/176 (9%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAVDEL 281
           +YV N+D + T+E    LF Q   +      +D   +  +GF F+ F + +    A   L
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRL--EKLAKYQGVNLFVKNLDDSIDDEK 339
           N+    S RLY        +R  ++RK          + A   G  LFVKN+D+ +D   
Sbjct: 72  NN----SLRLY--------DRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATA 119

Query: 340 LRDEFAPFGAITSA-KVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
           L   F+ FG +  A ++     G  K   +V ++T E + KA+ + N Q+V  K +
Sbjct: 120 LTRIFSKFGPLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCI 174

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 126/308 (40%), Gaps = 22/308 (7%)

Query: 115 WSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFV 173
           WS  +        GN++++ +   +  + L   F+ FG IL  KI  D   N S GFGFV
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 174 HFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQ--------SKLEEAKSNFTNIYV 225
            +     A   +  +NG L+NG  ++V  HV +K+R+           +E  + F  ++V
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKGVFV 297

Query: 226 KNIDLETTQEEFEALFTQFGKITSAV--LERDSEGKPRGFGFINFE----DHESAAKAVD 279
            N+ + TT+ +         K   A+   E  S   P+     N E    D +S +++  
Sbjct: 298 GNLPIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDEDSKSESPL 357

Query: 280 ELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEK 339
            LN   F  +  +      K  R  E  +  ++  +EK       ++ +KN   +  D +
Sbjct: 358 HLNAESFPVKSKHNSDETNK--RNNEKIEDPQLKTIEKHHDNGDEDIVMKNDATTSSDTE 415

Query: 340 LRDEFAPFGAITSAK-----VMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
           +    +     T A        +++    KG+GF  F+T E A K I   N     G  L
Sbjct: 416 VPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFNDSQWYGHQL 475

Query: 395 YVAIAQRK 402
            V  A +K
Sbjct: 476 VVNKAIQK 483

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 52/98 (53%), Gaps = 17/98 (17%)

Query: 322 QGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM--------RDDA--------GNSKG 365
           Q  NL+VK+L     DE L   F  FG I SAK++        +DD         G SKG
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 366 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 402
           +GFVCF  P +A++A+   +  ++ +   L+V+ AQR+
Sbjct: 788 YGFVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 127/311 (40%), Gaps = 37/311 (11%)

Query: 30  SENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89
           SEN        +LYV  +   +T+  L  +F+  G +  +++  D+ T  S+G+ +V++ 
Sbjct: 181 SENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYA 240

Query: 90  DHDAGRTAIQKLNYTTIKGRPCRI---------------MWSQRDPSLRKKGSGNIFIKN 134
                   I++LN   + G P  +                W Q +     K  G +F+ N
Sbjct: 241 LGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKG-VFVGN 299

Query: 135 LHP--AIDNKALHDTFSV--FGNIL-SCKIATDEAGNSKGFGFVHFEE--EYSAKEAVDA 187
           L P    +NK L  +  +  F   L  C++ +     +     V + E  E S  E+   
Sbjct: 300 L-PIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDEDSKSESPLH 358

Query: 188 INGMLLNGQEVYVAPHVSKKDRQS----KLEEAKSNFTN----IYVKNIDLETTQEEFEA 239
           +N      +  + +   +K++ +     +L+  + +  N    I +KN    ++  E   
Sbjct: 359 LNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGDEDIVMKNDATTSSDTEVPK 418

Query: 240 LFTQFGKITSAVLE-----RDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVG 294
             +     T A  E     ++ E   +G+GF  F  HE A K ++  ND+ +   +L V 
Sbjct: 419 SSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFNDSQWYGHQLVVN 478

Query: 295 RAQKKYERLQE 305
           +A +K+ + Q 
Sbjct: 479 KAIQKFHQHQH 489

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 17/104 (16%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSA--------VLERDSE--------GKPRGFG 264
           +N+YVK++ L+   E+    F +FG+I SA        + E+D +        GK +G+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 265 FINFEDHESAAKAVDELNDTDFKSQR-LYVGRAQKKYERLQELR 307
           F+ F++   A++A+   +     S   L+V  AQ++ + +  ++
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIK 833

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 19/101 (18%)

Query: 128 GNIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT---------------DEA-GNSKGFG 171
            N+++K+L     ++ L+  F  FG I+S KI T               DE  G SKG+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 172 FVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSK 212
           FV F+    A  A+   +G+ LN         VS   R+SK
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLF---VSFAQRRSK 827

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 133/316 (42%), Gaps = 39/316 (12%)

Query: 116 SQRDPSLRKKGSGNIFIKNLHPAIDNKALHDT----FSVFGNILSCKIATDEAGNSKGFG 171
           S  DPS  +  S  IF+ +L   + +  L+ +    F+ +G I+S K+  D A  ++ + 
Sbjct: 109 SSDDPSFSRPSSC-IFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDPA--NRPYA 165

Query: 172 FVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFT----NIYVKN 227
           FV +  +  A  A+    G  LN             +R  + E AK N T    + +   
Sbjct: 166 FVQYASDDEALNALSQAQGTTLN-------------NRNIRCERAKVNRTVFISSSFANP 212

Query: 228 IDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGF-------GFINFEDHESAAKAVDE 280
           ++ + T E+   L ++FG++   V  RD   K   +        FI +   + A +A  +
Sbjct: 213 LEGKLTVEKVVDLMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRDDAIRAYLQ 272

Query: 281 LN-DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEK--LAK----YQGVNLFVKNLDD 333
           +  + ++  +         ++  L    K  E  RLE+    K        ++F+  L+ 
Sbjct: 273 MKLNYEYMVEWAQNVDVPPRFNLLLSKAKICEKERLERERFGKQPIFIDNKSIFIGQLNF 332

Query: 334 SIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
            +    L + F+ +G I +  ++       K F F+ + TP  A KA+  +N  I   K 
Sbjct: 333 KVTKPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSIFVEKI 391

Query: 394 LYVAIAQRKDVRRSQL 409
           L+V I +  + RRS +
Sbjct: 392 LHVQIREVSNSRRSSI 407

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 125/308 (40%), Gaps = 57/308 (18%)

Query: 25  PTSTESENAKVDTSSASLYVGELDPTVTE----ALLYDLFSPIGSVSSIRVCRDAITKTS 80
           P+   S++      S+ ++V  L  T+++    A +   F+  G + S++V RD   +  
Sbjct: 105 PSPRSSDDPSFSRPSSCIFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDPANRP- 163

Query: 81  LGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKN-----L 135
             YA+V +   D    A+ +   TT+  R  R          R K +  +FI +     L
Sbjct: 164 --YAFVQYASDDEALNALSQAQGTTLNNRNIRCE--------RAKVNRTVFISSSFANPL 213

Query: 136 HPAIDNKALHDTFSVFGNILSCKIATD----------EAGNSKGFGFVHFEEEYSAKEAV 185
              +  + + D  S FG +     + D          E  NS    + + +      +A+
Sbjct: 214 EGKLTVEKVVDLMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRD------DAI 267

Query: 186 DAINGMLLN-------GQEVYVAPH---------VSKKDRQSKLEEAKS----NFTNIYV 225
            A   M LN        Q V V P          + +K+R  +    K     +  +I++
Sbjct: 268 RAYLQMKLNYEYMVEWAQNVDVPPRFNLLLSKAKICEKERLERERFGKQPIFIDNKSIFI 327

Query: 226 KNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTD 285
             ++ + T+      F+++G+I +  L    E + + F FI ++   SAAKA++  N + 
Sbjct: 328 GQLNFKVTKPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSI 386

Query: 286 FKSQRLYV 293
           F  + L+V
Sbjct: 387 FVEKILHV 394

>Scas_157.1
          Length = 232

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 82/172 (47%), Gaps = 8/172 (4%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIG-SVSSIRVCRDAITKTSLGYAYVNFHDHDAG 94
           +T S+ LY+G+LDP   E ++  ++  +G S   +++  ++    + GY +V F   + G
Sbjct: 43  NTGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHG 102

Query: 95  RTAIQKLNYTTIKGRPCR---IMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTF-SV 150
             A+ K N   I G P R   + W+    +    G  ++F+ +L P +    L + F   
Sbjct: 103 NNALLK-NGIVIPGFPQRRLKLNWASAGANGNNSGF-SVFVGDLSPNVTEAQLFELFIGR 160

Query: 151 FGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
           + +    K+  D+  G SK +GFV F      +  +  + G+ LNG+ + V 
Sbjct: 161 YPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 5/96 (5%)

Query: 21  QQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIG---SVSSIRVCRDAIT 77
           Q+    +  S  A  + S  S++VG+L P VTEA L++LF  IG   S    +V  D +T
Sbjct: 118 QRRLKLNWASAGANGNNSGFSVFVGDLSPNVTEAQLFELF--IGRYPSTCHAKVVHDQLT 175

Query: 78  KTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRI 113
             S  Y +V F+     +  + ++    + GR  ++
Sbjct: 176 GVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

>Kwal_27.11832
          Length = 686

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 87/195 (44%), Gaps = 13/195 (6%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           +   ++V++I  + T EE    F+    I  AV+ +D +   RGFGF++F   +    A+
Sbjct: 19  DMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDAL 78

Query: 279 DELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGV---------NLFVK 329
           D+   T FK + L V  A++   R +  + Q   +  E  +  Q            L V+
Sbjct: 79  DKARKTKFKGRLLRVDIAKR---RDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVR 135

Query: 330 NLDDSIDD-EKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQI 388
           N+  S+ + ++L+  F  +G +  AK+ +   G   GF FV          AI E     
Sbjct: 136 NMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLK 195

Query: 389 VAGKPLYVAIAQRKD 403
           + G+ + V  A +K+
Sbjct: 196 IGGRQVAVDFAVQKN 210

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 78/189 (41%), Gaps = 24/189 (12%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +L+V  +    T+  L + FS +  +    + +D   K S G+ +V+F   D  + A+ K
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDD-QKNSRGFGFVSFAVEDDTKDALDK 80

Query: 101 LNYTTIKGRPCRIMWSQRDPSLRKK----------------------GSGNIFIKNLHPA 138
              T  KGR  R+  ++R    +K                       G   + ++N+  +
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWS 140

Query: 139 IDN-KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQE 197
           + N   L   F  +G ++  KI     G   GF FV  ++  S K A++    + + G++
Sbjct: 141 VRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQ 200

Query: 198 VYVAPHVSK 206
           V V   V K
Sbjct: 201 VAVDFAVQK 209

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 17/168 (10%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++++     ++ L + FS    I    I  D+  NS+GFGFV F  E   K+A+D   
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 190 GMLLNGQEVYV----APHVSKKDR------------QSKLEEAKSNFTNIYVKNIDLETT 233
                G+ + V        +KKD+            Q K +E       + V+N+     
Sbjct: 83  KTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWSVR 142

Query: 234 Q-EEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDE 280
             +E + +F ++G +  A + +  +GK  GF F+  +   S   A++E
Sbjct: 143 NPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEE 190

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 256 SEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVG 294
           S G+ RG+GF+ F DH++A   +  LN  +     L  G
Sbjct: 549 STGRSRGYGFVEFRDHKAALMGLRWLNAHEVTKSELLEG 587

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 77/357 (21%), Positives = 137/357 (38%), Gaps = 87/357 (24%)

Query: 30  SENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVS-SIRVCRDAIT----------K 78
           + N  + T+   LY+G+LDPT  +  +  +++ +G  + ++R+  +             K
Sbjct: 44  ASNVSLGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPK 103

Query: 79  TSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRP---CRIMWS--------QRDPSLRKKGS 127
            + GY +V+F        A+ K N   I   P    ++ W+            +++   +
Sbjct: 104 NNQGYCFVDFPSSTHAANALLK-NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNN 162

Query: 128 GNIFIKNLHPAIDNKALHDTF-SVFGNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAV 185
            +IF+ +L P +    L + F + + +    KI  D+  G SKG+GFV F      + A+
Sbjct: 163 CSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 186 DAINGMLLNGQEVYVAP------HVSKKDR---------------------QSKLEEAKS 218
             + G+ LNG+ + V P      HVS  +                      QS L    +
Sbjct: 223 SEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNN 282

Query: 219 NF----------------------------TNIYVKNIDLETTQEEFEALFTQFGKITSA 250
           N                             T +++  +    T++E  A F  FG I   
Sbjct: 283 NMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTI--- 339

Query: 251 VLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQ--RLYVGRAQKKYERLQE 305
           V  +   GK    GF+ + D  SA  A+  +      +   RL  GR+ K+   LQ+
Sbjct: 340 VYVKIPVGKC--CGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQ 394

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 324 VNLFVKNLDDSIDDEKLRDEFAP-FGAITSAKVMRDDA-GNSKGFGFVCFSTPEEATKAI 381
            ++FV +L  ++ + +L + F   + + + AK++ D   G SKG+GFV F+  +E   A+
Sbjct: 163 CSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 382 TEKNQQIVAGKPLYVA 397
           +E     + G+ + V 
Sbjct: 223 SEMQGVFLNGRAIKVG 238

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 111/307 (36%), Gaps = 66/307 (21%)

Query: 166 NSKGFGFVHFEEEYSAKEAVDAINGMLL-----NGQEVYVAPHVSKKDRQSKLEEAKSNF 220
           N++G+ FV F     A  A+   NGML+        ++  A         S       N 
Sbjct: 104 NNQGYCFVDFPSSTHAANAL-LKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNN 162

Query: 221 TNIYVKNIDLETTQEE-FEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAV 278
            +I+V ++    T+ + FE    ++   + A +  D   G  +G+GF+ F + +    A+
Sbjct: 163 CSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 279 DEL-------------------------NDTDFKSQRL--------YVGRAQK------- 298
            E+                         ND +  S  L        ++ + Q        
Sbjct: 223 SEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNN 282

Query: 299 --KYERLQELRKQYEVSRLEKLAKYQGVN---LFVKNLDDSIDDEKLRDEFAPFGAITSA 353
              ++R    +  Y V +   L  +   N   +F+  L   + +++LR  F PFG I   
Sbjct: 283 NMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYV 342

Query: 354 KVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY---VAIAQRKDVRRSQLA 410
           K+        K  GFV +     A  AI       + G P+    V ++  +  +++ L 
Sbjct: 343 KIPV-----GKCCGFVQYVDRLSAEAAIAG-----MQGFPIANSRVRLSWGRSAKQTALL 392

Query: 411 QQIQARN 417
           QQ    N
Sbjct: 393 QQAMLSN 399

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 84/205 (40%), Gaps = 20/205 (9%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           +   ++V++I    T E+    F+ F  I  AV+ +D   K RGFGF++F   +    A+
Sbjct: 20  DMKTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIAL 79

Query: 279 DELNDTDFKSQRLYV--GRAQKKYERLQELRKQYEVSRLEKLAKYQGVN----------- 325
            E   T     +L V   R + +  + ++   Q E+ R      Y   N           
Sbjct: 80  KEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSL 139

Query: 326 ------LFVKNLDDSIDD-EKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEAT 378
                 L ++N+  S  D  KL+  F  +G +  A + R   G   GF FV  +      
Sbjct: 140 LKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCK 199

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKD 403
           KA+ +     + G+ + V  A +K+
Sbjct: 200 KALEDTKNLTIDGRKVAVDFAVQKN 224

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 88/216 (40%), Gaps = 41/216 (18%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +L+V  +  +VT+  L D FS    +    V +D + K S G+ +V+F   D  + A+++
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKD-VNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 101 LNYTTIKGRPCRIMWSQR--------DPSLRK---------------------------K 125
              T + G   ++  ++R        D S +K                           K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 126 GSGNIFIKNL-HPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEA 184
           G   + I+N+     D   L   F  +G ++   I     G   GF FV   +  + K+A
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 185 VDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNF 220
           ++    + ++G++V V   V K    +K EE K+ +
Sbjct: 202 LEDTKNLTIDGRKVAVDFAVQK----NKWEEYKTKY 233

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/317 (19%), Positives = 122/317 (38%), Gaps = 77/317 (24%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++++  ++ ++ L D FS F  I    +  D    S+GFGFV F  E   K A+    
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEE-----------AKSNFTN---------------- 222
              L+G ++ V     ++DR  K E+           +K ++ +                
Sbjct: 84  KTKLDGAQLKVDI-ARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKG 142

Query: 223 ---IYVKNIDLETTQ-EEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
              + ++N+        + + +F ++G +  A + R  +GK  GF F+      +  KA+
Sbjct: 143 KPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKAL 202

Query: 279 DELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLA------------------- 319
           ++  +     +++ V  A +K  + +E + +YE    E                      
Sbjct: 203 EDTKNLTIDGRKVAVDFAVQK-NKWEEYKTKYEKEDDEAKDDGSDSSSDKEDKISVSDSE 261

Query: 320 ------------------------KYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSA-K 354
                                   + +  ++FV+N+     +E L D F+ FG +  A  
Sbjct: 262 GDEDGEDVEEEEEVEEEKPRKQKNRREDFSVFVRNVPYDATEESLFDHFSKFGPVKYALP 321

Query: 355 VMRDDAGNSKGFGFVCF 371
           V+  + G +KG  FV F
Sbjct: 322 VIDKNTGLAKGTAFVAF 338

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSA--VLERDSEGKPRGFGFINFEDHESAAKAVD 279
           +++V+N+  + T+E     F++FG +  A  V+++++ G  +G  F+ F+D ++    VD
Sbjct: 291 SVFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNT-GLAKGTAFVAFKDEKTYKYCVD 349

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 27/47 (57%)

Query: 258 GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQ 304
           G+ RG+GF+ ++DH+ A   +  LN     ++ +  G  +++ + +Q
Sbjct: 550 GRSRGYGFVEYKDHKHALMGLRWLNAHMVTTEEILEGMTEEEQKSIQ 596

>Scas_598.1
          Length = 516

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 102/215 (47%), Gaps = 34/215 (15%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITS-AVLERDSEGKPRGFGFINFEDHESAAKAVDEL 281
           +++  ++ ETT+++ +  F+++G +    +++ ++ G+ RGFGF+ FE     + +VDE+
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFE----LSSSVDEV 257

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLR 341
                K+Q +  G       ++ + ++       +K  K     +FV  +   +  ++  
Sbjct: 258 ----VKTQHILDG-------KVIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 301

Query: 342 DEFAPFGAITSAKVM----RDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 397
           + FA +G I  A++M      D G S+GFGF+ + +  EA   + +       GK + + 
Sbjct: 302 EFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEAVDRVCQNKYIDFKGKQIEIK 360

Query: 398 IAQRKDVRRS--------QLAQQIQARNQMRYQQV 424
            A  + +++         Q   Q+QA  QM   Q+
Sbjct: 361 RAAPRHMQKGANNGRNPRQFQNQMQAPPQMFQNQM 395

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 75/163 (46%), Gaps = 18/163 (11%)

Query: 33  AKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHD 92
           A +      L++G L+   TE  L D FS  G+V  +++ +D  T  S G+ ++ F    
Sbjct: 193 ADLSKECCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSS 252

Query: 93  AGRTAIQKLNYTTIKGR---PCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFS 149
           +    ++  +   + G+   P R +     P   +  +G IF+  + P +  K   + F+
Sbjct: 253 SVDEVVKTQH--ILDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFA 305

Query: 150 VFGNILSCKIA----TDEAGNSKGFGFVHFEEEYSAKEAVDAI 188
            +G I+  ++       + G S+GFGF+     Y + EAVD +
Sbjct: 306 QWGTIIDAQLMLLMLDKDTGRSRGFGFI----TYDSSEAVDRV 344

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 81/167 (48%), Gaps = 14/167 (8%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A++YVG +D  VT+ LLY+LF+ +G V  ++  +D I++   G+A++ F         + 
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 100 KLNYTT-IKGRPCRIMWS----QRDPSLRKKG-------SGNIFIKNLHPAIDNKALHDT 147
            +N    +  +  +I  S    Q+D + +K            +F+K++   ++ + L   
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 148 FSVFGNILSC-KIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLL 193
           FS FG +    ++ T   G  +   F++F+   +A  A+  +NG  +
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFI 171

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 7/187 (3%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAVDEL 281
           IYV NID + T+E    LFTQ G++      +D   +  +GF FI F     A   ++ +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEV-SRLEKLAKYQGVNLFVKNLDDSIDDEKL 340
           N+     Q++   R   +  +  +  K++E+ + L  +AK     +FVK++ D+++   L
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAK-----VFVKDIADTVEVRHL 122

Query: 341 RDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
              F+ FG +     +   +       F+ F   + A  AI   N Q +  K   +  A 
Sbjct: 123 TQLFSKFGPLAKTPEVFTVSNGEVRCAFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAF 182

Query: 401 RKDVRRS 407
           +++ R++
Sbjct: 183 KENGRKN 189

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 122/275 (44%), Gaps = 20/275 (7%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
            ++ V  L P      +   F   GS+  I V       + L  A + F  +D   TA+ 
Sbjct: 37  TTVLVKNLPPNYNHHKVRRYFKTCGSILQIDVTDSTDGDSKL--ARIEFSSYDQALTAVS 94

Query: 100 KLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGN--ILSC 157
           +    T+K    +I + Q   ++ +     I++ N  P  D   L +  S + +  ILS 
Sbjct: 95  R----TLK----KIGFHQ--ITVEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPILSI 144

Query: 158 KIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAK 217
           ++ +    + + F +V       AK+A + +NG+ +N  ++ VA   +  +R  + + A 
Sbjct: 145 RLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKL-VAKISNVNERTERTDNAI 203

Query: 218 SNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE---GKPRGFGFINFEDHESA 274
           S+   I VKN+  + T ++   +F +FG    A +    E   G+   + FI F++  SA
Sbjct: 204 SDGREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASA 263

Query: 275 AKAVDELNDTDFKSQRLYVGRAQKK-YERLQELRK 308
             A+  LN      + L+V +  +K Y   QE+++
Sbjct: 264 DNAL-SLNGAVMNGKPLHVSKVMRKAYLERQEVKR 297

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 116/291 (39%), Gaps = 34/291 (11%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           + +KNL P  ++  +   F   G+IL   +     G+SK    + F    S  +A+ A++
Sbjct: 39  VLVKNLPPNYNHHKVRRYFKTCGSILQIDVTDSTDGDSK-LARIEFS---SYDQALTAVS 94

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQF--GKI 247
             L             KK    ++   +   + I+V N        +   L +Q+    I
Sbjct: 95  RTL-------------KKIGFHQITVEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPI 141

Query: 248 TSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELR 307
            S  L   +    R F +++    E A KA + LN  +  + +L V +     ER +  R
Sbjct: 142 LSIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKL-VAKISNVNERTE--R 198

Query: 308 KQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA---GNSK 364
               +S         G  + VKNL D I  + L   F  FG    A+++  D    G   
Sbjct: 199 TDNAIS--------DGREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHS 250

Query: 365 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQA 415
            + F+ F     A  A++  N  ++ GKPL+V+   RK     Q  +++ A
Sbjct: 251 RYAFITFKNKASADNALS-LNGAVMNGKPLHVSKVMRKAYLERQEVKRLLA 300

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 86/205 (41%), Gaps = 21/205 (10%)

Query: 219 NFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           +   ++V++I  + T E+    F+ F  I  AV+ +D+  + RGFGF++F   +   +A+
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEAL 83

Query: 279 DELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVN------------- 325
            +   T F    L V  A K+ +R ++  +  E S  E   K  G N             
Sbjct: 84  AKARKTKFNGHILRVDIA-KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSM 142

Query: 326 ------LFVKNLDDSIDDE-KLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEAT 378
                 L ++N+  S  D  KL+  F  +G +  A + R   G   GF FV         
Sbjct: 143 LKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCR 202

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKD 403
            A+       + G+ + V  A +K+
Sbjct: 203 IALENTKDLKIDGRKVAVDFAVQKN 227

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 2/88 (2%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKN 385
           LFV+++   + DE+L D F+ F  I  A V++D    S+GFGFV F+  ++  +A+ +  
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 386 QQIVAGKPLYVAIAQRKDVRRSQLAQQI 413
           +    G  L V IA+R+D  RS+   ++
Sbjct: 88  KTKFNGHILRVDIAKRRD--RSKKTSEV 113

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/333 (20%), Positives = 120/333 (36%), Gaps = 86/333 (25%)

Query: 24  APTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
            P+S  S+         +L+V  +   VT+  L D FS    +    V +D   K S G+
Sbjct: 10  VPSSNVSKQNDDGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGF 68

Query: 84  AYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRK------------------- 124
            +V+F   D  + A+ K   T   G   R+  ++R    +K                   
Sbjct: 69  GFVSFAVEDDTKEALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQ 128

Query: 125 ---------------KGSGNIFIKNL-HPAIDNKALHDTFSVFGNILSCKIATDEAGNSK 168
                          KG   + I+N+     D   L   F  +G ++   I     G   
Sbjct: 129 NNEDEDDADGEDSMLKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLC 188

Query: 169 GFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV---------------APHVSKKD----- 208
           GF FV  ++  + + A++    + ++G++V V                P ++ KD     
Sbjct: 189 GFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESG 248

Query: 209 -------------------RQ----SKLEEAKSNFTN------IYVKNIDLETTQEEFEA 239
                              RQ    SK +E+K    N      ++V+N+  + T+E    
Sbjct: 249 NEDAEENHDDEEDENEEEDRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAP 308

Query: 240 LFTQFGKITSAVLERD-SEGKPRGFGFINFEDH 271
            F++FG +  A+   D S G  +G  F+ F+D 
Sbjct: 309 HFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQ 341

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 116/312 (37%), Gaps = 71/312 (22%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++++   + ++ L D FS F  I    +  D    S+GFGFV F  E   KEA+    
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFT---------------------------- 221
               NG  + V     ++DR  K  E     T                            
Sbjct: 88  KTKFNGHILRV-DIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 222 -NIYVKNIDLETTQE-EFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
             + ++N+        + + +F ++G +  A + R  +GK  GF F+  +   +   A++
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 280 ELNDTDFKSQRLYVGRAQKK-----YERLQ----------------------------EL 306
              D     +++ V  A +K     Y++ Q                            E 
Sbjct: 207 NTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEEE 266

Query: 307 RKQYEVSRLEKLAKYQGVN------LFVKNLDDSIDDEKLRDEFAPFGAITSA-KVMRDD 359
            +Q + +   K +K +  N      +FV+N+     +E L   F+ FG++  A  V+   
Sbjct: 267 DRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKS 326

Query: 360 AGNSKGFGFVCF 371
            G +KG  FV F
Sbjct: 327 TGLAKGTAFVAF 338

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 258 GKPRGFGFINFEDHESAAKAVDELN 282
           G+ RG+GF+ F DH++A   +  LN
Sbjct: 550 GRSRGYGFVEFRDHKNALMGLRWLN 574

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNI-LSCKIATDEAGNSKGFGFVHFEEEYSAKEAV 185
           ++F++N+      ++L   FS FG++  +  +     G +KG  FV F+++Y+  E +
Sbjct: 291 SVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNECI 348

>Scas_376.1
          Length = 404

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 98/216 (45%), Gaps = 35/216 (16%)

Query: 223 IYVKNIDLETTQEEFEALFT------QFGKITSAVLER------DSEGKP---RGFGFIN 267
           +++ N+  +TT+EE   LFT      + GK+T   + R       ++GK    +GF +++
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 268 FEDHESAAKAV----DELNDTDF--KSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKY 321
           F+ +E     +     +LN  +   K  + Y GR  K    L  L K    SR+      
Sbjct: 189 FKTNEQMESIIKLSESQLNGRNMLIKDSKSYEGRPDK--NDLVSLSKN-PPSRI------ 239

Query: 322 QGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGFVCFSTPEEATKA 380
               LFV NL     DE L+  F   G I   ++    D+G  KGF F+ F + E AT A
Sbjct: 240 ----LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNA 295

Query: 381 ITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 416
           + +K  + +A +P+ +   + +  R+ +    ++ R
Sbjct: 296 LKDKTCRKIAARPIRMEYGEDRSKRQVKRRDPVEPR 331

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S  L+VG L    T+ LL   F   G +  IR+     +    G+A+++F   +    A+
Sbjct: 237 SRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNAL 296

Query: 99  QKLNYTTIKGRPCRIMWSQ 117
           +      I  RP R+ + +
Sbjct: 297 KDKTCRKIAARPIRMEYGE 315

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 86/222 (38%), Gaps = 53/222 (23%)

Query: 128 GNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAVD 186
           GNIF+  +  ++    L   FS +G ILS K+  D+  G   G+GF+ +     A   + 
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 187 AINGMLLNGQEVYVAPHVSKKDRQS------KLEEAKSNFTNIYVKNID----------- 229
            +NG  +NG  +++  HV +K+R+       K      NF  +++ N+            
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLI 314

Query: 230 -----LETTQEEFEALFTQFGKITSAVLERDS---------------------------- 256
                +E  ++E    F  F  I+    +R +                            
Sbjct: 315 TPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNA 374

Query: 257 --EGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRA 296
             E   +G+GFI   +HE A  A++  N   +   RL V +A
Sbjct: 375 QDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKA 416

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 21/106 (19%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM------------RDDA----- 360
           ++  Q  NL+VK++  S  DE L D +  FG I S KV+             +D+     
Sbjct: 534 MSNQQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDND 593

Query: 361 ---GNSKGFGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 402
              G+S+G+GFV F +P +A KAI   +  Q+   + L V+ AQ++
Sbjct: 594 LPVGSSRGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 25/102 (24%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVL-------------ERDSE-------GKP 260
           +N+YVK+I L  T E+    +  FG+I S  +               DS        G  
Sbjct: 540 SNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSS 599

Query: 261 RGFGFINFEDHESAAKAVDELNDTDF---KSQRLYVGRAQKK 299
           RG+GF++FE    AAKA+  LN   +   K Q L V  AQK+
Sbjct: 600 RGYGFVSFESPLDAAKAI--LNTDGYQVSKDQVLSVSFAQKR 639

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDE 280
           NI+V  I    +  E   LF+++G I S  L  D ++G+P G+GFI++     A+  + E
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 281 LNDTDFKSQRLYVGRAQKKYER 302
           LN        L++    ++ ER
Sbjct: 256 LNGRTVNGSTLFINYHVERKER 277

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 47/100 (47%), Gaps = 20/100 (20%)

Query: 128 GNIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT-------------DEA-------GNS 167
            N+++K++  +  ++ L+D +  FG I+S K+ T             D +       G+S
Sbjct: 540 SNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSS 599

Query: 168 KGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKK 207
           +G+GFV FE    A +A+   +G  ++  +V       K+
Sbjct: 600 RGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 81/234 (34%), Gaps = 58/234 (24%)

Query: 32  NAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDH 91
           N    T   +++VG +  +++   L  LFS  G + S+++  D       GY ++++   
Sbjct: 187 NKHALTYPGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLG 246

Query: 92  DAGRTAIQKLNYTTIKGRPC------------RIMWSQRDPSLRKKGSGNIFIKNL---H 136
                 I++LN  T+ G               RI W     +        +FI NL   +
Sbjct: 247 SQASLCIKELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHN 306

Query: 137 P-------------AIDNKALHDTFSVF------------------------GNILSCKI 159
           P              +  K L   F  F                        G++ S K 
Sbjct: 307 PEKVETLITPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKS 366

Query: 160 ATDEAGNS------KGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKK 207
           + +  GN+      KG+GF+       A  A++  NG + +G  + V   V  K
Sbjct: 367 SNNTNGNAQDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHK 420

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 103/217 (47%), Gaps = 26/217 (11%)

Query: 205 SKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSA-VLERD-------- 255
           S K+ +S +++++ N   +++ N+  +TT+E+         K T   + E D        
Sbjct: 99  SAKESESSVKDSRKN--GVWIGNLSFDTTKEDITRFIVGKTKGTDVEITEEDLVRVNMPL 156

Query: 256 --SEGKP---RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQY 310
             ++GK    +GF +++F+  E    A+ +L+++    + L + +  K YE       + 
Sbjct: 157 AKNDGKQIKNKGFCYVDFKTQEQVEAAI-KLSESQLNGRNLLI-KNSKSYE------GRP 208

Query: 311 EVSRLEKLAKYQGVN-LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGF 368
           + + L  ++K      LFV NL     DE LR  F   G I   ++    D+G  KGF F
Sbjct: 209 DKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAF 268

Query: 369 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 405
           V F   E AT A+ +K+ + +AG+PL +   + +  R
Sbjct: 269 VDFKNEEGATNALKDKSCRKIAGRPLRMEFGEDRSKR 305

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 81/190 (42%), Gaps = 25/190 (13%)

Query: 20  DQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           D ++  ++ ESE++  D+    +++G L    T+  +          + + +  + + + 
Sbjct: 93  DGESKDSAKESESSVKDSRKNGVWIGNLSFDTTKEDITRFIVGKTKGTDVEITEEDLVRV 152

Query: 80  SL-------------GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR-----DPS 121
           ++             G+ YV+F   +    AI KL+ + + GR   I  S+      D +
Sbjct: 153 NMPLAKNDGKQIKNKGFCYVDFKTQEQVEAAI-KLSESQLNGRNLLIKNSKSYEGRPDKT 211

Query: 122 LRKKGSGN-----IFIKNLHPAIDNKALHDTFSVFGNILSCKIAT-DEAGNSKGFGFVHF 175
                S N     +F+ NL     ++ L   F   G I+  ++AT  ++G  KGF FV F
Sbjct: 212 DLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDF 271

Query: 176 EEEYSAKEAV 185
           + E  A  A+
Sbjct: 272 KNEEGATNAL 281

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S  L+VG L    T+ LL   F   G +  IR+     +    G+A+V+F + +    A+
Sbjct: 222 SRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNAL 281

Query: 99  QKLNYTTIKGRPCRIMWSQ 117
           +  +   I GRP R+ + +
Sbjct: 282 KDKSCRKIAGRPLRMEFGE 300

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 79/181 (43%), Gaps = 21/181 (11%)

Query: 25  PTSTESENAKVD----TSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS 80
           P S E+ N +VD     S   L+V    P VT+A + ++F P G++  I++         
Sbjct: 33  PQSYENFNNRVDDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKILN------- 85

Query: 81  LGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR-DPSLRKKGSGNIFIKNLHPAI 139
            G+A+V F + ++   AIQ +        P  +++S++  P  R      + I+NL    
Sbjct: 86  -GFAFVEFEEAESASQAIQNVAGKMFADYPLEVVFSKKLKPRFR------VIIRNLPEGC 138

Query: 140 DNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVY 199
             + L D      N L    ++    +  G G + F  E   +EA++ +N +   G  + 
Sbjct: 139 AWQELKDL--ARDNQLETTFSSVNTRDFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLA 196

Query: 200 V 200
           V
Sbjct: 197 V 197

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 313 SRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFS 372
           +R++   +     LFVK     + D ++++ F PFGA+   K++        GF FV F 
Sbjct: 41  NRVDDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKIL-------NGFAFVEFE 93

Query: 373 TPEEATKAITEKNQQIVAGKPLYVAIAQR 401
             E A++AI     ++ A  PL V  +++
Sbjct: 94  EAESASQAIQNVAGKMFADYPLEVVFSKK 122

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           T ++VK    + T  E + +F  FG +    +         GF F+ FE+ ESA++A+
Sbjct: 52  TRLFVKPFPPDVTDAEMKEIFEPFGALKEIKILN-------GFAFVEFEEAESASQAI 102

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPTVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           SL+VG+L PT TEA L  LF +   SV ++RV  D IT  S  + +V F D    R A+ 
Sbjct: 163 SLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA 222

Query: 100 KLNYTTIKGRPCRIMWS 116
           ++N    +GR  R+ ++
Sbjct: 223 EMNGVWCQGRQLRVAYA 239

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAI 188
            +FI  L   I    LH  F  FGNILS K+        +G GFV FE    A+ A+  +
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKVPP-----GRGCGFVRFENRMDAEAAIQGM 381

Query: 189 NGMLLNGQEVYVA 201
            G ++ G  + ++
Sbjct: 382 QGFIVGGNAIRLS 394

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 92/233 (39%), Gaps = 63/233 (27%)

Query: 29  ESENAKVDTSSA---SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCR-------DAITK 78
           E  +  V TSS    +L++G+LDP+  EA +  ++  +G    +++ R          T 
Sbjct: 8   EPPSTTVQTSSEPPRTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTS 67

Query: 79  TSL----------------------------GYAYVNFHDHDAGRTAIQKLNYTTIKG-- 108
           ++L                            GY +V F +    +  +Q LN T +    
Sbjct: 68  STLSASHVDEERIQINGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVV 126

Query: 109 -------------RPCRIMWS-----QRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSV 150
                        R  R+ W+     Q D     + S  +F+ +L P      L   F  
Sbjct: 127 SPTTRNPTNPTGKRNFRLNWASGATLQSDIPATPEFS--LFVGDLSPTATEAHLLSLFQT 184

Query: 151 -FGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
            F ++ + ++ TD   G S+ FGFV F +E   + A+  +NG+   G+++ VA
Sbjct: 185 KFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVA 237

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           DT++ ++++G L   ++E  L+ LF P G++ S++V          G  +V F +     
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAE 375

Query: 96  TAIQKLNYTTIKGRPCRIMWSQ 117
            AIQ +    + G   R+ W +
Sbjct: 376 AAIQGMQGFIVGGNAIRLSWGR 397

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 222 NIYVKNIDLETTQEEFEALF-TQFGKI-TSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
           +++V ++    T+    +LF T+F  + T  V+     G  R FGF+ F D +   +A+ 
Sbjct: 163 SLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA 222

Query: 280 ELNDTDFKSQRLYVGRAQKKYERL 303
           E+N    + ++L V  A  +   L
Sbjct: 223 EMNGVWCQGRQLRVAYATPRNNLL 246

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 90/198 (45%), Gaps = 19/198 (9%)

Query: 223 IYVKNIDLETTQEEFEALFTQFG-KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDEL 281
           ++V N    +T E  +ALF+Q+G  + S  L        R F +I+F   + A  A+ +L
Sbjct: 185 LWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFDSNRRFAYIDFASSDEANTAMSKL 244

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLD-DSIDDEKL 340
           N+T      L V ++        E  K+ + + LEK        +F++ LD   +   KL
Sbjct: 245 NNTSHDGYILVVKKSNP-----HEKSKRTDAATLEKR------EIFIRKLDFYKVSLSKL 293

Query: 341 RDEFAPFGAITSAKV-MRDDAGNSK----GFGFVCFSTPEEATKAITEKNQQIVAGKPLY 395
                 +G +    +   +D+ NS     GF FV ++  E A KA+ E N  +  G+ L 
Sbjct: 294 TKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKAL-ELNMSVFEGRVLA 352

Query: 396 VAIAQRKDVRRSQLAQQI 413
           V+IA RK     Q  ++I
Sbjct: 353 VSIADRKPYLERQEVKRI 370

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 118/277 (42%), Gaps = 29/277 (10%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIG-SVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           A+L+V    P  T   L  LFS  G SV S+R+       ++  +AY++F   D   TA+
Sbjct: 183 ATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKF-DSNRRFAYIDFASSDEANTAM 241

Query: 99  QKLNYTTIKGRPCRIMWSQRDPSLRKKGSGN-----IFIKNL-HPAIDNKALHDTFSVFG 152
            KLN T+  G    +  S      ++  +       IFI+ L    +    L      +G
Sbjct: 242 SKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKREIFIRKLDFYKVSLSKLTKLVEKYG 301

Query: 153 NI--LSCKIATDEAGNSK---GFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA-----P 202
            +  +S   + D   ++K   GF FV +  E SA++A++ +N  +  G+ + V+     P
Sbjct: 302 PVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALE-LNMSVFEGRVLAVSIADRKP 360

Query: 203 HVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGK-----ITSAVLERDSE 257
           ++ +++ +  L   K     I +     + ++++  AL T+        I +  L  D E
Sbjct: 361 YLERQEVKRILNTKKPQNDMISMYPFTDKVSKDQLRALITEKASLKDEDIKAIYLVADHE 420

Query: 258 GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVG 294
           G       I  E    AAK    L+  +FK + L  G
Sbjct: 421 G-----AVIQLESERIAAKVTMALHGIEFKRKVLKCG 452

>Scas_705.22
          Length = 869

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 8/173 (4%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD------EAGNSKGFGFVHFEEEYSAK 182
           +IFIKNL+    +  L   F  F   +  ++ T       +   S GFGF  F  +  A 
Sbjct: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701

Query: 183 EAVDAINGMLLNGQEVYV--APHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240
             + A++G +++G  + +  +      +  S  +  K     I VKN+  E T+++   L
Sbjct: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFEL 761

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
           F  FG++ S  + +  +   RGF F+ F   + A  A+D+L       +RL +
Sbjct: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 3/93 (3%)

Query: 315 LEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFST 373
           +EK++K     LF++N+  +  ++  R  F PFG +    V  D   G SKGF ++ F  
Sbjct: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377

Query: 374 PEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 406
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 78/195 (40%), Gaps = 14/195 (7%)

Query: 20  DQQTAPTSTESENAKV-DTSSASLYVGELDPTVTEALLYDLFSPIGS--VSSIRVCRD-- 74
           D     ++ E E+  V D  + S+++  L+ T T   L   F       V+ ++   D  
Sbjct: 620 DSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPK 679

Query: 75  -AITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIK 133
            A    S+G+ +  F   +     I  L+ T I G   ++  S R  S     S      
Sbjct: 680 HADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKI 739

Query: 134 --------NLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAV 185
                   NL      K + + F+ FG + S ++      +++GF FV F     A+ A+
Sbjct: 740 KSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAM 799

Query: 186 DAINGMLLNGQEVYV 200
           D + G+ L G+ + +
Sbjct: 800 DQLQGVHLLGRRLVM 814

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 82/216 (37%), Gaps = 42/216 (19%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281
           I VKN    TT+EE   LF  FGK+   ++       P G    + + D  S   A  +L
Sbjct: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLM------PPSGTIAIVEYRDTTSGRSAFTKL 569

Query: 282 NDTDFKSQRLYVGRAQKKY-----------------ERLQELRKQY------------EV 312
               FK   +Y+ +  K                   E + E++               E 
Sbjct: 570 AFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEIMDSTDKTSNEE 629

Query: 313 SRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKV------MRDDAGNSKGF 366
              E +A    V++F+KNL+ +    +L   F  F     A+V         D   S GF
Sbjct: 630 HEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGF 689

Query: 367 GFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
           GF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 690 GFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%)

Query: 37  TSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRT 96
           + +  L++  +  T TE     LF P G +  + V  D  T  S G+AY+ F D      
Sbjct: 324 SKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQ 383

Query: 97  AIQKLNYTTIKGRPCRIM 114
           A  +L+    +GR   I+
Sbjct: 384 AYIELDKQIFQGRLLHIL 401

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAV 185
           +G +F++N+            F  FG +    +A D   G SKGF ++ F++   A +A 
Sbjct: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385

Query: 186 DAINGMLLNGQEVYVAPHVSKK 207
             ++  +  G+ +++ P  +KK
Sbjct: 386 IELDKQIFQGRLLHILPADAKK 407

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 75/182 (41%), Gaps = 14/182 (7%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK------PRGFGFINFEDHESA 274
            +I++KN++  TT  E    F  F     A ++   + K        GFGF  F   E A
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDS 334
              +  L+ T     R+ +        +L   +     +   K  K +   + VKNL   
Sbjct: 701 NAVISALDGTVIDGHRIQL--------KLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFE 752

Query: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
              + + + F  FG + S +V +    +++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812

Query: 395 YV 396
            +
Sbjct: 813 VM 814

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 326 LFVKNLDDSIDDEKLRDEFA----------PFGA-ITSAKVMRDDAGNSKGFGFVCFSTP 374
           + VK L   + D+ L+  F           P  + IT  K++R+  G S+ F F+ +   
Sbjct: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63

Query: 375 EEATKAITEKNQQIVAGKPLYVAIAQ 400
           E+A  A+   N   +    L V++A+
Sbjct: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 247 ITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQ 297
           IT   + R+ EG+ R F FI + + E A  AV+  N +   + +L V  A+
Sbjct: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 154 ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
           I   KI  +  G S+ F F+ +  E  A +AV+  NG  +N  ++ V+
Sbjct: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVS 86

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 37  TSSASLYVGELDPTVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           T   SL+VG+L PT TEA L  LF +   SV ++RV  D IT  S  + +V F + +  R
Sbjct: 231 TPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERR 290

Query: 96  TAIQKLNYTTIKGRPCRIMWS 116
            A+ ++N    +GR  R+ ++
Sbjct: 291 RALIEMNGVHFQGRTLRVAYA 311

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F+  L P +  + L   F  FGNILS KI        K  GFV FE +  A+ A+  + 
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIPP-----GKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 190 GMLL 193
           G +L
Sbjct: 524 GFVL 527

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 62/146 (42%), Gaps = 17/146 (11%)

Query: 169 GFGFVHFEEEYSAKEA-----------VDAINGMLLN--GQEVYVAPHVSKKDRQSKLEE 215
           G+ FV FE +  A+E            V    G  +N  GQ  +     S    QS +  
Sbjct: 171 GYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIPT 230

Query: 216 AKSNFTNIYVKNIDLETTQEEFEALF-TQFGKI-TSAVLERDSEGKPRGFGFINFEDHES 273
                 +++V ++    T+ +  +LF T+F  + T  V+     G  R FGF+ F + E 
Sbjct: 231 TPE--YSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEE 288

Query: 274 AAKAVDELNDTDFKSQRLYVGRAQKK 299
             +A+ E+N   F+ + L V  A  +
Sbjct: 289 RRRALIEMNGVHFQGRTLRVAYATPR 314

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 35  VDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAG 94
            D ++ +++VG L PTV E  L  +F P G++ SI++             +V F      
Sbjct: 462 TDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKI------PPGKNCGFVKFEHKIDA 515

Query: 95  RTAIQKLNYTTIKGRPCRIMW 115
             AIQ L    +   P R+ W
Sbjct: 516 EAAIQGLQGFVLVENPIRLSW 536

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 48/113 (42%), Gaps = 21/113 (18%)

Query: 130 IFIKNLHPAIDNKALHDTFSV-FGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDA 187
           +F+ +L P      L   F   F ++ + ++ TD   G S+ FGFV F  E   + A+  
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 188 INGMLLNGQEVYVA-------------------PHVSKKDRQSKLEEAKSNFT 221
           +NG+   G+ + VA                    HV  ++  SK E  KSN +
Sbjct: 296 MNGVHFQGRTLRVAYATPRSTTVMHTQGNNPHDHHVDVRNTISKAELEKSNLS 348

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           +FV  L  ++ +++LR  F PFG I S K+        K  GFV F    +A  AI
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIPP-----GKNCGFVKFEHKIDAEAAI 519

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPTVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           SL+VG+L PT TEA L  LF +   SV ++RV  D +T +S  + +V F D D  R A+ 
Sbjct: 193 SLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALI 252

Query: 100 KLNYTTIKGRPCRIMWS 116
           +++    +GR  R+ ++
Sbjct: 253 EMSGKWFQGRALRVAYA 269

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 13/116 (11%)

Query: 12  LEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRV 71
           +  +++ND       S  S     D ++ +++VG L P  TE  L  LF P G + ++R+
Sbjct: 339 ISNMRVND-------SLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI 391

Query: 72  CRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGS 127
                        +V F        +IQ L    + G P R+ W +   S  K  S
Sbjct: 392 PNGK------NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAKTNS 441

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 5/146 (3%)

Query: 262 GFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK--YERLQELRKQYEVSRLEKLA 319
           G+ F+ FE  + A  A+  LN T   +       +Q    ++R   L      +    + 
Sbjct: 129 GYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 320 KYQGVNLFVKNLDDSIDDEKLRDEF-APFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEA 377
                +LFV +L  +  +  L   F   F ++ + +VM D   G+S+ FGFV F   +E 
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 378 TKAITEKNQQIVAGKPLYVAIAQRKD 403
            +A+ E + +   G+ L VA A  ++
Sbjct: 248 RRALIEMSGKWFQGRALRVAYATPRN 273

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F+  L P      L   F  FG IL+ +I      N K  GFV FE+   A+ ++  + 
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRIP-----NGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 190 GMLLNGQEVYVA 201
           G ++ G  + ++
Sbjct: 417 GFIVGGSPIRLS 428

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 21/140 (15%)

Query: 82  GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKK-----GSG-------- 128
           GY +V F      + A+  LN T +         SQ +P+ ++       SG        
Sbjct: 129 GYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 129 -----NIFIKNLHPAIDNKALHDTFSV-FGNILSCKIATDE-AGNSKGFGFVHFEEEYSA 181
                ++F+ +L P      L   F   F ++ + ++ TD   G+S+ FGFV F +E   
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 182 KEAVDAINGMLLNGQEVYVA 201
           + A+  ++G    G+ + VA
Sbjct: 248 RRALIEMSGKWFQGRALRVA 267

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKN 385
           +FV  L     + +LR  F PFG I + ++      N K  GFV F    +A  +I    
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRI-----PNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 386 QQIVAGKPLYVA 397
             IV G P+ ++
Sbjct: 417 GFIVGGSPIRLS 428

>Kwal_14.1851
          Length = 535

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPTVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           SL+VG+L PT TEA L  LF     SV ++RV  D IT  S  + +V F D    R A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 100 KLNYTTIKGRPCRIMWS 116
           ++N    +GR  R+ ++
Sbjct: 235 EMNGVWCQGRNLRVAYA 251

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +FI  L   I  + LH  FS FG I++ KI        KG GFV +     A+ A+  + 
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKIPP-----GKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 190 GMLLNGQEVYVAPHVSKKD--RQSKLEEAKS 218
           G ++ G  + ++   +  D  R S +++  S
Sbjct: 453 GFIVGGNPIRLSWGRTSADTGRHSAMQDMPS 483

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 21  QQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTS 80
           Q TAP S     A  + ++ ++++G L   ++E  L+ LFSP G++ ++++         
Sbjct: 382 QPTAPRS-----AFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKI------PPG 430

Query: 81  LGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMW 115
            G  +V +        AIQ +    + G P R+ W
Sbjct: 431 KGCGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSW 465

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKN 385
           +F+  L   I + +L   F+PFGAI + K+        KG GFV ++   +A  AI    
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKIPP-----GKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 386 QQIVAGKPLYVA 397
             IV G P+ ++
Sbjct: 453 GFIVGGNPIRLS 464

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 130 IFIKNLHPAIDNKALHDTF-SVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDA 187
           +F+ +L P      L   F   F ++ + ++ TD   G S+ FGFV F +E   + A+  
Sbjct: 176 LFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVE 235

Query: 188 INGMLLNGQEVYVA 201
           +NG+   G+ + VA
Sbjct: 236 MNGVWCQGRNLRVA 249

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 223 IYVKNIDLETTQEEFEALF-TQFGKI-TSAVLERDSEGKPRGFGFINFEDHESAAKAVDE 280
           ++V ++    T+    +LF  +F  + T  V+     G  R FGF+ F D +   +A+ E
Sbjct: 176 LFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVE 235

Query: 281 LNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSR 314
           +N    + + L V  A  +   + +L +    S+
Sbjct: 236 MNGVWCQGRNLRVAYATPRNNVMWQLTQNSHQSQ 269

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 85/401 (21%), Positives = 148/401 (36%), Gaps = 128/401 (31%)

Query: 128 GNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDA 187
           GN+FI  +   +    L +TF  FG I S KI  D    + G GF+ F     A E +  
Sbjct: 139 GNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFDNK--NVGIGFLSFMLGSEAAECIRC 196

Query: 188 INGMLL---NGQE--VYVAPHVSKKDRQSKL----------------------------- 213
           +NG  +   NG E  +++  H+ +K+R+                                
Sbjct: 197 MNGTKIRSDNGDEGTLFINYHIERKERERLFLSHESSDSSASSLSVRNMRVNTHHRGKHN 256

Query: 214 -EEAKSNFTN-----------IYVKNI--DLETTQEEFEALFTQFGKIT--SAVLERD-S 256
             E  S  TN           +++ N+  D++   E  + L   F  +T  S     D S
Sbjct: 257 SPELNSWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFIDDLTEAFPSVTVISYYFPYDHS 316

Query: 257 EGKPRGFGFINFEDHESAAKAVDELNDT--DFKSQRLYVGRAQKK----------YERLQ 304
             + +G+GFI  ++++ A + + E++    +F    +   +A  K          Y +  
Sbjct: 317 LNQYKGYGFIKLQNNDQARRIIHEISTDCFEFCGNHIIANKASNKDNKTTSHFTLYTKTT 376

Query: 305 ELRKQYEVSRLEKLAKYQG----------------------------------------- 323
           E   +   + LE+ + Y G                                         
Sbjct: 377 ETNPKTRNNYLEQTSPYAGGINTFPPSMNNYTFGYDLYPPIKRGSHNLPYIYGLPVPLEG 436

Query: 324 ---VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM------RDDA-----------GNS 363
               N++VK++     D+ L + + PFG I S K++      R++            G S
Sbjct: 437 QQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGIS 496

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAG--KPLYVAIAQRK 402
           +G+GFV F+ P +A  AI   +   + G  + L V+ AQ+K
Sbjct: 497 RGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKK 537

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 79/169 (46%), Gaps = 30/169 (17%)

Query: 122 LRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT--------------DEA--- 164
           L  +   NI++K++     +K L + +  FGNI+SCKI T              DE    
Sbjct: 434 LEGQQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPF 493

Query: 165 GNSKGFGFVHFEEEYSAKEAVDAINGMLLNG--QEVYVA-PHVSKKDRQSKLEEAKSNFT 221
           G S+G+GFV+F     A  A+ + +G  L G  Q++ V+     KKD QS L+E+ SN +
Sbjct: 494 GISRGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSLLDESLSNES 553

Query: 222 NIYVKNIDLETTQEEFEALFTQFGK----------ITSAVLERDSEGKP 260
           +  + N +    +E+      +FG+          + S    R+  GKP
Sbjct: 554 SDQIDNSEKTNEKEKRNHSSAKFGQQQYNKKFMNALMSNFYHRNYVGKP 602

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVL---------ERDSE--------GKPRGF 263
           +NIYVK++ L+ + ++    +  FG I S  +         E+ +         G  RG+
Sbjct: 440 SNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGY 499

Query: 264 GFINFEDHESAAKAVDELNDTDFKS--QRLYVGRAQKKYERLQEL 306
           GF+ F +   AA A+   +    +   Q+L V  AQKK +  Q L
Sbjct: 500 GFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSL 544

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVS-SIRVCRDAITKTS-----LGYAYVNFHDHD 92
           S  LY+G+L+P  TE  +  ++S +G  +  +++ + +    S      GY +V F +  
Sbjct: 55  STQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQM 114

Query: 93  AGRTAIQK--LNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTF-S 149
           A   A+ K  L          ++ W+    +   + +  +F+ +L P +    L + F S
Sbjct: 115 AASNALMKSGLRVPMDSNYALKLNWASFATAPGSEFT--LFVGDLAPNVTEAQLFELFIS 172

Query: 150 VFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
            + + L+ KI  D+  G SKG+GFV F  E   + A+  + G  LNG+ + V 
Sbjct: 173 RYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVG 225

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 1/100 (1%)

Query: 15  LKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF-SPIGSVSSIRVCR 73
           L++  D   A     +  A    S  +L+VG+L P VTEA L++LF S   S  + ++  
Sbjct: 125 LRVPMDSNYALKLNWASFATAPGSEFTLFVGDLAPNVTEAQLFELFISRYSSTLNAKIVF 184

Query: 74  DAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRI 113
           D  T  S GY +V F +    + A+ ++  T + GR  R+
Sbjct: 185 DQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRV 224

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/184 (19%), Positives = 77/184 (41%), Gaps = 15/184 (8%)

Query: 125 KGSGNIFIKNLHPAIDNKALHDTFSVFGN-------ILSCKIATDEAGNSKGFGFVHFEE 177
           + S  +++ +L+P      +   +S+ G        I S       A N+ G+ FV F  
Sbjct: 53  QNSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPN 112

Query: 178 EYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEE- 236
           + +A       N ++ +G  V +  + + K   +    A  +   ++V ++    T+ + 
Sbjct: 113 QMAAS------NALMKSGLRVPMDSNYALKLNWASFATAPGSEFTLFVGDLAPNVTEAQL 166

Query: 237 FEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
           FE   +++    +A +  D   G  +G+GF+ F +     +A+ E+  T    + + VG 
Sbjct: 167 FELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGT 226

Query: 296 AQKK 299
             K 
Sbjct: 227 TSKN 230

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 326 LFVKNLDDSIDDEKLRDEF-APFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITE 383
           LFV +L  ++ + +L + F + + +  +AK++ D   G SKG+GFV F    E  +A+ E
Sbjct: 152 LFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVE 211

Query: 384 KNQQIVAGKPLYVAIAQRK 402
                + G+ + V    + 
Sbjct: 212 MQGTFLNGRAIRVGTTSKN 230

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 35  VDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAG 94
            D ++ ++++G L   +TE  L   F P G +  +++          G  +V + D  + 
Sbjct: 311 TDPNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDRISA 364

Query: 95  RTAIQKLNYTTIKGRPCRIMW 115
            TAI K+    I     R+ W
Sbjct: 365 ETAISKMQGFPIGNSRIRLSW 385

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +FI  L   I    L   F  FG I+  KI        KG GFV + +  SA+ A+  + 
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKIPVG-----KGCGFVQYVDRISAETAISKMQ 372

Query: 190 GM 191
           G 
Sbjct: 373 GF 374

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 5/69 (7%)

Query: 315 LEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTP 374
           L +        +F+  L   I +++LR  F PFG I   K+        KG GFV +   
Sbjct: 307 LSQFTDPNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVG-----KGCGFVQYVDR 361

Query: 375 EEATKAITE 383
             A  AI++
Sbjct: 362 ISAETAISK 370

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           I+   +++E T+ +   +F+QFG  T   L RD E G+ RGFGF+ +ED  S   AVD L
Sbjct: 36  IHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNL 95

Query: 282 NDTDFKSQRLYV 293
           N  +   + L V
Sbjct: 96  NGVNLCGRVLKV 107

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILS 156
           +IQKL+ T ++     I+  +     + K    I    L+  +    +   FS FG    
Sbjct: 6   SIQKLSETELEHG---ILSEEASWHYQYKDQAYIHFSGLNVELTEGDILTVFSQFGVPTD 62

Query: 157 CKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
            K+  D E G S+GFGF+ +E++ S   AVD +NG+ L G+ + V
Sbjct: 63  LKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A ++   L+  +TE  +  +FS  G  + +++ RD  T  S G+ ++ + D  +   A+ 
Sbjct: 34  AYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVD 93

Query: 100 KLNYTTIKGRPCRI 113
            LN   + GR  ++
Sbjct: 94  NLNGVNLCGRVLKV 107

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 344 FAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           F+ FG  T  K++RD + G S+GFGF+ +        A+   N   + G+ L V
Sbjct: 54  FSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/261 (19%), Positives = 95/261 (36%), Gaps = 30/261 (11%)

Query: 170 FGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA---PHVSKKDRQSKL-------EEAKSN 219
            G V F        A+   +G  LNG+ ++V    P  ++  R           + A   
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
              ++V  +      +E + +F   G +  A +  D +GK RGFG +     E    A+ 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 280 ELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSR----------------LEKLAKYQG 323
               T++K + L V   +    R         + R                ++ LA   G
Sbjct: 121 HWTGTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTG 180

Query: 324 VN----LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATK 379
            +    +F +N+  S  +  L D F     +   K++ +  G+     +  F TPE+A  
Sbjct: 181 GDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADI 240

Query: 380 AITEKNQQIVAGKPLYVAIAQ 400
            I++ ++       L V  A+
Sbjct: 241 CISKLDKYSYGDHELKVTYAR 261

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/198 (19%), Positives = 73/198 (36%), Gaps = 30/198 (15%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F+  L  +++ + L D F   G++L   + TD  G S+GFG V+   +    +A+    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 190 GMLLNGQEVYV------------------APHVSKKDRQSKLEEAKSNF----------- 220
           G    G+ + V                   P   + +  + L+    +            
Sbjct: 124 GTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTGGDR 183

Query: 221 -TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
            + I+ +N+   TT+ +   LF     +    L  + EG      +  FE  E A   + 
Sbjct: 184 NSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADICIS 243

Query: 280 ELNDTDFKSQRLYVGRAQ 297
           +L+   +    L V  A+
Sbjct: 244 KLDKYSYGDHELKVTYAR 261

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 35  VDTSSASLYVGELDPTVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDA 93
           + T   SL+VG+L P  TEA L  LF +   SV ++RV  D IT  S  + +V F +   
Sbjct: 154 LPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETE 213

Query: 94  GRTAIQKLNYTTIKGRPCRIMWSQ-RDPSLRKKGSGNI 130
            R A+ ++N    +GR  R+ ++  R+   ++  SGN+
Sbjct: 214 RRNALIEMNGVQFQGRQLRVAYATPRNNVAQQHLSGNL 251

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 16/84 (19%)

Query: 37  TSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRV-----CRDAITKTSLGYAYVNFHDH 91
            SS +++VG L+P + E  L++LF P G+++ +++     C            +V +++ 
Sbjct: 442 VSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQC-----------GFVKYNER 490

Query: 92  DAGRTAIQKLNYTTIKGRPCRIMW 115
                AI  L    I G P R+ W
Sbjct: 491 LEAEAAINGLQGFIIMGSPIRLSW 514

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 85/215 (39%), Gaps = 55/215 (25%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRD------AITKTSL------------- 81
           +L++G+LDP   E ++  ++  +G    +++ +        I  TS+             
Sbjct: 21  TLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEING 80

Query: 82  --------------GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR--DPSLRK- 124
                         GY +V F   +  + A+  LN T I    C    S+R  D   RK 
Sbjct: 81  VSFIDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRKF 139

Query: 125 -----KGSG-----------NIFIKNLHPAIDNKALHDTFSV-FGNILSCKIATDE-AGN 166
                 G+            ++F+ +L P      L   F   + ++ + ++ TD   G 
Sbjct: 140 RLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGA 199

Query: 167 SKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
           S+ FGFV F  E   + A+  +NG+   G+++ VA
Sbjct: 200 SRCFGFVRFANETERRNALIEMNGVQFQGRQLRVA 234

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186
           S  +F+  L+P I+   L + F  FG I   KI        K  GFV + E   A+ A++
Sbjct: 444 STTVFVGGLNPNINELQLFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAEAAIN 498

Query: 187 AINGMLLNGQEVYVA 201
            + G ++ G  + ++
Sbjct: 499 GLQGFIIMGSPIRLS 513

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 319 AKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEAT 378
           A      +FV  L+ +I++ +L + F PFG IT  K+        K  GFV ++   EA 
Sbjct: 440 AGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAE 494

Query: 379 KAITEKNQQIVAGKPLYVA 397
            AI      I+ G P+ ++
Sbjct: 495 AAINGLQGFIIMGSPIRLS 513

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 66/160 (41%), Gaps = 32/160 (20%)

Query: 169 GFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKL------EEAKSNFTN 222
           G+ FV FE    A++A      + LN   +   P++S     SK        + + N+ N
Sbjct: 95  GYCFVEFESFEDAQQA------LTLNATPI---PNISCNTTASKRTNDDGKRKFRLNWAN 145

Query: 223 ---------------IYVKNIDLETTQEEFEALF-TQFGKI-TSAVLERDSEGKPRGFGF 265
                          ++V ++    T+ +  +LF T++  + T  V+     G  R FGF
Sbjct: 146 GATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGF 205

Query: 266 INFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQE 305
           + F +      A+ E+N   F+ ++L V  A  +    Q+
Sbjct: 206 VRFANETERRNALIEMNGVQFQGRQLRVAYATPRNNVAQQ 245

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 101/227 (44%), Gaps = 16/227 (7%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFG-NILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAI 188
           +++ N  P  D + L   F   G   LS ++ +      + F +V      SA  A + +
Sbjct: 110 LWVTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANTL 169

Query: 189 NGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNID-LETTQEEFEALFTQFGKI 247
           NGM L+G  + V      + R  + +        + ++ +D ++ T E+ + L   FG++
Sbjct: 170 NGMDLDGYNLVVKLS-DPESRAQRSDAGTIEKREVLIRGLDFIKVTIEKLQGLVEPFGEV 228

Query: 248 TSAVLERDSEGKP----RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERL 303
              ++   S+       RGF F+ ++D  +A  A+   N T F+ +RL V  A +K    
Sbjct: 229 EKLIMPPSSDSADGRHNRGFAFVTYKDAAAAEAALALHN-TVFEDRRLTVAMADRKPYLE 287

Query: 304 QELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD---EFAPF 347
           ++  KQ  VSR     K Q   L +  + D++  E +R    E APF
Sbjct: 288 RQKVKQILVSR-----KPQPNILGLFPISDTLSKECIRSLVKEKAPF 329

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEA 184
           +F+  LH A+D   L  +F  +G+I SC+I  D+ G S+G+GFV F     +K+ 
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQC 171

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITE 383
           LFV  L  ++D+ +L+  F  +G I S +++RD  G S+G+GFV F++ E++ +   E
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
           +  ++V  +     + E +  F ++G I S  + RD +GK RG+GF+ F  +E + +   
Sbjct: 114 YRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFR 173

Query: 280 EL 281
           EL
Sbjct: 174 EL 175

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A +Y G L+  +TE  +  +FS  G    I++ RD  T+ S G+ Y+ + D  +   A+ 
Sbjct: 34  AYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVD 93

Query: 100 KLNYTTIKGRPCRI 113
            LN  TI GR  ++
Sbjct: 94  NLNGATIAGRTIKV 107

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 72/152 (47%), Gaps = 25/152 (16%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK-PRGFGFINFEDHESAAKAVDEL 281
           IY  +++ E T+ +   +F+Q+G      L RD E +  +GFG++ +ED  S   AVD L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 282 NDTDFKSQRLYVGRA--------QKKYERLQ-ELRKQYEVSRLEKLAKYQGVNLFVKNLD 332
           N      + + V  A         +  E +Q EL+K      + +  K+  V L  + ++
Sbjct: 96  NGATIAGRTIKVDHAFYTPRDDDWQYAEAVQNELKKD-----IVREQKHNTVGL--RQIE 148

Query: 333 DSIDDEKL-------RDEFA-PFGAITSAKVM 356
             I++ +L        DEFA P  A++  +VM
Sbjct: 149 SGIEENRLSTEINNQEDEFADPIAAVSRNEVM 180

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 4/105 (3%)

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILS 156
           +IQKL+   ++   C I+ ++       +    I+  +L+  +    +   FS +G  + 
Sbjct: 6   SIQKLSEKELE---CGILSAKASWHKEYEEQAYIYFGSLNKELTEGDILTIFSQYGIPVD 62

Query: 157 CKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
            K+  D E   SKGFG++ +E++ S   AVD +NG  + G+ + V
Sbjct: 63  IKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 344 FAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           F+ +G     K++RD +   SKGFG++ +        A+   N   +AG+ + V
Sbjct: 54  FSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 79/183 (43%), Gaps = 20/183 (10%)

Query: 18  NDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAIT 77
           +DD   A T  E E      S+  L+V      V E+ L ++FSP G +  +++      
Sbjct: 58  HDDHYGALTPNEGE-----LSTTRLFVRPFPFDVQESELNEIFSPFGPMKEVKILN---- 108

Query: 78  KTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHP 137
               G+A+V F + ++   AI ++N  T   +P  +++S+  P   +     + ++NL  
Sbjct: 109 ----GFAFVEFEESESAAKAIDEVNGKTFANQPLEVVYSKLPPQRFR-----MILRNLPE 159

Query: 138 AIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQE 197
            +  + L D      N L    ++       G G + F  E   +EA++ +N +   G  
Sbjct: 160 GVAWQELKDL--ARENNLETTFSSVNTREFDGTGALEFPTEEILEEALEKLNNIEFRGAV 217

Query: 198 VYV 200
           + V
Sbjct: 218 ISV 220

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 7/79 (8%)

Query: 215 EAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESA 274
           E + + T ++V+    +  + E   +F+ FG +    +         GF F+ FE+ ESA
Sbjct: 69  EGELSTTRLFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESA 121

Query: 275 AKAVDELNDTDFKSQRLYV 293
           AKA+DE+N   F +Q L V
Sbjct: 122 AKAIDEVNGKTFANQPLEV 140

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 74/168 (44%), Gaps = 24/168 (14%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++     +    L++ FS FG +   KI         GF FV FEE  SA +A+D +N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESAAKAIDEVN 129

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT- 248
           G     Q + V          SKL   +     + ++N+      +E + L  +    T 
Sbjct: 130 GKTFANQPLEVV--------YSKLPPQR---FRMILRNLPEGVAWQELKDLARENNLETT 178

Query: 249 -SAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
            S+V  R+ +G     G + F   E   +A+++LN+ +F+   + V R
Sbjct: 179 FSSVNTREFDGT----GALEFPTEEILEEALEKLNNIEFRGAVISVER 222

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 23/190 (12%)

Query: 223 IYVKNIDLETTQEEFEALFT------QFGKITSAVLER------DSEGKP---RGFGFIN 267
           +++ N+  +TTQEE            + G++T A + R       ++GK    +GF +++
Sbjct: 107 VWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVD 166

Query: 268 FEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLF 327
           F    +   AV  L++     + L +  A K Y+          +S+           LF
Sbjct: 167 FA-TSAQMDAVIGLSEAQLNGRNLLIKNA-KSYDGRPAKNDLISMSK-----NPPSRILF 219

Query: 328 VKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGFVCFSTPEEATKAITEKNQ 386
           V NL     DE L+  F   G I   ++    D+G  KGF FV F     AT A+T+++ 
Sbjct: 220 VGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSC 279

Query: 387 QIVAGKPLYV 396
           + +AG+PL +
Sbjct: 280 RAIAGRPLRM 289

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L+VG L    T+ LL   F   G +  IR+     +    G+A+V+F D      A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 102 NYTTIKGRPCRIMWSQ 117
           +   I GRP R+ + +
Sbjct: 278 SCRAIAGRPLRMEYGE 293

>Kwal_27.10364
          Length = 443

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 112/254 (44%), Gaps = 30/254 (11%)

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR 118
           LF   G++  I V    +T      A + F D +   +A+ K ++  +  +   +  SQ 
Sbjct: 60  LFKDCGNIKHIDV--KQVTNEDSKVARIEFEDFNDVLSALTK-SHKRLGDQEIIVEQSQ- 115

Query: 119 DPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFG-NILSCKIATDEAGNSKGFGFVHFEE 177
                   +  +++ N  P      L   FS FG  +LS +  +    + + F +V    
Sbjct: 116 --------NSTLWVTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDSHRRFAYVDMAS 167

Query: 178 EYSAKEAVDAINGMLLNGQEVYVA---PHVSKKDRQSKLEEAKSNFTNIYVKNID-LETT 233
              AK  VD ++G +++  E+ +    P  ++K   S + E +     +Y+KN+D    +
Sbjct: 168 SEEAKLIVDRLHGFVVDNHELIIKLSNPLKAEKRTDSDVLERR----QVYLKNLDYFRVS 223

Query: 234 QEEFEALFTQFGKITSAVLERDSE-----GKPR---GFGFINFEDHESAAKAVDELNDTD 285
           +E     F+++G I    L    E      + R   GFGF+ F +  SAA ++ +L+ ++
Sbjct: 224 EEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSL-QLDGSE 282

Query: 286 FKSQRLYVGRAQKK 299
            + +++ V  A +K
Sbjct: 283 LEGRKISVTLADRK 296

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 83/196 (42%), Gaps = 28/196 (14%)

Query: 236 EFEALFTQFGKITSAV----LERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRL 291
           E + LF+QFG    ++    L  DS    R F +++    E A   VD L+     +  L
Sbjct: 132 ELQKLFSQFGGTVLSIRFPSLRYDSH---RRFAYVDMASSEEAKLIVDRLHGFVVDNHEL 188

Query: 292 YVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDD-SIDDEKLRDEFAPFGAI 350
            +     K     +  K+ +   LE+        +++KNLD   + +E +   F+ +G I
Sbjct: 189 II-----KLSNPLKAEKRTDSDVLERR------QVYLKNLDYFRVSEEIISKSFSKYGHI 237

Query: 351 TSAKV-MRDDAGNS-------KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
               +  +++ G S        GFGFV FS    A  ++     ++  G+ + V +A RK
Sbjct: 238 ERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSLQLDGSEL-EGRKISVTLADRK 296

Query: 403 DVRRSQLAQQIQARNQ 418
                Q  +++  R +
Sbjct: 297 AYIERQAVKRLLHRKR 312

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 8/84 (9%)

Query: 200 VAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEG 258
           ++PH      QS   E K N   IY+ N++ E T+ +   +F+++G     +L RD + G
Sbjct: 17  LSPH------QSWHNEYKDN-AYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTG 69

Query: 259 KPRGFGFINFEDHESAAKAVDELN 282
           + +GF ++ +ED  S   AVD LN
Sbjct: 70  ESQGFAYLKYEDQRSTILAVDNLN 93

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           +A +Y+G L+  +TE  +  +FS  G    + + RD  T  S G+AY+ + D  +   A+
Sbjct: 30  NAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAV 89

Query: 99  QKLNYTTIKGRPCRI 113
             LN   I GR  +I
Sbjct: 90  DNLNGFKIGGRALKI 104

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 125 KGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKE 183
           K +  I+I NL+  +    +   FS +G  +   ++ DE  G S+GF ++ +E++ S   
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTIL 87

Query: 184 AVDAINGMLLNGQEVYV 200
           AVD +NG  + G+ + +
Sbjct: 88  AVDNLNGFKIGGRALKI 104

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           S+++G LD    E  L+  FSP G V  IR+ RD+ T    G+AYV F D  +   A+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 101 LNYTTIKGRPCRIMWSQRDPSLRK 124
           LN   I G   ++  S R  ++RK
Sbjct: 367 LNEKKINGNGRKLRVS-RCKNMRK 389

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITE 383
           ++F+ NLD    +E L   F+P G +   +++RD   N  KGF +V F   +   KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 384 KNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRY 421
            N++ + G    + +++ K++R+SQ AQ     N  RY
Sbjct: 367 LNEKKINGNGRKLRVSRCKNMRKSQPAQ-----NSSRY 399

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/115 (20%), Positives = 55/115 (47%), Gaps = 21/115 (18%)

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYV------APHVSKKDRQSKLEEAKSNFTNIY 224
            ++ ++++ + K  +  +NG + +   + +      APH +K+              +++
Sbjct: 265 AYIVYKDKSALKPLLQHLNGFVFHDHHLRIDSVAHPAPHDNKR--------------SVF 310

Query: 225 VKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAV 278
           + N+D E  +E     F+  G++    + RDS+    +GF ++ F+D +S  KA+
Sbjct: 311 IGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL 365

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 316 EKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPE 375
           E+  +Y    L VK     +++ +L + F+P+GA+   K+M        GF FV F  PE
Sbjct: 29  EQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM-------SGFAFVEFEKPE 81

Query: 376 EATKAITEKNQQIVAGKPLYVAIAQ 400
            A +AI + N ++ A  PL V+ ++
Sbjct: 82  SAEQAIKDVNGKMFADMPLTVSYSR 106

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 71/165 (43%), Gaps = 15/165 (9%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           + S+  L+V    P V E  L ++FSP G++  +++          G+A+V F   ++  
Sbjct: 33  EYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS--------GFAFVEFEKPESAE 84

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155
            AI+ +N       P  + +S R P  R +    I I+NL   I  + L D      N L
Sbjct: 85  QAIKDVNGKMFADMPLTVSYS-RMPMPRFR----IKIRNLPEGIAWQELKDLARE--NNL 137

Query: 156 SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
                + +  N  G G + F  E   +EA++ +N     G  + V
Sbjct: 138 ETTFLSVDTSNFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAV 182

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           + +K   P ++   L + FS +G +   K+ +       GF FV FE+  SA++A+  +N
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPESAEQAIKDVN 91

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITS 249
           G +     + V+         S++   +     I ++N+      +E + L  +   + +
Sbjct: 92  GKMFADMPLTVS--------YSRMPMPR---FRIKIRNLPEGIAWQELKDLARE-NNLET 139

Query: 250 AVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
             L  D+     G G + F   E   +A+++LN+ +F+   L V R
Sbjct: 140 TFLSVDTSNF-DGTGALEFSSEEILEEALEKLNNYEFRGNVLAVER 184

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 72/183 (39%), Gaps = 30/183 (16%)

Query: 214 EEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHES 273
           +E + + T ++VK    +  + E + +F+ +G +    L         GF F+ FE  ES
Sbjct: 30  QEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPES 82

Query: 274 AAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDD 333
           A +A+ ++N   F    L V      Y R+   R + ++  L +   +Q        L D
Sbjct: 83  AEQAIKDVNGKMFADMPLTV-----SYSRMPMPRFRIKIRNLPEGIAWQ-------ELKD 130

Query: 334 SIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
              +  L   F           +  D  N  G G + FS+ E   +A+ + N     G  
Sbjct: 131 LARENNLETTF-----------LSVDTSNFDGTGALEFSSEEILEEALEKLNNYEFRGNV 179

Query: 394 LYV 396
           L V
Sbjct: 180 LAV 182

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 15/165 (9%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           + S+  L+V      V E+ L ++F P G++  +++          G+A+V F + ++  
Sbjct: 101 ELSNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKILN--------GFAFVEFEEAESAS 152

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155
            AI+++N  T   +P  +M+S+  P  R +    I +KNL      + L D      N L
Sbjct: 153 KAIEEVNGKTFANQPLEVMFSKM-PVKRFR----ITLKNLPEGCSWQELKDL--ARENNL 205

Query: 156 SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
               ++  + +  G G + F  E    +A++ +N +   G  + V
Sbjct: 206 ETTFSSVNSRDFDGTGALEFPTEEIMNDALEKLNNIEFRGSVISV 250

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 214 EEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHES 273
           +E + + T ++V+   L+  + E   +F  FG +    +         GF F+ FE+ ES
Sbjct: 98  QEGELSNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAES 150

Query: 274 AAKAVDELNDTDFKSQRLYVGRAQKKYER----LQELRKQYEVSRLEKLAK 320
           A+KA++E+N   F +Q L V  ++   +R    L+ L +      L+ LA+
Sbjct: 151 ASKAIEEVNGKTFANQPLEVMFSKMPVKRFRITLKNLPEGCSWQELKDLAR 201

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 72/168 (42%), Gaps = 28/168 (16%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++     +    L++ F  FG +   KI         GF FV FEE  SA +A++ +N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 190 GMLLNGQ--EVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKI 247
           G     Q  EV  +    K+ R             I +KN+    + +E + L  +    
Sbjct: 160 GKTFANQPLEVMFSKMPVKRFR-------------ITLKNLPEGCSWQELKDLARENNLE 206

Query: 248 T--SAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293
           T  S+V  RD +G     G + F   E    A+++LN+ +F+   + V
Sbjct: 207 TTFSSVNSRDFDGT----GALEFPTEEIMNDALEKLNNIEFRGSVISV 250

>Scas_717.41
          Length = 379

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 76/168 (45%), Gaps = 24/168 (14%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++     +    L++ F+ FG +   KI         GF FV FEE  SA +A++ +N
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT- 248
           G     Q + V          SKL   +   T   ++N+    + +E + L  +    T 
Sbjct: 138 GKTFANQPLEVV--------YSKLPVKRYRLT---LRNLPEGCSWQELKDLAREHSLETT 186

Query: 249 -SAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
            S+V  RD +G     G + F + E+   A+++LN+ +F+   + V R
Sbjct: 187 FSSVNTRDFDGT----GALEFANEETLDTALEKLNNIEFRGSVITVER 230

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 7/80 (8%)

Query: 214 EEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHES 273
           +E + + T ++V+    +  + E   +FT FG +    +         GF F+ FE+ +S
Sbjct: 76  QEGELSTTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADS 128

Query: 274 AAKAVDELNDTDFKSQRLYV 293
           AAKA++E+N   F +Q L V
Sbjct: 129 AAKAIEEVNGKTFANQPLEV 148

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 73/163 (44%), Gaps = 15/163 (9%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           S+  L+V      V EA L ++F+P G +  +++          G+A+V F + D+   A
Sbjct: 81  STTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN--------GFAFVEFEEADSAAKA 132

Query: 98  IQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSC 157
           I+++N  T   +P  +++S+  P  R +    + ++NL      + L D      + L  
Sbjct: 133 IEEVNGKTFANQPLEVVYSKL-PVKRYR----LTLRNLPEGCSWQELKDL--AREHSLET 185

Query: 158 KIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
             ++    +  G G + F  E +   A++ +N +   G  + V
Sbjct: 186 TFSSVNTRDFDGTGALEFANEETLDTALEKLNNIEFRGSVITV 228

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 324 VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITE 383
             LFV+     + + +L + F PFG +   K++        GF FV F   + A KAI E
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL-------NGFAFVEFEEADSAAKAIEE 135

Query: 384 KNQQIVAGKPLYVAIAQRKDVRRSQL 409
            N +  A +PL V +  +  V+R +L
Sbjct: 136 VNGKTFANQPLEV-VYSKLPVKRYRL 160

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           ++++G L   VTE  L   FS  G +  +RV RD  T  S GYA++ F D    R A ++
Sbjct: 58  TVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKE 117

Query: 101 L 101
           +
Sbjct: 118 I 118

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAV 278
           F  +++  +  E T+ E +  F++FG+I    + RD S  K RG+ FI F D   +  A 
Sbjct: 56  FRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAAC 115

Query: 279 DEL 281
            E+
Sbjct: 116 KEI 118

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGFVCFSTPEEATKAITEK 384
           LFV NL     DE LR  F   G I   ++    D+G  KGF F+ F   +  T+A+T+K
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 385 NQQIVAGKPLYVAIAQ---RKDVRRSQLAQQ 412
           + + +AG+PL +   +   ++ V+R + + Q
Sbjct: 291 SCRKIAGRPLRMEFGEDRSKRQVKRRENSSQ 321

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L+VG L    T+ LL   F   G +  +R+     +    G+A+++F D      A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 102 NYTTIKGRPCRIMWSQ 117
           +   I GRP R+ + +
Sbjct: 291 SCRKIAGRPLRMEFGE 306

>Scas_530.4
          Length = 684

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 72/333 (21%), Positives = 125/333 (37%), Gaps = 63/333 (18%)

Query: 119 DPSLRKKGSGNIFI----KNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVH 174
           +P+ R + S  +F+     NLH      ++ D F  FG I+  K+  D+A  ++ + FV 
Sbjct: 132 EPTFRGRPSSCVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQA--NRPYAFVQ 189

Query: 175 FEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQ 234
           +  +  A  A+   +G +LNG             R+ + E A+ N T     N  +E   
Sbjct: 190 YTNDNDANVALKEAHGSILNG-------------RRLRCERARVNRTLFITHNSPIELF- 235

Query: 235 EEFEALFTQFGKITSAVLERDSEGKPR---------GFGFINFEDHESAAKAVDEL-NDT 284
            E  A+  +FG++   V +RD     R            F  F   + A +A   L  D+
Sbjct: 236 -EVHAICRKFGELDQLVPKRDDNPFMRRCSYPISNSSSWFAQFTFRDDAIRAFANLKTDS 294

Query: 285 DFKSQRLYVGRAQKKY-----------ERLQELRKQYEVSRLEKLAKYQGVN-------- 325
           ++  Q     R  K +           E +     Q + +  +        N        
Sbjct: 295 NWAVQWAQNIRVPKFFNLLNKDSPMDKENITNFNSQEDGADTDPTHDNNLNNDNMQPVTI 354

Query: 326 ----LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
               +FV  L +   +E L+  F+  G I    ++         F F+ + T   A  A+
Sbjct: 355 DKKSIFVGQLPEETTEEVLKIHFSKHGKILDLNLIHKPKN---VFAFIQYETENAAAIAL 411

Query: 382 TEKNQQIVAGKPLYV------AIAQRKDVRRSQ 408
             +N  I   K ++V       I  R++ +RSQ
Sbjct: 412 ETENHSIFISKTIHVQYKEIGGIHGRRNSKRSQ 444

>Kwal_55.20972
          Length = 135

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 125 KGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKE 183
           K    IF+  LH  +    +   FS +G  +  K+  D E+G SKGF ++ +E++ S   
Sbjct: 31  KDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVL 90

Query: 184 AVDAINGMLLNGQEVYV 200
           AVD +NG+ + G+ + V
Sbjct: 91  AVDNLNGVKIAGRSIRV 107

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A ++VG L   +TE  +  +FS  G    +++ RD  +  S G+AY+ + D  +   A+ 
Sbjct: 34  AYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVD 93

Query: 100 KLNYTTIKGRPCRI---MWSQRD 119
            LN   I GR  R+   M++ RD
Sbjct: 94  NLNGVKIAGRSIRVDHTMFTPRD 116

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           I+V  +  + T+ +   +F+Q+G      L RD E G+ +GF ++ +ED  S   AVD L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 282 N 282
           N
Sbjct: 96  N 96

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           +FV  L   + +  +   F+ +G     K++RD ++G SKGF ++ +        A+   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 385 NQQIVAGKPLYV 396
           N   +AG+ + V
Sbjct: 96  NGVKIAGRSIRV 107

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 99/221 (44%), Gaps = 40/221 (18%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKIT----SAVLERD--------------SEGKPRGFG 264
           +++ N+  +TT+++    F    K      S V E+D              +  K +GF 
Sbjct: 127 VWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAMKNKGFC 186

Query: 265 FINFEDHESAAKAVDELNDTDFKSQRL-------YVGRAQKKYERLQELRKQYEVSRLEK 317
           ++ F++ E   KAV EL+++    + +       Y GR  K  + L  + K    SR+  
Sbjct: 187 YMFFKNVEQM-KAVLELSESHLNGRNMLIKDSENYSGRPDK--DDLVAMSKN-PPSRI-- 240

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGFVCFSTPEE 376
                   LFV NL   + D+ LR  F   G I   ++   +D+G  KGF F+ F   E 
Sbjct: 241 --------LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEG 292

Query: 377 ATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARN 417
           +T  + +K+ + +AG+PL +   + +  R+ +   +  +RN
Sbjct: 293 STNELKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRN 333

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L+VG L   VT+ LL   F   G +  IR+     +    G+A+++F + +     ++  
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 102 NYTTIKGRPCRIMWSQ 117
           +   I GRP R+ + +
Sbjct: 301 SCRKIAGRPLRMEYGE 316

>Kwal_55.20414
          Length = 284

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 211 SKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLE------RDSEGKPRGFG 264
           +++ EA S    IYV N+D  TT+EE      ++  ++  +        R+S  +P G G
Sbjct: 7   TQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVRPLGIG 66

Query: 265 FINFEDHESAAKAVDELNDTDFKSQRLYV 293
           + +F+  + A  A   LN    K ++L +
Sbjct: 67  YADFQSAQDAQNAAQNLNGKQLKDRKLKI 95

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           S++VG LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D  +   A+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 101 LNYTTIKGRPCRIMWSQRDPSLRK 124
                 +G+  R +   R  ++RK
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRK 443

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 2/103 (1%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITE 383
           ++FV NLD    +E L   F P G I   +++RD   N  KGF +V F   +  +KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 384 KNQQIVAGKPLY-VAIAQRKDVRRSQLAQQIQARNQMRYQQVT 425
             ++I  GK    + I++ K++R++Q  Q     N++  QQ T
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQRT 462

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 29/139 (20%)

Query: 188 INGMLLNGQEVYV--APHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245
           +NG + N   + V    H S  D++           +++V N+D E  +E     F   G
Sbjct: 334 LNGKVFNDHHLRVDSVTHPSPHDKRR----------SVFVGNLDFEEVEESLWKHFEPCG 383

Query: 246 KITSAVLERDSEGKP-RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQ 304
            I    + RDS+    +GF ++ F+D +S +KA+          ++++ G+  +K     
Sbjct: 384 DIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKAL------LLHEKKIHEGKKARK----- 432

Query: 305 ELRKQYEVSRLEKLAKYQG 323
            LR    +SR + + K QG
Sbjct: 433 -LR----ISRCKNMRKAQG 446

>Kwal_26.7179
          Length = 456

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI-- 98
           S++VG LD   TE  L+  F   G +  +R+ RD+ T    G+AYV F D      A+  
Sbjct: 294 SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLL 353

Query: 99  --QKLNYTTIKGRPCRI 113
             QKLN T   GR  R+
Sbjct: 354 DGQKLNGT---GRKLRV 367

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 13/111 (11%)

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYV--APHVSKKDRQSKLEEAKSNFTNIYVKNI 228
            +V + ++ + K A + +NG L     + V    H ++ D          N  +++V N+
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPTQHD----------NKRSVFVGNL 300

Query: 229 DLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAV 278
           D E T+E     F + G I    L RDS+    +GF ++ F D ++  KA+
Sbjct: 301 DFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKAL 351

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 84  AYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKA 143
           AYV + D  A + A ++LN T  +    R+  S   P+ +     ++F+ NL      + 
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVD-SVTHPT-QHDNKRSVFVGNLDFEETEEN 308

Query: 144 LHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAINGMLLNG 195
           L   F   G+I   ++  D   N  KGF +V F +  +  +A+  ++G  LNG
Sbjct: 309 LWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKAL-LLDGQKLNG 360

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITE 383
           ++FV NLD    +E L   F   G I   +++RD   N  KGF +V F   +   KA+  
Sbjct: 294 SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLL 353

Query: 384 KNQQIV-AGKPLYV 396
             Q++   G+ L V
Sbjct: 354 DGQKLNGTGRKLRV 367

>Scas_701.3
          Length = 321

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           ++++G L    TE  L  LF   G +  IR+ RD +T  S GYA++ F D  + + A ++
Sbjct: 107 TIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

Query: 101 LNY---TTIKGRPC 111
           +       IKGR C
Sbjct: 167 IGVHRGIDIKGRTC 180

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 206 KKDRQSKLEEAKSN--------------FTNIYVKNIDLETTQEEFEALFTQFGKITSAV 251
           +K+R SK+ E+  N              +  I++  +  +TT+ E + LF +FG+I    
Sbjct: 77  EKERISKMNESIRNWDPHNDPNIKDTDPYRTIFIGRLPYDTTELELQKLFVKFGEIEKIR 136

Query: 252 LERDS-EGKPRGFGFINFEDHESAAKAVDEL 281
           + RD    K +G+ FI F D  S+  A  E+
Sbjct: 137 IVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITE 383
           +F+  L     + +L+  F  FG I   +++RD   N SKG+ F+ F  P  +  A  E
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

>Scas_709.2*
          Length = 171

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           IY+  +D E T+ +  ++F+Q+G     +L  D++ G+ +GF F+ +ED  S   A+D L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 282 NDTDFKSQRLYV 293
           N     S  + V
Sbjct: 96  NGVKVGSNTIQV 107

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A +Y+G LD  +TE  +  +FS  G    + +  D  T  S G+A++ + D  +   AI 
Sbjct: 34  AYIYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAID 93

Query: 100 KLN 102
            LN
Sbjct: 94  NLN 96

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILS 156
           +IQ++N   ++     I+ +++    + K    I+I  L   +    +   FS +G  + 
Sbjct: 6   SIQQINERELQ---SGILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPVD 62

Query: 157 CKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
             +  D + G SKGF F+ +E++ S   A+D +NG+ +    + V
Sbjct: 63  LLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLNGVKVGSNTIQV 107

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 13/99 (13%)

Query: 298 KKYERLQELRKQYEVSRLEKLAKY--------QGVN----LFVKNLDDSIDDEKLRDEFA 345
           ++YE L+ +  + E    E+LAK+        QG +    +FV  L   +D+ +L+  F 
Sbjct: 69  QRYEELKTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFI 128

Query: 346 PFGAITSAKVMRDDAGNS-KGFGFVCFSTPEEATKAITE 383
            FG I   +++RD   N  +G+ FV F  PE + KA  E
Sbjct: 129 KFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +++VG L   V E  L   F   G +  +R+ RD IT    GYA+V F D +  + A ++
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 101 LNY---TTIKGR 109
           +       I+GR
Sbjct: 168 IGVHRGLMIRGR 179

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAV 278
           F  I+V  +  +  + E +  F +FG+I    + RD    KPRG+ F+ F D E + KA 
Sbjct: 106 FRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAY 165

Query: 279 DEL 281
            E+
Sbjct: 166 REI 168

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNS-KGFGFVHFEEEYSAKEAVDA 187
            IF+  LH  +D   L   F  FG I   +I  D+  N  +G+ FV F +   +K+A   
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 188 I---NGMLLNGQEVYV 200
           I    G+++ G+   V
Sbjct: 168 IGVHRGLMIRGRSAIV 183

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 72/165 (43%), Gaps = 19/165 (11%)

Query: 97  AIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILS 156
           +IQKL+   ++   C I+  +       K    I    +H  +    +   FS +G  + 
Sbjct: 6   SIQKLSERELE---CGILKPESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVD 62

Query: 157 CKIATDEA-GNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEE 215
            K+  D+  G SKGFGF+ +E++ S   AVD +NG  + G+ + V  H   + R  + E 
Sbjct: 63  IKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV-DHAFYRPRSDEAEY 121

Query: 216 AKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP 260
                          E  ++E E  F + G + S  ++++S   P
Sbjct: 122 E--------------EAVRQELEKDFAKTGDVPSEPMKQESVADP 152

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 228 IDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDELN 282
           + LE T+ +   +F+Q+G      L RD + GK +GFGF+ +ED  S   AVD LN
Sbjct: 41  MHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLN 96

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A +  G +   +TEA +  +FS  G    I++ RD  T  S G+ ++ + D  +   A+ 
Sbjct: 34  AYINFGGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVD 93

Query: 100 KLNYTTIKGRPCRI 113
            LN   + GR  R+
Sbjct: 94  NLNGAKVCGRLIRV 107

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 344 FAPFGAITSAKVMRDDA-GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           F+ +G     K++RD   G SKGFGF+ +        A+   N   V G+ + V
Sbjct: 54  FSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

>Kwal_47.18572
          Length = 363

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 69/158 (43%), Gaps = 15/158 (9%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           S+  L+V      V ++ L ++F P G +  +++          G+A+V F + D+   A
Sbjct: 80  STTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKILN--------GFAFVEFEEADSAARA 131

Query: 98  IQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSC 157
           I+++N  T   +P  +++S+  P   +     + ++NL   +  + L D      N L  
Sbjct: 132 IEEVNGKTFANQPLEVVYSKVQPPRYR-----MILRNLPDGVAWQELKDL--ARENNLET 184

Query: 158 KIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNG 195
             ++       G G + F  E   ++A+  +N +   G
Sbjct: 185 TFSSVNTREFDGTGALEFPSEEILEDALQKLNNIEFRG 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKN 385
           LFV+     + D +L + F PFG +   K++        GF FV F   + A +AI E N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEEVN 136

Query: 386 QQIVAGKPLYVAIAQRKDVR 405
            +  A +PL V  ++ +  R
Sbjct: 137 GKTFANQPLEVVYSKVQPPR 156

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 59/131 (45%), Gaps = 28/131 (21%)

Query: 212 KLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDH 271
           +L + + + T ++V+    +    E   +F  FG +    +         GF F+ FE+ 
Sbjct: 73  RLMDGELSTTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKILN-------GFAFVEFEEA 125

Query: 272 ESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNL 331
           +SAA+A++E+N   F +Q L V      Y ++Q  R +                + ++NL
Sbjct: 126 DSAARAIEEVNGKTFANQPLEV-----VYSKVQPPRYR----------------MILRNL 164

Query: 332 DDSIDDEKLRD 342
            D +  ++L+D
Sbjct: 165 PDGVAWQELKD 175

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 24/168 (14%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++     + +  L++ F  FG +   KI         GF FV FEE  SA  A++ +N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKILN-------GFAFVEFEEADSAARAIEEVN 136

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT- 248
           G     Q + V          SK++  +     + ++N+      +E + L  +    T 
Sbjct: 137 GKTFANQPLEVV--------YSKVQPPR---YRMILRNLPDGVAWQELKDLARENNLETT 185

Query: 249 -SAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
            S+V  R+ +G     G + F   E    A+ +LN+ +F+   +   R
Sbjct: 186 FSSVNTREFDGT----GALEFPSEEILEDALQKLNNIEFRGSVITAER 229

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 40  ASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           A +++G L+  +TE  L  +FS  G    + + RD  T  S G+A++ + D  +   A+ 
Sbjct: 34  AYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVD 93

Query: 100 KLNYTTIKGRPCRI 113
            LN  T+ GR  ++
Sbjct: 94  NLNGITVAGRQIKV 107

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEG-KPRGFGFINFEDHESAAKAVDEL 281
           I++  ++ + T+ +   +F+Q+G     +L RD E  + +GF F+ +ED  S   AVD L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 282 N 282
           N
Sbjct: 96  N 96

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 8/107 (7%)

Query: 97  AIQKLNYTTIKGRPCR--IMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI 154
           AIQ++N   ++    +    W Q       K    IFI  L+  +    L   FS +G  
Sbjct: 6   AIQRINEKELEAGILKPEHSWHQE-----YKDQAYIFIGGLNRQLTEGDLLTIFSQYGVP 60

Query: 155 LSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
           +   +  D E   SKGF F+ +E++ S   AVD +NG+ + G+++ V
Sbjct: 61  VDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKV 107

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           +F+  L+  + +  L   F+ +G      ++RD +   SKGF F+ +        A+   
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 385 NQQIVAGKPLYV 396
           N   VAG+ + V
Sbjct: 96  NGITVAGRQIKV 107

>Scas_88.1
          Length = 256

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 344 FAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
           F+P+G +    V  D   G SKGF ++ F  PE A  A  E ++QI  G+ L++  A+ K
Sbjct: 19  FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEAK 78

Query: 403 DVRR 406
              R
Sbjct: 79  KSHR 82

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR 118
           LFSP G +  + V  D  T  S G+AY+ F + +    A  +L+    +GR   I+ ++ 
Sbjct: 18  LFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEA 77

Query: 119 DPSLR 123
             S R
Sbjct: 78  KKSHR 82

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 130 IFIKNLH-PAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDA 187
           +F+  +H   ID   L   FS +G +    +A D   G SKGF ++ F+   +A +A   
Sbjct: 3   LFVHFIHCKGIDFXQL---FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 188 INGMLLNGQEVYVAPHVSKKDRQ 210
           ++  +  G+ +++ P  +KK  +
Sbjct: 60  LDKQIFQGRLLHILPAEAKKSHR 82

>Kwal_23.5864
          Length = 278

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           +++VG L  TVTE  L   F   G +  +RV RD  +  S GY ++ F +    RTA ++
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 101 LNY---TTIKGRPC 111
           +       I GRP 
Sbjct: 162 IGVHRGVEIGGRPV 175

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFST---PEEATKA 380
            +FV  L  ++ + +L+ EF  FG I   +V+RD   N S+G+GF+ F        A + 
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 381 ITEKNQQIVAGKPLYVAIAQRKDVR 405
           I       + G+P+ V I + + V+
Sbjct: 162 IGVHRGVEIGGRPVIVDIERGRTVK 186

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDA 187
            +F+  L   +    L   F  FG I   ++  D+  N S+G+GF+ F+EE  A+ A   
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 188 I---NGMLLNGQEVYV 200
           I    G+ + G+ V V
Sbjct: 162 IGVHRGVEIGGRPVIV 177

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAV 278
           +  ++V  +    T+ E +  F +FG+I    + RD +  K RG+GFI F++   A  A 
Sbjct: 100 YRTVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTAC 159

Query: 279 DEL 281
            E+
Sbjct: 160 REI 162

>Kwal_33.14463
          Length = 393

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGFVCFSTPEEATKAITEK 384
           LFV NL     DE L+  F   G I   ++    D G  KGF FV F   E  T A+ +K
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 385 NQQIVAGKPLYVAIAQ---RKDVRR 406
             + +AG+PL +   +   ++ VRR
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQVRR 321

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L+VG L    T+ LL   F   G +  IR+     T    G+A+V+F D +    A++  
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 102 NYTTIKGRPCRIMW------------------SQRDPSLRKKGSGN 129
               I GRP R+ +                  S+ +PSLR++ S N
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQVRRRAPEAPVSRPEPSLREEHSSN 342

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 167 SKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVS---KKDRQSKLEEAKSNFTNI 223
           +KGF  ++F+ +     AV A++   LNG+ + +    S   + D+   +  +K+  + I
Sbjct: 178 NKGFAHMNFKTQEQM-NAVVALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSRI 236

Query: 224 -YVKNIDLETTQEEFEALFTQFGKITSAVLER-DSEGKPRGFGFINFEDHESAAKAVDEL 281
            +V N+  +TT E  +  F   G I    +      GK +GF F++F+D E    A+ + 
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKD- 295

Query: 282 NDTDFKSQRLYVGR 295
                K+ R   GR
Sbjct: 296 -----KTCRKIAGR 304

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           S++VG LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKD 329

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 71/157 (45%), Gaps = 26/157 (16%)

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYV------APHVSKKDRQSKLEEAKSNFTNIY 224
            ++ ++ + + ++    +N ++     + V      APH  K+              +I+
Sbjct: 237 AYIVYKNKSAVRKICSNLNAVVFQDHHLRVDSVAHPAPHDKKR--------------SIF 282

Query: 225 VKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAVDELND 283
           V N+D E  +E     F   G I    + RDS+    +GF ++ F+D +S  KA+  LN+
Sbjct: 283 VGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL-LLNE 341

Query: 284 TDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAK 320
              KSQ+      +K  ++ ++LR    VSR + + K
Sbjct: 342 KPMKSQKQEDENTKKPTKKARKLR----VSRCKNMKK 374

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAI 381
           ++FV NLD    +E L   F P G I   +++RD   N  KGF +V F   +   KA+
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL 337

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S  +Y+G +    TE  + DL S +G V S+++  D+ T  S GYA+V + D ++  +A+
Sbjct: 15  SRVVYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAV 74

Query: 99  QKLNYTTIKGRPCRIMWSQRDPSLRKKGSGN 129
           + LN   +  R  +  +S  +  +  +G GN
Sbjct: 75  RNLNGYQLGSRLLKCGYS-SNSDITDQGVGN 104

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           +Y+ +I  + T+E+   L +  G + S  +  DS+ GK +G+ F+ ++D ES+A AV  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 282 NDTDFKSQRLYVG 294
           N     S+ L  G
Sbjct: 78  NGYQLGSRLLKCG 90

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 144 LHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAING 190
           + D  S  G ++S K+  D + G SKG+ FV +++  S+  AV  +NG
Sbjct: 32  ILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNLNG 79

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/333 (20%), Positives = 124/333 (37%), Gaps = 87/333 (26%)

Query: 119 DP-SLRKKGSGNIFIKNLHPAIDNKAL----HDTFSVFGNILSCKIATDEAGNSKGFGFV 173
           DP + R + S  +F+ +L  ++ +  L     + F  +G +   K+  D +  ++ + FV
Sbjct: 151 DPKTWRGRPSSCVFVASLAASLTDDDLCVSVTEAFKKYGELSMVKVLRDPS--NRPYAFV 208

Query: 174 HFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDL--- 230
            +  +  AK A+    G LLNG+ +             + E+AK N T +++   +    
Sbjct: 209 QYTNDNDAKRALKQAQGTLLNGRTI-------------RCEKAKVNRT-LFISTRNRKAP 254

Query: 231 ETTQEEFEALFTQFGKITSAVLERDSEGKPRGF-------GFINFEDHESAAKAVDELND 283
           E T +E   L + FG++   V  R+   K   +        F+ F   + A +A   L  
Sbjct: 255 EVTSDEIIQLCSSFGELEQLVASREYAFKKNYYPIDRSSAWFVQFAYRDDAIRAFINL-- 312

Query: 284 TDFKSQRLYVGRAQKKYERLQELRKQYEVSR---LEKLAKYQGV---------------- 324
                        +  Y+   E  +  EV +   L +  K +G                 
Sbjct: 313 -------------KPGYDWTVEWAQNIEVPKRLNLLRKTKVRGTKSGNSESEEDEEEYED 359

Query: 325 ---------------------NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNS 363
                                ++FV  LD S+  EKL   F+  G +    ++  D  N+
Sbjct: 360 EDEDEDDEDEDDSRDILIDKKSIFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKD-NNT 418

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           K F F+ + T E    A+  +N      + ++V
Sbjct: 419 KVFAFIKYETEEATATALERENHASFLNRTMHV 451

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIR-VCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           S++V +LDP+VT+  L   FS  G V  +  + +D  TK    +A++ +   +A  TA++
Sbjct: 381 SIFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDNNTKV---FAFIKYETEEATATALE 437

Query: 100 KLNYTTIKGRPCRIMWSQ 117
           + N+ +   R   + + +
Sbjct: 438 RENHASFLNRTMHVQYRE 455

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 35  VDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAG 94
           V + +ASL   +L  +VTEA     F   G +S ++V RD   +    YA+V + + +  
Sbjct: 165 VASLAASLTDDDLCVSVTEA-----FKKYGELSMVKVLRDPSNRP---YAFVQYTNDNDA 216

Query: 95  RTAIQKLNYTTIKGRPCRI 113
           + A+++   T + GR  R 
Sbjct: 217 KRALKQAQGTLLNGRTIRC 235

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 15/125 (12%)

Query: 205 SKKDRQSKLEEAKSNF--TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPR 261
           +++D  S L++ + +     +YV N+   T++E+   LF++ G I   ++  D  +  P 
Sbjct: 29  ARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPC 88

Query: 262 GFGFINFEDHESAAKAVDELNDTDFKSQRLYV------------GRAQKKYERLQELRKQ 309
           GF FI F+  E A  ++  L DT    + + +            GR +   +   E+R +
Sbjct: 89  GFCFIIFDKMEDALNSIKYLGDTKLDDRHITIDLDPGFEEGRQFGRGKNGGQVSDEMRFE 148

Query: 310 YEVSR 314
           ++ SR
Sbjct: 149 FDASR 153

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S ++YVG L    +E  +Y+LFS  G++  I +  D    T  G+ ++ F   +    +I
Sbjct: 46  SCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSI 105

Query: 99  QKLNYTTIKGR 109
           + L  T +  R
Sbjct: 106 KYLGDTKLDDR 116

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 4/97 (4%)

Query: 200 VAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEG 258
           V+  +SK+++ +   EA S   +I+V NI  + T E+ E  F   G+I    L  D + G
Sbjct: 45  VSQKLSKEEKHAHQLEADS--RSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTG 102

Query: 259 KPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
            P+G+G+I FE      KA+ +LN  + K +++ V R
Sbjct: 103 TPKGYGYIEFESPAYREKAL-QLNGGELKGKKIAVSR 138

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 34  KVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDA 93
           +++  S S++VG + P VT   + D F   G +  I +  D  T T  GY Y+ F     
Sbjct: 58  QLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAY 117

Query: 94  GRTAIQKLNYTTIKGRPCRI 113
              A+Q LN   +KG+   +
Sbjct: 118 REKALQ-LNGGELKGKKIAV 136

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAV 185
           S +IF+ N+ P +  + + D F   G I    +  D   G  KG+G++ FE   + +E  
Sbjct: 63  SRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESP-AYREKA 121

Query: 186 DAINGMLLNGQEVYVA 201
             +NG  L G+++ V+
Sbjct: 122 LQLNGGELKGKKIAVS 137

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
           +FV N+   +  E++ D F   G I    ++ D + G  KG+G++ F +P    KA+
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 203 HVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG 262
           H+  +      +E + + T ++V+   L+  + E   +F  FG +    +         G
Sbjct: 107 HMHGRPPMHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------G 159

Query: 263 FGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQ 322
           F F+ FE+ ESAAKA++E++   F +Q L V      Y +L   R +  +  L +   +Q
Sbjct: 160 FAFVEFEEAESAAKAIEEVHGKSFANQPLEV-----VYSKLPAKRYRITMKNLPEGCSWQ 214

Query: 323 GVNLFVK 329
            +    +
Sbjct: 215 DLKDLAR 221

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 24/168 (14%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189
           +F++     +    L++ F  FG +   KI         GF FV FEE  SA +A++ ++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKIT- 248
           G     Q + V          SKL   +   T   +KN+    + ++ + L  +    T 
Sbjct: 180 GKSFANQPLEVV--------YSKLPAKRYRIT---MKNLPEGCSWQDLKDLARENSLETT 228

Query: 249 -SAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
            S+V  RD +G     G + F   E   +A++ LN+ +F+   + V R
Sbjct: 229 FSSVNTRDFDGT----GALEFPSEEILVEALERLNNIEFRGSVITVER 272

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 74/165 (44%), Gaps = 15/165 (9%)

Query: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           + S+  L+V      V E+ L ++F P G +  +++          G+A+V F + ++  
Sbjct: 121 ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAA 172

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155
            AI++++  +   +P  +++S+  P+ R +    I +KNL      + L D      N L
Sbjct: 173 KAIEEVHGKSFANQPLEVVYSKL-PAKRYR----ITMKNLPEGCSWQDLKDL--ARENSL 225

Query: 156 SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200
               ++    +  G G + F  E    EA++ +N +   G  + V
Sbjct: 226 ETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITV 270

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S ++Y+G +    TE  + DL   IG V+++++  D  T  S GYA++ F D     +A+
Sbjct: 7   SRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAV 66

Query: 99  QKLNYTTIKGRPCRI 113
           + LN  T+  R  + 
Sbjct: 67  RNLNGYTLGSRSLKC 81

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSAVLERD-SEGKPRGFGFINFEDHESAAKAVDE 280
            +Y+ +I  + T+++   L    G +T+  +  D + GK +G+ FI F+D  ++A AV  
Sbjct: 9   TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 281 LNDTDFKSQRLYVG 294
           LN     S+ L  G
Sbjct: 69  LNGYTLGSRSLKCG 82

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 144 LHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEV 198
           + D     G + + K+  D   G SKG+ F+ F++  ++  AV  +NG  L  + +
Sbjct: 24  ILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRNLNGYTLGSRSL 79

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%)

Query: 31  ENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E  +   +SA++YVG L    +E  LY+LFS  GS+  I +  D    T  G+ ++ +  
Sbjct: 37  EELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQT 96

Query: 91  HDAGRTAIQKLNYTTIKGRPCRI 113
                 A++ L+ T +  R   I
Sbjct: 97  PQEALAALKYLSKTKLDDREITI 119

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 203 HVSKKDRQSK--LEEAKSNFTN--IYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-E 257
           ++ +K R++   LEE + + T+  IYV N+   T++E+   LF++ G I   ++  D  +
Sbjct: 24  YLKRKARKTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFK 83

Query: 258 GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV------------GRAQKKYERLQE 305
             P GF FI ++  + A  A+  L+ T    + + +            GR +   +   E
Sbjct: 84  FTPCGFCFIIYQTPQEALAALKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDE 143

Query: 306 LRKQYEVSR 314
           LR +++ SR
Sbjct: 144 LRFEFDASR 152

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 8/117 (6%)

Query: 185 VDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQF 244
           V+++ G+     E      +S++DRQ++  E  S   +I+V NI   TT E  EA F   
Sbjct: 53  VESMKGLGFTASE----HQLSREDRQARQIELDSR--SIFVGNISPSTTPESLEAHFEDA 106

Query: 245 GKITS-AVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300
           G I    +L     G P+G+ +I FE  +S  K     + +DF  + + V + +  +
Sbjct: 107 GVIKRVTILYNKHTGAPKGYAYIEFESKDSVEKG-SAFDQSDFNGKTITVAKKRTNF 162

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%)

Query: 34  KVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDA 93
           +++  S S++VG + P+ T   L   F   G +  + +  +  T    GYAY+ F   D+
Sbjct: 77  QIELDSRSIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEFESKDS 136

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 3/92 (3%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAV 185
           SG I++  L      + L   FS FG++   ++A ++  GNS+ +GFV F     ++ A 
Sbjct: 124 SGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAY 183

Query: 186 DAINGMLLNGQ--EVYVAPHVSKKDRQSKLEE 215
           D +N  LL G   +V + P  SK ++  K ++
Sbjct: 184 DTMNNYLLMGHLLQVRLLPKGSKIEKLYKYKQ 215

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 15/121 (12%)

Query: 204 VSKKDRQSKLEEAKSNFTNI-YVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPR 261
            SKK + +K ++  S+ + I YV  +     + E    F+QFG +    L R+ + G  R
Sbjct: 107 TSKKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSR 166

Query: 262 GFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKY 321
            +GF+ F + + +  A D +N+       L +G        L ++R   + S++EKL KY
Sbjct: 167 HYGFVQFVNTDDSRVAYDTMNNY------LLMG-------HLLQVRLLPKGSKIEKLYKY 213

Query: 322 Q 322
           +
Sbjct: 214 K 214

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           ++V  L     + +L   F+ FG +   ++ R+   GNS+ +GFV F   +++  A    
Sbjct: 127 IYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTM 186

Query: 385 NQQIVAGKPLYVAI 398
           N  ++ G  L V +
Sbjct: 187 NNYLLMGHLLQVRL 200

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%)

Query: 31  ENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E+ +   SSA++YVG L    +E  +Y+LFS  G++  I +  D    T  G+ +V ++ 
Sbjct: 37  EDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 91  HDAGRTAIQKLNYTTIKGRPCRI 113
                +A++ L+ T +  R   I
Sbjct: 97  PKEALSAVKYLSDTKLDDRHISI 119

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 56/117 (47%), Gaps = 15/117 (12%)

Query: 213 LEEAKSNFTN--IYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFE 269
           LE+ + + ++  IYV N+   T++E+   LF++ G I   ++  D  +  P GF F+ + 
Sbjct: 36  LEDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYN 95

Query: 270 DHESAAKAVDELNDTDFKSQRLYV------------GRAQKKYERLQELRKQYEVSR 314
             + A  AV  L+DT    + + +            GR +   +   ELR +++ SR
Sbjct: 96  TPKEALSAVKYLSDTKLDDRHISIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

>Scas_621.16
          Length = 314

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 33  AKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHD 92
           A+ ++ S  +Y+G +    TE  + DL + +G V ++++  D  T  S GYA++ F D +
Sbjct: 37  AQHNSPSRIVYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLE 96

Query: 93  AGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFG 152
              +AI+ LN   +  R  +  +S  +  +    SGN+   N+   +DN   ++  S  G
Sbjct: 97  TSASAIRNLNGYQLGSRFLKCGYSSNN-DISASSSGNVHEGNI---LDNDGSYENNSKMG 152

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           +Y+ +I  + T+E+   L    G + +  +  D + GK +G+ FI F+D E++A A+  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 282 NDTDFKSQRLYVG 294
           N     S+ L  G
Sbjct: 106 NGYQLGSRFLKCG 118

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 203 HVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITS-AVLERDSEGKPR 261
           H S+ +R  K  E  S   +I+V NI  E T E  E  F   G++    +L     G P+
Sbjct: 87  HQSRAERLEKQIELDS--RSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPK 144

Query: 262 GFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
           G+ +I FE  +S  KA+ EL D++   + + V +
Sbjct: 145 GYAYIEFESSDSIPKAL-ELKDSELHGETINVAK 177

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%)

Query: 34  KVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDA 93
           +++  S S++VG +    T   L + F   G V  + +  + +T    GYAY+ F   D+
Sbjct: 97  QIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDS 156

Query: 94  GRTAIQ 99
              A++
Sbjct: 157 IPKALE 162

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 309 QYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFG 367
           Q    RLEK  +    ++FV N+      E L + F   G +    ++ +   G  KG+ 
Sbjct: 88  QSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYA 147

Query: 368 FVCFSTPEEATKAITEKNQQIVAGKPLYVA 397
           ++ F + +   KA+  K+ ++  G+ + VA
Sbjct: 148 YIEFESSDSIPKALELKDSEL-HGETINVA 176

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S ++Y+G +    TE  + DL S +G V+ +++  D  T  S GYA++ F D     +A+
Sbjct: 10  SRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAV 69

Query: 99  QKLNYTTIKGRPCRIMWS 116
           + LN   +  R  +  ++
Sbjct: 70  RNLNGYALGNRTLKCGYT 87

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           +Y+ +I  + T+++   L +  G +T   +  D + GK +G+ FI F+D  +++ AV  L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGV 324
           N     ++ L  G     Y     + ++Y +S   +L++  G+
Sbjct: 73  NGYALGNRTLKCG-----YTTGGGISEEYSLSNRGELSQVGGM 110

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 144 LHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLL 193
           + D  S  G +   K+  D + G SKG+ F+ F++  ++  AV  +NG  L
Sbjct: 27  ILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNLNGYAL 77

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L+V +L+P    A L  +F+  G V+S+ + RD  +  SLGY +V F    A   A  K+
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 102 NYTTIKGRPCRIMWSQ 117
           +   I  R   + +SQ
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
           +F+  L+P      L   F+ FG++ S +I  D ++G S G+GFV F  + + + A   +
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 189 NGMLLNGQEVYV 200
           +G L++ + V+V
Sbjct: 292 DGALIDDRRVHV 303

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEK 384
           LFV  L+       L   FA FG + S +++RD D+G S G+GFV F+T      A T+ 
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 385 NQQIVAGKPLYVAIAQ 400
           +  ++  + ++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           ++V  ++  T   +   +F QFG + S  + RD + G+  G+GF+ F    +   A  ++
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 282 NDTDFKSQRLYVGRAQ 297
           +      +R++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAI 188
            +F+  L    D   L   F+ +G I+  ++  D+   S+G+ FV F+E  SA+     I
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRDI 175

Query: 189 ---NGMLLNGQEVYV 200
               G+ +NG+   V
Sbjct: 176 GVHRGIQINGRRCIV 190

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 5/110 (4%)

Query: 6   DKTAEQLEQLKINDDQQTAPTSTESENAKVDTSS-ASLYVGELDPTVTEALLYDLFSPIG 64
           D  A+++   +   +QQ       S+N   DT    +++VG L     E  L  +F+  G
Sbjct: 80  DAVAKRVRDNQREVEQQLLQWDPLSDNHMRDTDPYKTVFVGRLPYDTDEVQLQKVFAKYG 139

Query: 65  SVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNY---TTIKGRPC 111
            +  +RV RD   K S GYA+V F + D+ R   + +       I GR C
Sbjct: 140 EIVRVRVVRDKQNK-SRGYAFVLFKETDSARVCTRDIGVHRGIQINGRRC 188

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEA 377
            +FV  L    D+ +L+  FA +G I   +V+RD    S+G+ FV F   + A
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 33/55 (60%)

Query: 220 FTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESA 274
           +  ++V  +  +T + + + +F ++G+I    + RD + K RG+ F+ F++ +SA
Sbjct: 114 YKTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S  +Y+G +    TE  + DL S +G V+++++  D  T  S GYA+V + D +A  +A+
Sbjct: 12  SRVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAV 71

Query: 99  QKLN 102
           + LN
Sbjct: 72  RNLN 75

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 144 LHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAING 190
           + D  S  G + + K+  D + G SKG+ FV +++  ++  AV  +NG
Sbjct: 29  ILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNLNG 76

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 95/217 (43%), Gaps = 24/217 (11%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVS-SIRVCRDAITKTSLGYAYVNFHDHDAGRT 96
           +  +L++    P+ T+  + DL   I  V+ SIR+       TS  +AY++    +  R 
Sbjct: 115 TECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFN-TSRRFAYIDVTSKEDARY 173

Query: 97  AIQKLNYTTIKGRPCR------IMWSQRDPSLRKKGSGNIFIKNLHP-AIDNKALHDTFS 149
            ++KLN   I+G          +  S+R  S   +G   I I+NL    +D   L ++F 
Sbjct: 174 CVEKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGR-EIMIRNLSTELLDENLLRESFE 232

Query: 150 VFGNILSCKIATDEAGNS--KGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKK 207
            FG+I    I   +  +S      F+ FE + SA+ A+  +N  LL  +E+     VS  
Sbjct: 233 GFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQ-MNRSLLGNREI----SVSLA 287

Query: 208 DRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQF 244
           D++  LE  +       VK +      +E E L   F
Sbjct: 288 DKKPFLERNE-------VKRLLASRNSKELETLICLF 317

>Kwal_26.7522
          Length = 262

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S ++Y+G +    TE  + DL S +G V ++++  D  T  S GYA+V + D +A  +A+
Sbjct: 11  SRTVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAV 70

Query: 99  QKLN 102
           + LN
Sbjct: 71  RNLN 74

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 146 DTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAING 190
           D  S  G +++ K+  D + G SKG+ FV +++  ++  AV  +NG
Sbjct: 30  DLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNLNG 75

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 73/149 (48%), Gaps = 10/149 (6%)

Query: 167 SKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSK--LEEAKSNFTN-- 222
           +KGF ++ F+ E    EAV  ++   LNG+ + +    S + R  K  L  A  N  +  
Sbjct: 170 NKGFAYIDFKTEKQM-EAVVGLSESALNGRNLLIKNAGSYEGRPDKNDLVAASKNPPSRI 228

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLER-DSEGKPRGFGFINFEDHESAAKAVDEL 281
           ++V N+  +TT++     F   G+I    +   +  GK +GF FI+F+D   A  A+ + 
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 282 NDTDFKSQ--RLYVG--RAQKKYERLQEL 306
           +     S+  R+  G  R++++  R  EL
Sbjct: 289 SCRKIASRPIRMEYGEDRSKRQVRRRPEL 317

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMR-DDAGNSKGFGFVCFSTPEEATKAITEK 384
           LFV NL     ++ LR  F   G I   ++   +D G  KGF F+ F     AT A+ +K
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 385 NQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 416
           + + +A +P+ +   + +  R+ +   ++ AR
Sbjct: 289 SCRKIASRPIRMEYGEDRSKRQVRRRPELDAR 320

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%)

Query: 42  LYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKL 101
           L+VG L    TE LL   F   G +  IR+     T    G+A+++F D      A++  
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 102 NYTTIKGRPCRIMWSQ 117
           +   I  RP R+ + +
Sbjct: 289 SCRKIASRPIRMEYGE 304

>Kwal_27.11158
          Length = 567

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 75/178 (42%), Gaps = 43/178 (24%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR--- 95
           S ++Y+G + P +    L D     G V  IR+ R+ +       A+++F D  +     
Sbjct: 145 SRTVYLGNIPPNLEARQLLDHVRS-GVVEDIRILREKMC------AFISFLDESSALLFH 197

Query: 96  --TAIQKLNYTTIKGRPCRIMWSQRDP-------SLRKKGSG-NIFIKNLHP-------- 137
               +++LN   I GR  +I W +  P       ++   G+  N++I  L+         
Sbjct: 198 SDAILKRLN---IDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQI 254

Query: 138 -------AIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAI 188
                   +  + L D  S +G I S KI T+     KG  FVHF   +SA + V ++
Sbjct: 255 GADPRDEVVTEQKLRDDLSFYGEIESVKIITE-----KGIAFVHFCSIFSAIKVVSSL 307

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 92/202 (45%), Gaps = 36/202 (17%)

Query: 126 GSGNIFIKNLHPAIDNKALHDTFSVFGNIL-SCKIATDEAGNSKGFGFVHFEEEYSAKE- 183
           G+  I++ NL   +  + + +   V G +L S K+ TD     +   FV F +  +A + 
Sbjct: 384 GNRTIYLGNLPKDVKIEEICNV--VRGGLLQSIKLLTD-----RHVCFVTFIDPTAAAQL 436

Query: 184 -AVDAINGMLLNGQEVYVA--PHVSKKDRQSKLEEAKSNFTNIYVKNIDLET-------- 232
            A+ +++G+ ++ +   +    H         L  +     NIY+ NID +         
Sbjct: 437 YAMASLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEHPI 496

Query: 233 -TQEEFEALFTQFGKI--TSAVLERDSEGKPRGFGFINFEDHESAAKAVDEL-NDTDFKS 288
            T++   ++F +FG++   + ++ER+         F+NF +  +A  A+D++ N+  F  
Sbjct: 497 FTEQNLRSIFEEFGEVEQINFLIERNC-------CFVNFTNISNAILAIDKIKNNPQFSD 549

Query: 289 QRLYVGRAQKKYERLQELRKQY 310
            ++  G+     +R   + +QY
Sbjct: 550 LKINFGK-----DRCGNVPRQY 566

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 332 DDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
           D+ + ++KLRD+ + +G I S K++ +     KG  FV F +   A K ++     + A 
Sbjct: 260 DEVVTEQKLRDDLSFYGEIESVKIITE-----KGIAFVHFCSIFSAIKVVSS----LAAV 310

Query: 392 KPLY 395
            P Y
Sbjct: 311 NPYY 314

>Kwal_33.13496
          Length = 330

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAI 188
           +FI  L+P    K L   FS FG I   +I  D E G S  +GF+ F  + S + A   +
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 189 NGMLLNGQEVYV 200
            G+L++ + ++V
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%)

Query: 38  SSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           S   L++ +L+P      L  +FS  G++  + + RD  T  SL Y ++ F +  +   A
Sbjct: 245 SEKVLFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAA 304

Query: 98  IQKLNYTTIKGRPCRIMWSQ 117
             K+    I  R   + + Q
Sbjct: 305 YSKMEGVLIDDRRIHVDFCQ 324

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           +++  ++  T  ++   +F++FG I    + RD E G    +GFI F +  S   A  ++
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 282 NDTDFKSQRLYVGRAQ 297
                  +R++V   Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

>Scas_582.10
          Length = 283

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 8/105 (7%)

Query: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI-------LSCKIATDEAGNSKGFGFV 173
           S   + S  I++ N+        L   FS +G I       L+CK+  DE GN KG   V
Sbjct: 34  SQHSRESSAIYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALV 93

Query: 174 HFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKS 218
            +E+  S + A+D ++G + N   + V      +D + KL++  S
Sbjct: 94  VYEKPESVQLAIDMVDGTIFNKSTIKV-ERAQFEDNKRKLDDVDS 137

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 7/82 (8%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKI-------TSAVLERDSEGKPRGFGFINFEDHESAA 275
           IYV NI   T+Q +   LF+++GKI        +  + +D +G  +G   + +E  ES  
Sbjct: 43  IYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEKPESVQ 102

Query: 276 KAVDELNDTDFKSQRLYVGRAQ 297
            A+D ++ T F    + V RAQ
Sbjct: 103 LAIDMVDGTIFNKSTIKVERAQ 124

>Scas_666.11
          Length = 224

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAV 185
           S  +++  L      + L   FS FG++   ++A ++  GNS+ +GF+ F  +  A  A 
Sbjct: 93  SSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQ 152

Query: 186 DAINGMLLNGQ--EVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQ 243
           DA+N  L+ G   +V + P  +K ++  K +  K  FT + +K    E  +        +
Sbjct: 153 DAMNNYLVMGHLLQVRLLPKGAKIEKLYKYK--KRAFTQMKIKKTAKELKERAHTKHEER 210

Query: 244 FGKITSA 250
             K+T A
Sbjct: 211 MNKLTEA 217

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEE 376
           LA+Y  + L+V  L     + +L   F+ FG +   ++ R+   GNS+ +GF+ F+  ++
Sbjct: 89  LAEYSSI-LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDD 147

Query: 377 ATKAITEKNQQIVAGKPLYVAI 398
           A  A    N  +V G  L V +
Sbjct: 148 ANIAQDAMNNYLVMGHLLQVRL 169

>KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 652

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 80/181 (44%), Gaps = 43/181 (23%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD-HDA---- 93
           S ++Y+G +  T+T   L D +   G V  +++  + +       A+V+F D +DA    
Sbjct: 232 SRTVYLGNIPATITYKALLD-YVRTGVVEEVKILSEKMC------AFVSFVDENDALLFH 284

Query: 94  GRTAIQKLNYTTIKGRPCRIMWSQ---RDPSLRKK-----GSGNIFIKNLHPAIDN---- 141
               +++LN   I GR  +I W +    DP +R        + N++I  L+   D+    
Sbjct: 285 SDAILKRLN---IDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKW 341

Query: 142 -----------KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAING 190
                      + L+D  S FG I S K+  D     +G  FVHF   ++A +AV  I  
Sbjct: 342 GADPKEILVTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAVANIGS 396

Query: 191 M 191
           +
Sbjct: 397 I 397

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           +  EKL D+ + FG I S K++ D     +G  FV F++   A KA+
Sbjct: 350 VTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAV 391

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 7/69 (10%)

Query: 229 DLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTD--F 286
           ++  T+E+     +QFG+I S  L  D     RG  F++F    +A KAV  +   D  +
Sbjct: 347 EILVTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAVANIGSIDPYY 401

Query: 287 KSQRLYVGR 295
            +++++ G+
Sbjct: 402 SNKKVFYGK 410

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S  +Y+G +    TE  + DL S +G V ++++  D  T  S GYA++ F D ++  +A+
Sbjct: 17  SRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAV 76

Query: 99  QKLNYTTIKGR 109
           + LN   +  R
Sbjct: 77  RNLNGYQLGSR 87

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           +Y+ +I  + T+E+   L +  G + +  +  D + G+ +G+ FI F D ES+A AV  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 282 NDTDFKSQRLYVG 294
           N     S+ L  G
Sbjct: 80  NGYQLGSRFLKCG 92

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 144 LHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAING 190
           + D  S  G +++ K+  D + G SKG+ F+ F +  S+  AV  +NG
Sbjct: 34  ILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNG 81

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 81/209 (38%), Gaps = 41/209 (19%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNS--KGFGFVHFEEEYSAKEAVD 186
           +IF+ NL P    + L     VFG  +  +I T ++  +  + F FV F+++   ++   
Sbjct: 18  SIFVGNLSPETSPEDLQ---KVFGESVKVEIPTLQSDRTYPRIFAFVTFDDKVDVEDLRS 74

Query: 187 AINGMLLNGQEVYV--------------------------APHVSKKDRQSKLEEAKSNF 220
             +  ++  + +YV                          AP    K+ Q  LE+ + + 
Sbjct: 75  KFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEAQVPLEQMERSK 134

Query: 221 TNIYVKNIDLETTQEEFEALF--TQFGKITSAVLERDSEGKP--------RGFGFINFED 270
             +YV NI   TT+ E  + F  T+   I      +D+  K         RG  F++F +
Sbjct: 135 DTLYVNNIPYHTTKAEIASFFGTTEESVILPMRRMKDTTTKRVFFSRKFNRGIAFVSFPE 194

Query: 271 HESAAKAVDELNDTDFKSQRLYVGRAQKK 299
                    E N  +F+ + L V  A  K
Sbjct: 195 GTDIEAKAAEFNGKNFEDRELTVDVAANK 223

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDE 280
           T+I+V N+  ET+ E+ + +F +  K+    L+ D    PR F F+ F+D         +
Sbjct: 17  TSIFVGNLSPETSPEDLQKVFGESVKVEIPTLQSD-RTYPRIFAFVTFDDKVDVEDLRSK 75

Query: 281 LNDTDFKSQRLYVGRAQKKYERLQELRKQ 309
            + T  K + +YV +     E  Q+L+KQ
Sbjct: 76  FDKTVIKDKSIYVTKVLTPEE--QQLKKQ 102

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAV 185
           SG I++  L      K L   F+ FG++   ++A ++  GNS+ +GF+ F  +  A  A 
Sbjct: 90  SGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQ 149

Query: 186 DAINGMLLNGQ--EVYVAP 202
           +++N  LL G   +V V P
Sbjct: 150 ESMNNYLLMGHLLQVRVLP 168

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEE 376
           L +Y G+ ++V  L     +++L   FA FG +   ++ R+   GNS+ +GF+ F   E+
Sbjct: 86  LEEYSGI-IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKED 144

Query: 377 ATKAITEKNQQIVAGKPLYVAI 398
           A  A    N  ++ G  L V +
Sbjct: 145 AMIAQESMNNYLLMGHLLQVRV 166

 Score = 35.4 bits (80), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 21/121 (17%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           IYV  +     ++E    F QFG +    L R+ + G  R +GF+ F + E A  A + +
Sbjct: 93  IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESM 152

Query: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKY-------QGVNLFVKNLDDS 334
           N+       L +G        L ++R   + +++EKL KY       +G+   VK L D+
Sbjct: 153 NNY------LLMG-------HLLQVRVLPKGAKIEKLYKYKKRVLVEKGITKPVKQLKDN 199

Query: 335 I 335
           +
Sbjct: 200 M 200

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 5/100 (5%)

Query: 5   TDKTAEQLEQLKINDDQQTAPTS----TESENAK-VDTSSASLYVGELDPTVTEALLYDL 59
           +D   +Q EQ   N    T P S     + ++AK V+  S S++V  + P  T  +L + 
Sbjct: 43  SDSKGDQDEQSSYNSLDSTTPVSQPLSKDRKHAKQVELDSRSVFVSSITPEATAEMLEEH 102

Query: 60  FSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQ 99
           F  +G +S I +  +  T    GYAY+ F    +   A+Q
Sbjct: 103 FKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKALQ 142

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 200 VAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITS-AVLERDSEG 258
           V+  +SK  + +K  E  S   +++V +I  E T E  E  F   G I+   +L     G
Sbjct: 64  VSQPLSKDRKHAKQVELDSR--SVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTG 121

Query: 259 KPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGR 295
           +P+G+ +I FE   S  KA+ +L+ + F    + V +
Sbjct: 122 EPKGYAYIQFESISSVEKAL-QLDGSSFNGNTISVAK 157

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAV 185
           S ++F+ ++ P    + L + F   G I    I  ++  G  KG+ ++ FE   S ++A+
Sbjct: 82  SRSVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL 141

Query: 186 DAINGMLLNGQEVYVA 201
             ++G   NG  + VA
Sbjct: 142 Q-LDGSSFNGNTISVA 156

>Scas_643.16
          Length = 448

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 13/104 (12%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA--I 98
           S++VG LD    E  L++ F   G +  +R+ RD  T    G+AYV F + ++   A  +
Sbjct: 276 SIFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLL 335

Query: 99  QKLNYTTI--------KGRPCRIMWSQRDPSLRKKGSGNIFIKN 134
            +   T I        KGR  R+    R  ++RK  +    IKN
Sbjct: 336 NEKQMTKIKTDKDNKKKGRKLRVT---RCKNMRKSNNTVSNIKN 376

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 14/112 (12%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITEK 384
           +FV NLD   D+E L + F   G I   +++RD   N  KGF +V F   E   KA+   
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 385 NQQIV----------AGKPLYVAIAQRKDVRRS-QLAQQIQARNQMRYQQVT 425
            +Q+            G+ L V     K++R+S      I+  N++   Q T
Sbjct: 337 EKQMTKIKTDKDNKKKGRKLRVTRC--KNMRKSNNTVSNIKNNNKLSESQRT 386

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%), Gaps = 25/111 (22%)

Query: 179 YSAKEAVDAI----NGMLLNGQEVYV------APHVSKKDRQSKLEEAKSNFTNIYVKNI 228
           Y  K+AV+ I    NG + +   + V      APH  K+              +I+V N+
Sbjct: 237 YKNKQAVNIISSKLNGNVFHNHHLRVDSVAHPAPHDKKR--------------SIFVGNL 282

Query: 229 DLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAV 278
           D E  +E     F   G+I    + RD +    +GF ++ F++ ES  KA+
Sbjct: 283 DFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKAL 333

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           S++VG LD    E  L+  F   GS+  +R+ RD  T    G+AYV F++
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNE 278

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 10/86 (11%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITE 383
           ++FV NLD   D+E L   F   G+I   +++RD   N  KGF +V F+  +  +KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-- 286

Query: 384 KNQQIVAGKPLYVAIAQRKDVRRSQL 409
               ++  KP+   I+Q + +++ +L
Sbjct: 287 ----LLNEKPM---ISQNEHLKKRKL 305

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDA 187
           ++F+ NL    D ++L   F   G+I   +I  D   N  KGF +V F E  S  +A   
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKA--- 285

Query: 188 INGMLLN 194
              +LLN
Sbjct: 286 ---LLLN 289

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           S++VG LD   +E  L+  F   G +  +R+ RD  T    G+AYV F D
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFAD 309

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 1/102 (0%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGN-SKGFGFVCFSTPEEATKAITE 383
           ++FV NLD    +E L   F   G I   +++RD   N  KGF +V F+      KA+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLL 319

Query: 384 KNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQQVT 425
            ++++  GK   + + + +++++ Q      A  ++  QQ T
Sbjct: 320 NDKKMAVGKGRKLRVTRCRNMQKVQRQSNTAALPKLTDQQKT 361

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           ++++G L   + E  L   F   G +  IR+ +D IT+ S GYA++ F D  + + A ++
Sbjct: 108 TIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

Query: 101 LNY---TTIKGRPC 111
           +       IK R C
Sbjct: 168 IGVHRGIQIKDRIC 181

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITE 383
           +F+  L   +D+ +L+  F  FG I   ++++D     SKG+ F+ F  P  +  A  E
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 11/83 (13%)

Query: 200 VAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EG 258
           V PH+   D           +  I++  +  +  + E +  F +FG+I    + +D    
Sbjct: 96  VDPHIKDTD----------PYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQ 145

Query: 259 KPRGFGFINFEDHESAAKAVDEL 281
           K +G+ FI F+D  S+  A  E+
Sbjct: 146 KSKGYAFIVFKDPISSKMAFKEI 168

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPR-GFGFINFEDHESAAKAVDEL 281
           IY+ NI L+TT EE +  F   G I    +  D    P  G+ ++ F+  +S  KA+D  
Sbjct: 47  IYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD-F 105

Query: 282 NDTDFKSQRLYVGR 295
           N T+ +   + V R
Sbjct: 106 NGTNLRQHVISVER 119

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query: 7   KTAEQLEQLKINDDQQTAPTST----ESENA-KVDTSSASLYVGELDPTVTEALLYDLFS 61
           K +E  E L ++ +  T  +++    E ++A +++  + S+Y+G +    T   + + F 
Sbjct: 7   KISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADACSIYIGNISLDTTPEEIDEHFK 66

Query: 62  PIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
             G +  I +  D  T  S+GYAYV F   D+   A+
Sbjct: 67  SCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKAL 103

>Scas_565.8
          Length = 322

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 64/143 (44%), Gaps = 23/143 (16%)

Query: 227 NIDLETTQEEFEALFTQFGKITSAVLE--------RDSEGKPRGFGFINFEDHESAAKAV 278
           N+   T+  E E L   FGK+  +VL         R ++    G+ ++ FE  + AA A 
Sbjct: 23  NVRFNTSDAELEELLKPFGKV--SVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAATAF 80

Query: 279 DELNDTDFKSQRLYVG-----------RAQKKYERLQELRKQYEVSRLEKLAKYQGVN-- 325
           +EL+ T+FK + LY+               KK  R +E     ++ + +K++K +     
Sbjct: 81  NELHKTEFKGRTLYIKPYEEFIPFGWRTKWKKKVRNEEDAVDTQLIQPKKVSKKETSTDI 140

Query: 326 LFVKNLDDSIDDEKLRDEFAPFG 348
           L+   L   + DEK+R  F  F 
Sbjct: 141 LYCSKLPKDVTDEKIRALFREFN 163

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 52  TEALLYDLFSPIGSVSSIRVCRDAI----TKT-SLGYAYVNFHDHDAGRTAIQKLNYTTI 106
           ++A L +L  P G VS +           TK  S+GYAYV F       TA  +L+ T  
Sbjct: 29  SDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAATAFNELHKTEF 88

Query: 107 KGRPCRI 113
           KGR   I
Sbjct: 89  KGRTLYI 95

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAIT------SAKVMRDDAGNSKGFGFVCFSTPEEATK 379
           L   N+  +  D +L +   PFG ++      S    R     S G+ +V F TP+ A  
Sbjct: 19  LVFTNVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAAT 78

Query: 380 AITEKNQQIVAGKPLYV 396
           A  E ++    G+ LY+
Sbjct: 79  AFNELHKTEFKGRTLYI 95

>Kwal_27.11096
          Length = 201

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 203 HVSKKDRQS--KLEEAKSNF--TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-E 257
           ++ KK R++   LE+ + +     IYV N+   T++E+   LF++ G I   ++  D  +
Sbjct: 24  YLMKKARRNPDGLEDLRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFK 83

Query: 258 GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV------------GRAQKKYERLQE 305
             P GF F+ +   E A  AV  L+DT    + + +            GR +   +   E
Sbjct: 84  FTPCGFCFVIYNTPEEALNAVKYLSDTKLDDRNISLDLDPGFEDGRQFGRGKSGGQVSDE 143

Query: 306 LRKQYEVSR 314
           LR +++ SR
Sbjct: 144 LRFEFDASR 152

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%)

Query: 31  ENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E+ +    SA++YVG L    +E  +Y+LFS  G +  I +  D    T  G+ +V ++ 
Sbjct: 37  EDLRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 91  HDAGRTAIQKLNYTTIKGR 109
            +    A++ L+ T +  R
Sbjct: 97  PEEALNAVKYLSDTKLDDR 115

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 315 LEKLAK-YQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSK-GFGFVCFS 372
           LE L +  +   ++V NL     +E++ + F+  G I    +  D    +  GF FV ++
Sbjct: 36  LEDLRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYN 95

Query: 373 TPEEATKAI 381
           TPEEA  A+
Sbjct: 96  TPEEALNAV 104

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVD 279
           + IYV N+   T++E+   LF++ G I   ++  D  +  P GF FI +   + A  AV 
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVK 105

Query: 280 ELNDTDFKSQRLYV------------GRAQKKYERLQELRKQYEVSR 314
            L DT    + + +            GR +   +   ELR +++ SR
Sbjct: 106 YLGDTKLDDKSITIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S+++YVG L    +E  +Y+LFS  G +  I +  D    T  G+ ++ ++       A+
Sbjct: 45  SSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAV 104

Query: 99  QKLNYTTIKGRPCRI 113
           + L  T +  +   I
Sbjct: 105 KYLGDTKLDDKSITI 119

>Scas_714.59
          Length = 233

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 324 VNLFVKNLDDSIDDEKLRDEFA-PFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
             L +  L+++ D+  LR+E   PF  I    V+R+ + G SKG  FV FS+ + A KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 118 RDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFE 176
           RDP  R        ++    A +N    +    F  I  C +  + E G SKG  FV F 
Sbjct: 141 RDPRERDDLCTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFS 200

Query: 177 EEYSAKEAVDAING 190
            E  A++A+  ++G
Sbjct: 201 SEQMAEKALHFLDG 214

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 48/110 (43%), Gaps = 23/110 (20%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEG------KPRGFGFINFEDHESAAK 276
           +Y+ N+  + T+E        F  ++  +  +   G      +P G  ++ F+D ++AAK
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPLGIAYVEFKDADTAAK 110

Query: 277 AVDELN-------------DTDFKSQRLYVGRAQKKY----ERLQELRKQ 309
            + ELN                FKS++  + R   K+     RL ELR++
Sbjct: 111 VILELNGVTFMDRELRLRYHIPFKSEKEKLARGPNKFRQIQRRLSELRRR 160

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 7/80 (8%)

Query: 42  LYVGELDPTVTEALLYDL---FSPIGSVSSIRVCRDAITKTS---LGYAYVNFHDHDAGR 95
           +Y+  L    TE  L +    F P+  +   +  R    KTS   LG AYV F D D   
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVR-GFQKTSVRPLGIAYVEFKDADTAA 109

Query: 96  TAIQKLNYTTIKGRPCRIMW 115
             I +LN  T   R  R+ +
Sbjct: 110 KVILELNGVTFMDRELRLRY 129

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFEDHESAAKAVD 279
           + IYV N+   T++E+   LF++ G I   ++  D  +  P GF FI +   + A  A+ 
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALK 105

Query: 280 ELNDTDFKSQRLYV------------GRAQKKYERLQELRKQYEVSR 314
            L+DT    + + +            GR +   +   ELR  ++ SR
Sbjct: 106 YLSDTKLDEKTITIDLDPGFEDGRQFGRGKSGGQVSDELRFDFDASR 152

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           S+++YVG L    +E  +Y+LFS  G++  I +  D    T  G+ ++ +   D    A+
Sbjct: 45  SSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNAL 104

Query: 99  QKLNYTTI 106
           + L+ T +
Sbjct: 105 KYLSDTKL 112

>Scas_570.14
          Length = 113

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 326 LFVKNLDDSIDDEKLRDE----FAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           L+V NLD+ I+ ++LR      F+ +G +    +    A   +G  F+   T +EA  A+
Sbjct: 32  LYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAI---SAKKQRGQAFITMRTVDEANLAL 88

Query: 382 TEKNQQIVAGKPLYVAIAQ 400
              N +    KPL++  ++
Sbjct: 89  ISLNNEPFFDKPLHIQFSK 107

>Scas_316.1
          Length = 483

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 5/76 (6%)

Query: 206 KKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSA--VLERDSEGKPRGF 263
           K+D + K +  K +F+ I+V+N+  + T+E   A F++FG++  A  V++R + G  +G 
Sbjct: 229 KRDERPK-QNKKEDFS-IFVRNVPYDATEESLAAHFSKFGQVKYALPVIDR-TTGLAKGT 285

Query: 264 GFINFEDHESAAKAVD 279
            F+ F DH +    +D
Sbjct: 286 AFVAFRDHMTYKYCID 301

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 27/142 (19%)

Query: 168 KGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEA----KSNFTNI 223
           +GFGFV F  E   KEA+       L G  + V     ++DR +K  E     K   T+ 
Sbjct: 5   RGFGFVSFAVEDDTKEALKQARKAKLKGHLLRV-DIAKRRDRSNKPGEGDKPEKKTRTDT 63

Query: 224 YVKNIDLETTQE----------------------EFEALFTQFGKITSAVLERDSEGKPR 261
             ++ + E  +E                      + + +F++FG +  A + +  +GK  
Sbjct: 64  IARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLC 123

Query: 262 GFGFINFEDHESAAKAVDELND 283
           GF F+  +   +   A++   D
Sbjct: 124 GFAFVTMKKLSNCTIALENTKD 145

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 66/158 (41%), Gaps = 15/158 (9%)

Query: 261 RGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK--YERLQELRKQYEVSRLEKL 318
           RGFGF++F   +   +A+ +      K   L V  A+++    +  E  K  + +R + +
Sbjct: 5   RGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTI 64

Query: 319 AKYQGV------------NLFVKNLDDSIDD-EKLRDEFAPFGAITSAKVMRDDAGNSKG 365
           A+ +               L ++N+  S  D  +L+  F+ FG +  A + +   G   G
Sbjct: 65  ARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCG 124

Query: 366 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 403
           F FV        T A+       + G+ + V  A +K+
Sbjct: 125 FAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQKN 162

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 58/156 (37%), Gaps = 31/156 (19%)

Query: 82  GYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGN------------ 129
           G+ +V+F   D  + A+++     +KG   R+  ++R     K G G+            
Sbjct: 6   GFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIA 65

Query: 130 ------------------IFIKNL-HPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGF 170
                             + I+N+     D   L   FS FG ++   I     G   GF
Sbjct: 66  RDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGF 125

Query: 171 GFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSK 206
            FV  ++  +   A++    + ++G+ V V   V K
Sbjct: 126 AFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQK 161

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 120 PSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI-LSCKIATDEAGNSKGFGFVHFEEE 178
           P   KK   +IF++N+      ++L   FS FG +  +  +     G +KG  FV F + 
Sbjct: 234 PKQNKKEDFSIFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDH 293

Query: 179 YSAKEAVD----AINGMLLNGQEV 198
            + K  +D    A +  LL G +V
Sbjct: 294 MTYKYCIDNAPAAGSTSLLIGDDV 317

>Scas_720.2
          Length = 245

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%)

Query: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98
           SA++YVG L    +E  +Y+LFS  G +  I +  D    T  G+ +V + +      A+
Sbjct: 46  SATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNAL 105

Query: 99  QKLNYTTIKGRPCRI 113
           + L+ T +  +   I
Sbjct: 106 KYLSDTKLDDKHITI 120

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 213 LEEAKSNF--TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDS-EGKPRGFGFINFE 269
           LEE + +     IYV N+   T++E+   LF++ G I   ++  D  +  P GF F+ + 
Sbjct: 37  LEELRQSLQSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYS 96

Query: 270 DHESAAKAVDELNDTDFKSQRLYV 293
           + + A  A+  L+DT    + + +
Sbjct: 97  NAQEALNALKYLSDTKLDDKHITI 120

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGK----ITSAVLERDSEG------KPRGFGFINFEDHE 272
           +Y+ N+    ++ +  A    +G     I +  + R S+       KP G  F  F ++ 
Sbjct: 20  VYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNT 79

Query: 273 SAAKAVDELNDTDFKSQRLYV 293
            A KA+ +LN T F++Q+L++
Sbjct: 80  LALKAIQDLNGTVFQNQKLFL 100

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 103 YTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD 162
           +T +  +P R   +++  + R   SG I+I  L      + L   F+ FG++   ++A +
Sbjct: 54  HTILPQQPARRSGAKKQ-AARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARN 112

Query: 163 -EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201
            + GNS+ + F+ F     A  A + ++  LL G  + V+
Sbjct: 113 KKTGNSRHYAFIEFANPDDAVVAQETMHNYLLMGHLLQVS 152

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           +++  L     + +L   FA FG +   ++ R+   GNS+ + F+ F+ P++A  A    
Sbjct: 80  IYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETM 139

Query: 385 NQQIVAGKPLYVAI 398
           +  ++ G  L V++
Sbjct: 140 HNYLLMGHLLQVSV 153

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 211 SKLEEAKSNFTNI-YVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINF 268
           +K + A+++ + I Y+  +     + E    F QFG +    L R+ + G  R + FI F
Sbjct: 67  AKKQAARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEF 126

Query: 269 EDHESAAKAVDELND 283
            + + A  A + +++
Sbjct: 127 ANPDDAVVAQETMHN 141

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281
           I+V  +DL TT+E     F+  GKI +     D   KP   F FI +E  ++AA A+D+ 
Sbjct: 378 IFVGQLDLSTTKEILVKRFSTHGKIRNI----DVVSKPTTVFAFIEYETEQAAAAALDKE 433

Query: 282 NDTDFKSQRLYV 293
           N +   S+ ++V
Sbjct: 434 NHSILLSKTMHV 445

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100
           S++VG+LD + T+ +L   FS  G + +I    D ++K +  +A++ +    A   A+ K
Sbjct: 377 SIFVGQLDLSTTKEILVKRFSTHGKIRNI----DVVSKPTTVFAFIEYETEQAAAAALDK 432

Query: 101 LNYTTIKGRPCRIMWSQ 117
            N++ +  +   + + +
Sbjct: 433 ENHSILLSKTMHVQYKE 449

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 326 LFVKNLDDSIDDEKL----RDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           +FV +L  S+ D++L       F  +G +   KV+RDD  +++ + FV +   ++A  A+
Sbjct: 97  IFVASLASSLPDDQLCMNVTKHFQNYGQLVGVKVLRDD--HNRPYAFVQYINDKDAKHAL 154

Query: 382 TEKNQQIVAGKPLYVAIAQRKDVRRSQL 409
              +  ++ G+ L    A+   V R+ L
Sbjct: 155 KNASGTVLNGRKLRCEAAK---VNRTLL 179

>Kwal_26.8458
          Length = 219

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%)

Query: 16  KINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDA 75
           K++  +  A  S +  N+K D  S  +YV  L     E  L   FS  G +  +R+ R+ 
Sbjct: 66  KLDPKKNAAQKSGKKGNSKADGLSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNK 125

Query: 76  ITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIM 114
            T  S  Y +V F + +    A + ++   + G   +++
Sbjct: 126 KTGNSRHYGFVEFVNKEDSFVAQETMHNYLLMGHLLQVV 164

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAV 185
           SG I++  L      + L   FS FG++   ++A ++  GNS+ +GFV F  +  +  A 
Sbjct: 89  SGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQ 148

Query: 186 DAINGMLLNGQEVYV 200
           + ++  LL G  + V
Sbjct: 149 ETMHNYLLMGHLLQV 163

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384
           ++V  L     + +L   F+ FG +   ++ R+   GNS+ +GFV F   E++  A    
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETM 151

Query: 385 NQQIVAGKPLYV 396
           +  ++ G  L V
Sbjct: 152 HNYLLMGHLLQV 163

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281
           IYV  +     + E    F+QFG +    L R+ + G  R +GF+ F + E +  A + +
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETM 151

Query: 282 ND 283
           ++
Sbjct: 152 HN 153

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 324 VNLFVKNLDDSIDDEKLRDEFA-PFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
             L +  ++++ D+  LR+E   PF  I    V+R+ + G S+G  FV FS+ E A +A+
Sbjct: 191 CTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 25  PTSTESENAKVDTSSASLYVGELDPTVTE-ALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           P+S    +++      +L + +++    E +L  +L  P   +  + V R+  T  S G 
Sbjct: 176 PSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGL 235

Query: 84  AYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQ 117
           A+V F   +    A++ L+         R+ WS+
Sbjct: 236 AFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSK 269

>Scas_241.1
          Length = 186

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 8/94 (8%)

Query: 117 QRDPSLRKKGSGN---IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFV 173
           Q+ P+L      N   +FI  L   +    L   F  FG+I+  KI T      KG GFV
Sbjct: 12  QQQPTLNHLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPT-----GKGCGFV 66

Query: 174 HFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKK 207
            + +  SA+ A+  + G  L    + ++   S K
Sbjct: 67  QYVDRLSAELAISKMQGFPLANSRIRLSWGRSSK 100

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 42/100 (42%), Gaps = 7/100 (7%)

Query: 17  INDDQQTAPTSTE-SENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDA 75
           +N  Q   P   + + N   D ++ ++++G L   V+E  L   F P G +  +++    
Sbjct: 2   LNSSQFMYPVQQQPTLNHLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKI---- 57

Query: 76  ITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMW 115
              T  G  +V + D  +   AI K+    +     R+ W
Sbjct: 58  --PTGKGCGFVQYVDRLSAELAISKMQGFPLANSRIRLSW 95

>Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement
          Length = 280

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 14/100 (14%)

Query: 121 SLRKKGSGNIFIKNLHPAIDN---KALHDTFSVFG--------NILSCKIATDEAGNSKG 169
           ++++K +  IF+ NL  +++N     L   F+ FG        N   CK+  D  GN KG
Sbjct: 36  TMKRKQNSAIFVSNL--SVENTKRDELISEFNKFGMIRRDLSTNDYKCKLYFDSTGNFKG 93

Query: 170 FGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHV-SKKD 208
              + +    S   A++ ++G  LNG+++ V   V SKK+
Sbjct: 94  EALIVYVRPESVGMAINMMDGFELNGEKITVQEAVFSKKN 133

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 72/184 (39%), Gaps = 24/184 (13%)

Query: 296 AQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEK---LRDEFAPFGAIT- 351
            ++K ER + L KQ  + R       Q   +FV NL  S+++ K   L  EF  FG I  
Sbjct: 21  VKRKKEREERLSKQLTMKR------KQNSAIFVSNL--SVENTKRDELISEFNKFGMIRR 72

Query: 352 -------SAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV--AIAQRK 402
                    K+  D  GN KG   + +  PE    AI   +   + G+ + V  A+  +K
Sbjct: 73  DLSTNDYKCKLYFDSTGNFKGEALIVYVRPESVGMAINMMDGFELNGEKITVQEAVFSKK 132

Query: 403 DVRRSQLAQQIQARNQM---RYQQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPN 459
           + +  +L      R ++   + Q              G+    +   V+PP   P +   
Sbjct: 133 NSKEDELGMPTTKRRKLENEKEQAKRLDDWEDTDSQQGETYTVILGNVLPPYDDPVDDEE 192

Query: 460 PQQM 463
            +++
Sbjct: 193 IKEI 196

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 209 RQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLE------RDSEGKPRG 262
           RQ  ++ +++N   +Y+ N+  +TT++E      ++  ++  +        R+S  +P G
Sbjct: 11  RQQTVQPSENN-RRVYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRGFRNSRVRPLG 69

Query: 263 FGFINFEDHESAAKAVDELNDTDFKSQRL 291
             + +FE  + A +A++ LN   F ++ L
Sbjct: 70  IAYADFESADKAKEAIEALNGKVFNNRTL 98

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 169 GFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSK-----KDRQSKLEEAKSNFTNI 223
           G  +  FE    AKEA++A+NG + N + + + P+V+        + SK  + +S F+ +
Sbjct: 69  GIAYADFESADKAKEAIEALNGKVFNNRTLRLKPYVAYSPAVVSRKPSKANKEESRFSKL 128

Query: 224 YVK 226
            VK
Sbjct: 129 KVK 131

>Kwal_23.5204
          Length = 294

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 130 IFIKNLHPAIDNK-ALHDTFSVFGNILS--------CKIATDEAGNSKGFGFVHFEEEYS 180
           I++ NL      K A+   FS +G I          CK+ TDE G+ KG   V +    S
Sbjct: 49  IYVSNLPLGSTTKDAVVKEFSKYGIIQKDAKTNEPRCKLYTDEQGSFKGSALVVYMRRES 108

Query: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKD 208
              A+D +NG    G E+ V     KKD
Sbjct: 109 VDLAIDLMNGYRFLGNELKVEEATFKKD 136

>Kwal_55.20903
          Length = 147

 Score = 35.0 bits (79), Expect = 0.056,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186
           S +IF++++   I   +L D F   G+I    + + +  +  G+ +V F  + SA+ A++
Sbjct: 58  SRSIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERALE 117

Query: 187 AINGMLLNGQEVYVA 201
            ++G +L G ++ VA
Sbjct: 118 -LDGSILRGHKLRVA 131

 Score = 32.0 bits (71), Expect = 0.60,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 56/113 (49%), Gaps = 4/113 (3%)

Query: 15  LKINDDQQTAPTSTESENA-KVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCR 73
           LK ++      ++ + EN  + +T S S+++ ++   ++   L D F  +GS+  I +  
Sbjct: 33  LKSSNRSSHQESAAKGENIDQSETDSRSIFLRDIPSDISLPSLEDHFRDMGSICRITMIS 92

Query: 74  DAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRD-PSLRKK 125
               K+  GYAYV F    +   A++ L+ + ++G   R+   + + P +R K
Sbjct: 93  KQ-RKSGTGYAYVEFATKASAERALE-LDGSILRGHKLRVARKRTNVPRMRVK 143

 Score = 31.6 bits (70), Expect = 0.84,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 325 NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEK 384
           ++F++++   I    L D F   G+I    ++     +  G+ +V F+T   A +A+ E 
Sbjct: 60  SIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-EL 118

Query: 385 NQQIVAGKPLYVAIAQRKDVRRSQL 409
           +  I+ G  L VA  +R +V R ++
Sbjct: 119 DGSILRGHKLRVA-RKRTNVPRMRV 142

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 28/65 (43%)

Query: 222 NIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDEL 281
            ++V     ET   +    F   GKI    +      + R F F+ FE HE   +AV+EL
Sbjct: 6   TVHVSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEEL 65

Query: 282 NDTDF 286
           +   F
Sbjct: 66  DGRPF 70

>Kwal_30.12890
          Length = 280

 Score = 35.8 bits (81), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 55  LLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLN 102
           L Y+L  P G +  + V R+  T  S G AYV F   +   TA+  LN
Sbjct: 213 LRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLN 260

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 237 FEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDF 286
           +E LF  FG+I   V+ R+ E G+ RG  ++ FE  E A  A++ LN   F
Sbjct: 215 YELLF-PFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGF 264

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 328 VKNLDDSIDDEKLRDEFA-PFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
           +  L+++ D+  LR E   PFG I    V+R+ + G S+G  +V F T E A  A+
Sbjct: 201 IMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETAL 256

>Kwal_55.21039
          Length = 119

 Score = 33.9 bits (76), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 9/84 (10%)

Query: 326 LFVKNLDDSIDDEKLRDE----FAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           L+V NL+D +  + LR+     F+ +G +       D +   +G  F+   T +EA  A+
Sbjct: 37  LYVHNLNDRVKIQTLRENLFLLFSTYGEVLQI----DMSKRIRGQAFIVLKTVDEANIAL 92

Query: 382 TEKNQQIVAGKPLYVAIAQRKDVR 405
              N +   GK L++  + +KD R
Sbjct: 93  ISLNNEPFFGKDLHIQFS-KKDSR 115

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFG-AITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEK 384
           + +KN+  +I  E+L D        +  A     D G  +G  F  F+TPEE T+ IT  
Sbjct: 87  IVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANFTTPEETTQVITSL 146

Query: 385 NQQIVAGKPLYV 396
           N + ++G+ L V
Sbjct: 147 NGKEISGRKLKV 158

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 36.2 bits (82), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGA-ITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEK 384
           + +KN+  +I  E+L D     G  +  A     D G  +G  F  FSTPE+ ++ I++ 
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 385 NQQIVAGKPLYV 396
           N + + G+ L V
Sbjct: 118 NGKEINGRKLKV 129

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 223 IYVKNIDLETTQEEFEALFTQFG-KITSAVLERDSEGKPRGFGFINFEDHESAAKAVDEL 281
           I +KNI     +E+   +  + G  +  A       G  RG  F NF   E  ++ + +L
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 282 NDTDFKSQRLYV 293
           N  +   ++L V
Sbjct: 118 NGKEINGRKLKV 129

>Sklu_2060.3 YIR009W, Contig c2060 4599-4931
          Length = 110

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 10/99 (10%)

Query: 29  ESENAKVDTS-SASLYVGELD----PTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           ES   + +TS   +LYV  L+    P      LY LFS  G V  +     ++T    G 
Sbjct: 16  ESHEGQPETSPKNTLYVNNLNDQIRPNTLRENLYLLFSTYGEVIQV-----SMTSKERGQ 70

Query: 84  AYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSL 122
           A+V     +    A+  L      G+P RI +S+ D  L
Sbjct: 71  AFVLLRTMNEANLAMISLQDEPFFGKPLRIRFSRTDSQL 109

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 326 LFVKNLDDSIDDEKLRDE----FAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           ++VKNL+D I  + +R+     FA +G +    +        +G  F+ F + +EA  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSM----TPKQRGQAFITFKSVDEANLAL 89

Query: 382 TEKNQQIVAGKPLYVAIAQRKDVR 405
                ++   KPL +  +++   +
Sbjct: 90  LSLKDELFFNKPLVLQFSKQTTTK 113

>Kwal_26.6824
          Length = 739

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 141 NKALHDTFSVFGNILSCKIATDEAGN-SKGFGFVHFEEEYSAKEAVDAING--------M 191
           +K L   FS  G ++   +  DEA   +KG+ FV F+   SA++A+  +NG        +
Sbjct: 57  SKVLTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLNGKKLDVKHRL 116

Query: 192 LLNG 195
           L+NG
Sbjct: 117 LVNG 120

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%)

Query: 51  VTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLN 102
           V   +L  LFS  G V  I +  D   K + GY +V F    + R AI+ LN
Sbjct: 55  VLSKVLTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLN 106

>Kwal_55.20718
          Length = 594

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF 88
           S++VG+LDP  TE  L   FS  GS++ I +    ITK +  +A++ F
Sbjct: 201 SIFVGQLDPMATEEKLLKRFSRHGSITDINL----ITKPNNVFAFIKF 244

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKN 385
           +FV  LD    +EKL   F+  G+IT   ++      +  F F+ F+T E A  A+  +N
Sbjct: 202 IFVGQLDPMATEEKLLKRFSRHGSITDINLITKP---NNVFAFIKFTTEEAAAAALEMEN 258

Query: 386 QQIVAGKPLYVAIAQRKDVRRSQLAQQ 412
             I   K ++V   +   ++R +   Q
Sbjct: 259 HAIFLSKTMHVQYREIGGIKRFRRGNQ 285

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 326 LFVKNLDDSIDDEKLRDEFA-PFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
           L +  L++  D+  +R E   PFG I    V+R+ + G S+G  ++ F T E A  A+
Sbjct: 200 LKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETAL 257

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 240 LFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQK 298
           L   FG+I   V+ R++E G+ RG  +I FE  E A  A++ L+   F +  L+   ++ 
Sbjct: 218 LLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNLILHAEWSKP 277

Query: 299 K 299
           K
Sbjct: 278 K 278

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 39  SASLYVGELDPTVTEALLY-DLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTA 97
           + +L + +L+    E+ +  +L  P G +  + V R+  T  S G +Y+ F   +   TA
Sbjct: 197 AKTLKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETA 256

Query: 98  IQKLN 102
           +  L+
Sbjct: 257 LNFLD 261

>AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH]
           complement(381754..382098) [345 bp, 114 aa]
          Length = 114

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 9/84 (10%)

Query: 40  ASLYVGELDPTVTEALL----YDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95
           ++LY+  L+  V  + L    Y LFS  G V      R A++    G A+V     D   
Sbjct: 32  STLYISNLNDQVKISTLRTNLYLLFSTFGEV-----LRIAMSPKLRGQAFVVLSTVDEAN 86

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRD 119
            A+  L   +  G+P RI +S+ D
Sbjct: 87  LAMISLKDESFFGKPLRIQFSKSD 110

 Score = 32.3 bits (72), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 325 NLFVKNLDDSIDDEKLRDE----FAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKA 380
            L++ NL+D +    LR      F+ FG +    +    +   +G  FV  ST +EA  A
Sbjct: 33  TLYISNLNDQVKISTLRTNLYLLFSTFGEVLRIAM----SPKLRGQAFVVLSTVDEANLA 88

Query: 381 ITEKNQQIVAGKPLYVAIAQ 400
           +     +   GKPL +  ++
Sbjct: 89  MISLKDESFFGKPLRIQFSK 108

>Scas_589.4
          Length = 530

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 20/122 (16%)

Query: 193 LNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNI--DLETTQEEFEALFTQFGKITSA 250
           LN     +A  V+K+D   +          ++V N+  +L+ + E+    F  FG+    
Sbjct: 9   LNWTMSSIADTVNKEDSTVR----------VFVGNLQNNLDASLEDLYKRFGTFGQCVDP 58

Query: 251 VLERDSEGKPRGFGFIN--FEDHESAAKAV-DELNDTDFKSQRLYVGRAQKKYERLQELR 307
           V E     K  GF +IN  FED  +  K + + LN+  FK   L + +A+  ++   +LR
Sbjct: 59  VFE-----KHNGFAYINMTFEDGLAGFKKLKNSLNNVKFKGNLLVIDQAKPDWQESWKLR 113

Query: 308 KQ 309
           ++
Sbjct: 114 QE 115

>ACL149W [900] [Homologous to ScYDL167C (NRP1) - SH]
           complement(88715..90601) [1887 bp, 628 aa]
          Length = 628

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 23/102 (22%)

Query: 198 VYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGK------ITSAV 251
           V   P+ S  D  S ++E       +Y+ N+  +TTQ E E+ FTQFG           V
Sbjct: 178 VLTHPYDSYADMTSFIQERSEV---LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNV 234

Query: 252 LE--------------RDSEGKPRGFGFINFEDHESAAKAVD 279
           +E              R  E      GF+ F+ HE+A++A++
Sbjct: 235 VEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALN 276

>Kwal_55.22147
          Length = 468

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 21/120 (17%)

Query: 223 IYVKNI--DLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFIN--FEDHESAAKAV 278
           ++V NI  D +T+  E    F +FGK TS   E  +      FG++N  FE+  + AK  
Sbjct: 7   VFVGNIYNDHDTSLTELYRRFQRFGKCTSDKFESHAH-----FGYVNMEFENEAAFAKLK 61

Query: 279 DELNDTDFKSQRLYVGRA----QKKYERLQ--------ELRKQYEVSRLEKLAKYQGVNL 326
              N   FK   L V  A    Q+++++ Q        E +KQ E S+ E   K + + +
Sbjct: 62  QSFNGVKFKGNILKVDVAKMGWQERWKKDQEEGQHIEEEKQKQMEKSQWEHYKKLENIKM 121

>Scas_537.5
          Length = 570

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 23/103 (22%)

Query: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG---------- 245
           Q V   P+ S  D ++ L+E       +Y+ N+  +TTQ E E+ FTQFG          
Sbjct: 196 QLVLTRPYDSYADIKTFLQERSRV---LYMNNLPSDTTQSELESWFTQFGARPIGFWTAK 252

Query: 246 ---KITSAVLERDS-EGKPR------GFGFINFEDHESAAKAV 278
              + TS++    S  G P         GF+ F+ HE A +A+
Sbjct: 253 NTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHEEATEAL 295

>AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH]
           (705111..705524,706055..706303) [663 bp, 220 aa]
          Length = 220

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 130 IFIKNLHPAIDNKALHDTF-SVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAI 188
           + ++ L   I   A+ D F S  G +    ++ +E GNS G   + F     A+EAV   
Sbjct: 68  VNVEGLPRDIKEDAVRDFFRSSVGGLQRVLLSYNERGNSTGMATLTFANAEKAREAVKKF 127

Query: 189 NGMLLNG 195
           NG  ++G
Sbjct: 128 NGAPIDG 134

>Scas_683.32
          Length = 272

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 204 VSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGF 263
           + K+  Q+K   A  NF  + V+  D+   QE+ E+ F + GK+    L RD + K  G 
Sbjct: 111 IDKRMEQNKRTLAVMNFP-VEVEGDDISELQEQIESFFDKLGKVNQVRLRRDHKKKFNGN 169

Query: 264 GFINFEDHESA 274
             + FE  E  
Sbjct: 170 VLVEFESLEEC 180

>CAGL0G05401g complement(508557..510572) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, hypothetical start
          Length = 671

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 223 IYVKNIDLETTQEEFEALFT-QFGKITSAVLERDSEGKPRGFG---FINFEDHESAAKAV 278
           +YV N+  + T++E   LF+ QFG    +   +++ G   G G   F+ F+D   A +A+
Sbjct: 546 LYVGNLPSDATEQELRQLFSNQFGFRRLSFRNKNANGTGHGHGPMCFVEFDDVSCATRAL 605

Query: 279 DEL 281
            EL
Sbjct: 606 VEL 608

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 323 GVNLFVKNLDDSIDDEKLRDEFA-PFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKA 380
              L +  L+++ D+  LR+E   PF  I    V+R+ + G S+G  FV F   + A KA
Sbjct: 188 SCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKA 247

Query: 381 I 381
           +
Sbjct: 248 L 248

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 25  PTSTESENAKVDTSSASLYVGELDPTVTE-ALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           P+S    +A+    S +L + +L+    E  L  +L  P   +  + V R+  T  S G 
Sbjct: 174 PSSDAYRDARERDDSCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGL 233

Query: 84  AYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQ 117
           A+V F + D    A+  L+         R+ WS+
Sbjct: 234 AFVTFINEDMAEKALHFLDGRGFMNLILRVDWSK 267

>AFL061C [3132] [Homologous to ScYPL184C - SH] (317447..319018)
           [1572 bp, 523 aa]
          Length = 523

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 61/138 (44%), Gaps = 19/138 (13%)

Query: 172 FVHFEEEYSAKE--AVDAINGMLLNGQEVYVA--PHVSKKDRQSKLEEAKSNFTNIYVKN 227
           FV F +  +A +  A+ +++G+ ++ +   +    H         L  ++    NIY+ N
Sbjct: 380 FVTFIDPTAAAQFYAMSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGN 439

Query: 228 IDLET---------TQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           ID            T+    A+F +FG++     E+ +    R   FINF +  SA  A+
Sbjct: 440 IDFAADKKSQHPIFTEAALRAVFQEFGEV-----EQINFLYERNCCFINFANISSAILAI 494

Query: 279 DELNDT-DFKSQRLYVGR 295
           D++     FK  ++  G+
Sbjct: 495 DKIKSIPTFKDLKINFGK 512

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 47/127 (37%), Gaps = 24/127 (18%)

Query: 84  AYVNFHDHDAGRT--AIQKLNYTTIKGRPCRIMWSQRDPSL--------RKKGSGNIFIK 133
            +V F D  A     A+  L+  TI  + C+I W +    L         +  S NI++ 
Sbjct: 379 CFVTFIDPTAAAQFYAMSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLG 438

Query: 134 NL---------HPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEA 184
           N+         HP     AL   F  FG +       +     +   F++F    SA  A
Sbjct: 439 NIDFAADKKSQHPIFTEAALRAVFQEFGEVEQINFLYE-----RNCCFINFANISSAILA 493

Query: 185 VDAINGM 191
           +D I  +
Sbjct: 494 IDKIKSI 500

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 332 DDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           ++ I +EKLR++ + FG + + K++ +     KG  FV FS+   A K +
Sbjct: 217 EEVITEEKLRNDLSDFGEVENVKIVPE-----KGIAFVHFSSIFAAIKVV 261

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 326 LFVKNLD-DSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEK 384
           LF+ NL   ++  + L   F+PFG I    +          FGF+ +  P+    AI  +
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 385 NQQIVAGKPLYVAIA 399
           +Q+I  GK L + ++
Sbjct: 385 SQEINFGKKLILEVS 399

>YDL167C (NRP1) [704] chr4 complement(160996..163155)
           Asparagine-rich protein with one RNA recognition (RRM)
           domain [2160 bp, 719 aa]
          Length = 719

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245
           + V   P+ S  D ++ L+E KS    +Y+ N+  +TTQ E E+ FTQ+G
Sbjct: 204 ESVLTKPYDSHTDIRAFLQE-KSKI--LYMNNLPPDTTQSELESWFTQYG 250

>KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036
           Saccharomyces cerevisiae YKL214c singleton, start by
           similarity
          Length = 173

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 215 EAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESA 274
           + +   T + ++NI LET+  E E    + G++ S  +    E +      + F+D +  
Sbjct: 45  DRRKRITLLRIRNIPLETSDYEIEDWINEIGEVESIRINDRKENR---VATVGFKDVQLL 101

Query: 275 AKAVDELNDTDFKSQRLYV 293
             AV++LN  +    +L V
Sbjct: 102 GTAVEKLNGKEVHGSQLEV 120

>YLL046C (RNP1) [3376] chr12 complement(46713..47462)
           Ribonucleoprotein 1, contains two RNA recognition (RRM)
           domains which include RNP-1 octamer and RNP-2 hexamer
           motifs [750 bp, 249 aa]
          Length = 249

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 12/83 (14%)

Query: 170 FGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSN---------- 219
           F F+ F+E  + K+  + +NG +   +++ V  ++  K+ +S  +  KSN          
Sbjct: 79  FAFIEFQEGVNLKKVKEKMNGKIFMNEKI-VIENILTKEEKSFEKNQKSNKKTAPDLKPL 137

Query: 220 -FTNIYVKNIDLETTQEEFEALF 241
               +YVKNI +++T E+   +F
Sbjct: 138 STNTLYVKNIPMKSTNEDLAKIF 160

>KLLA0A03531g 320828..323026 similar to sp|P06103 Saccharomyces
           cerevisiae YOR361c PRT1 translation initiation factor
           eIF3 subunit singleton, start by similarity
          Length = 732

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 142 KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQ 196
           K L   FS  G +L  +I   E G +KG  F+  E   +AKEA+   NG  L+ +
Sbjct: 57  KVLTKLFSQAGKVLDMQIPV-EDGKTKGHLFIEMESVSAAKEAIQLFNGKKLDAK 110

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 214 EEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHE 272
           E  K   + IYV  +     + E    F+QFG +    L R+ + G  R + FI F + +
Sbjct: 85  ESNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKD 144

Query: 273 SAAKAVDELND 283
            A  A D +N+
Sbjct: 145 DALVAQDTMNN 155

>Sklu_2434.14 YOR361C, Contig c2434 32150-34360
          Length = 736

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 142 KALHDTFSVFGNILSCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGMLLN 194
           K L   FS  G ++   +  DE    +KG+ FV F+   +AK+A+  +NG  L+
Sbjct: 58  KVLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLNGKKLD 111

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 49  PTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLN 102
           P +T+ +L  LFS  G+V  + +  D   KT+ GY +V F    A + AI  LN
Sbjct: 54  PVLTK-VLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLN 106

>ACL133W [916] [Homologous to NOHBY] complement(119503..120618)
           [1116 bp, 371 aa]
          Length = 371

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 17/23 (73%)

Query: 333 DSIDDEKLRDEFAPFGAITSAKV 355
           D +  E LR EFAPFGA+T A++
Sbjct: 119 DRLRWETLRAEFAPFGAVTRARI 141

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 96/226 (42%), Gaps = 31/226 (13%)

Query: 83  YAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSG-------NIFIKNL 135
           +AYV+  + ++   AIQ LN   I G   +++  + +P  R K S         I I+NL
Sbjct: 143 FAYVDLPNMESLDKAIQLLNGKDING--YKLVVKKSNPENRDKRSDAPVLERREIIIRNL 200

Query: 136 HPAIDNK-ALHDTFSVFGNILSCKIATDE----AGNSKGFGFVHFEEEYSAKEAVDAING 190
              +  K  L D F  +G I   +I   +    +  + G  FV +     AK A++  N 
Sbjct: 201 PKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSALEMNNH 260

Query: 191 MLLNGQEVYVAPHVSKKDRQSKLEEAKSN----------FTNIYVKNIDLETTQEEFEAL 240
           ++    ++ ++ ++S  D  + LE  + N          +  IY   I  +T++E+    
Sbjct: 261 VI---DDIKISVNLS--DSHAYLERKEVNRIINSKHTEKYAAIYP--ISDKTSKEQIRNF 313

Query: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDF 286
                 +    L+           F+ FE   +AAKA+ +LN++ F
Sbjct: 314 INDKNAVLVEELKNIYLVTDYKAVFLKFERESTAAKAMLQLNNSTF 359

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 11/92 (11%)

Query: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155
           T I++  YT       RI   Q  P   +   GN+ +KN    +  + L   FS +G+I 
Sbjct: 314 TPIERQRYTEYLRGENRITEIQHFPPKSRLFIGNLPLKN----VTKEDLFRIFSPYGHIF 369

Query: 156 SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDA 187
              I          FGF+ +++  S K+A++ 
Sbjct: 370 QINIKN-------AFGFIQYDDPQSVKDAIEC 394

>Kwal_56.24638
          Length = 527

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 20/76 (26%)

Query: 223 IYVKNIDLETTQEEFEALFTQFG-------KITSAVLERDS-------------EGKPRG 262
           +Y+ N+  +TTQ E E+ FTQFG        + + V E  +             E +   
Sbjct: 212 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSI 271

Query: 263 FGFINFEDHESAAKAV 278
            GF+ F+ HE A +A+
Sbjct: 272 SGFVVFQSHEEATEAL 287

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 326 LFVKNLDDSIDDEKL----RDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAI 381
           +FV +L  ++ D++L     + F  +G +   KV+RD+A  ++ + FV ++   +A  A+
Sbjct: 95  IFVASLAAALSDDELCLSVTENFKKYGDLARVKVLRDNA--NRPYAFVQYNNDHDAKHAL 152

Query: 382 TEKNQQIVAGKPLYVAIAQ 400
                 ++ G+ L    A+
Sbjct: 153 IRAQGTLLNGRRLRCEPAK 171

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 23/117 (19%)

Query: 203 HVSKKDRQSKL--------EEAKSNFT----NIYVKNIDLETTQEEFEALFTQFGKITSA 250
           HV   D + KL        E+  S  T    +I+V  +D ETT+EE    F+  GKI   
Sbjct: 316 HVHGSDSEEKLTSDGIYDDEDKDSEITIDKRSIFVGQLDKETTREELNRRFSTHGKIQDI 375

Query: 251 VLERDSEGKPRG-FGFINFEDHESAAKAVDELNDTDFKSQRLYV------GRAQKKY 300
            L      KP   F FI +E  E+AA A++  N   F ++ ++V      GR  +K+
Sbjct: 376 NL----IFKPTNIFAFIKYETEEAAAAALESENHAIFLNKTMHVQYKEVGGRHNRKF 428

>Sklu_2063.4 YDL167C, Contig c2063 1979-3781
          Length = 600

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 23/101 (22%)

Query: 198 VYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG-------KITSA 250
           V   P+ S  D ++ L+E       +Y+ N+  +TTQ E E+ FTQFG        + + 
Sbjct: 199 VLTHPYDSYLDVRTFLQERSKV---LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNV 255

Query: 251 VLERDS-------------EGKPRGFGFINFEDHESAAKAV 278
           V E  +             E +    GF+ F+ HE A +A+
Sbjct: 256 VEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEEATEAL 296

>Scas_663.15
          Length = 753

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 142 KALHDTFSVFGNILSCKIATDEA-GNSKGFGFVHFEEEYSAKEAVDAINGMLLN 194
           KAL   FS  G +++     DEA G SKGF FV       AK+ + + NG  L+
Sbjct: 87  KALTGLFSKAGKVVNMDFPIDEASGKSKGFLFVECGSSDDAKKILKSFNGKRLD 140

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQ 117
           L SP  +V  + V R+  T  S G AYV F       TA++ L+         ++ WS+
Sbjct: 208 LLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWSK 266

>ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH]
           (1420640..1422850) [2211 bp, 736 aa]
          Length = 736

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 142 KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLN 194
           K L   FS  G+++   +  +E G +KG  F+ FE+  +A+ A+   NG  L+
Sbjct: 57  KVLTKLFSQAGSVVDMDVPVEE-GRTKGHLFIEFEDAGAARRAIKMFNGKKLD 108

>CAGL0K09966g complement(974102..976261) highly similar to sp|P06103
           Saccharomyces cerevisiae YOR361c PRT1, hypothetical
           start
          Length = 719

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 142 KALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLN 194
           KAL   FS  G ++  +   D+   SKGF FV    +  AK+ + A +G  L+
Sbjct: 55  KALGGLFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGKRLD 107

>CAGL0G05511g complement(522026..524050) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, start by similarity
          Length = 674

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 223 IYVKNIDLETTQEEFEALFT-QFGKITSAVLERDSEGKPRGFG---FINFEDHESAAKAV 278
           +YV N+  +T+++E   LF+ Q G    +   +++ G   G G   F+ FED   A +A+
Sbjct: 560 LYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFEDVSFATRAL 619

Query: 279 DEL 281
            EL
Sbjct: 620 AEL 622

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 325 NLFVKNLDDSIDDEKLRDEFA-PFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAI 381
            + +  +++  D+E L+ E   PFG I    V+++ + G S+G  +V F T E A +A+
Sbjct: 185 TIRLTQVNELADEEVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQAL 243

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 27/68 (39%)

Query: 53  EALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCR 112
           E L  +L  P G +  + V ++  T  S G AYV F   +    A++ L           
Sbjct: 198 EVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLH 257

Query: 113 IMWSQRDP 120
             WS+  P
Sbjct: 258 AEWSKPKP 265

>KLLA0B08976g complement(786122..787039) weakly similar to sp|P32605
           Saccharomyces cerevisiae YBR119w MUD1 U1 snRNP-specific
           A protein singleton, start by similarity
          Length = 305

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 223 IYVKNIDLETTQEEFEALFTQFG----KITSAVLERDSEGKPRGFGFINFEDHESAAKAV 278
           + V+N+  + TQ+E E LF   G    ++ S           R   F+ ++   +A K V
Sbjct: 235 LLVQNLPKDVTQQELEKLFVSDGFKEVRLVSV----------RNLCFVEYDSTANATKVV 284

Query: 279 DEL-NDTDFKSQRLYVGRAQK 298
           + L +D  FK+  + +G A+K
Sbjct: 285 ETLGHDHPFKNVTIKIGYAKK 305

>KLLA0A09097g 794827..797244 some similarities with sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 805

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 446 GVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQFGRPNGPMYGVPPQGA--PQGGFPRN 503
           G+  P  +P +GPNP   AA  G P N ++P      P+ P +  PP G   PQ   P++
Sbjct: 386 GLSQPGSLPMSGPNPWMFAAPHGSP-NFLVP-----HPHHPGHAGPPAGHQRPQSNNPQH 439

Query: 504 GGNQF 508
               F
Sbjct: 440 RKRHF 444

>Kwal_14.2265
          Length = 555

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 9/41 (21%)

Query: 546 PPQEVVPLLENDDLFE---------QHFKEAFAAYESFKKD 577
           PP+E  P +  DDL E         +  KE FAAY  F KD
Sbjct: 11  PPEEATPEVNRDDLMELGIPTKNPNRTKKEKFAAYGRFAKD 51

>Sklu_2414.9 YKL204W, Contig c2414 20547-22373
          Length = 608

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 43/104 (41%), Gaps = 17/104 (16%)

Query: 408 QLAQQIQARNQ--MRYQQVTXXXXXXXXGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAA 465
           Q  Q  Q RN   + +  V+         +P QFMP    G MPP G P   P P     
Sbjct: 505 QPQQGKQTRNDQPLSHDNVSRERQRQQRQVPPQFMP--AQGGMPPPGFPLMQPPPGFSPN 562

Query: 466 MGGMPKNGVIPPQ------------QFGRPNGPMYGVPPQGAPQ 497
           M  +P NG+ PPQ            QFG P      VPPQ APQ
Sbjct: 563 MPVVP-NGMAPPQGFFPPQPPVSFLQFGHPQMANSNVPPQMAPQ 605

>AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH]
           (303268..305541) [2274 bp, 757 aa]
          Length = 757

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 128 GNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDA 187
           GN+ +KN    +  + L   FS +G+I    I          FGF+ ++   S K+A++ 
Sbjct: 294 GNLPLKN----VTKEDLFRIFSPYGHIFQINI-------KNAFGFIQYDNAQSVKDAIEC 342

Query: 188 INGMLLNGQEVYV 200
            +G +  G+++ +
Sbjct: 343 ESGTMNFGKKLIL 355

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 36/83 (43%), Gaps = 12/83 (14%)

Query: 434 GMPGQF-MPPMFYGVMPPRGVPFNGPNPQQMAAM-GGMPKNGVIPPQQFGRPNGPMYGVP 491
           G P +F  PP   G  PPR + F    P+ M+    G P N  +PPQQ   PN     VP
Sbjct: 273 GPPQRFRQPPQ--GGYPPRPMGFGQEGPRAMSLTNSGRPLNMAMPPQQ-PYPNANYGPVP 329

Query: 492 PQGAPQGGFPRNGGNQFYHQKQR 514
           PQ A       NG      Q QR
Sbjct: 330 PQYA-------NGPRTMSLQNQR 345

>CAGL0J07546g complement(731562..733931) similar to sp|P13134
           Saccharomyces cerevisiae YNL238w KEX2 endoproteinase of
           late golgi compartment, hypothetical start
          Length = 789

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 4/108 (3%)

Query: 262 GFGFINFEDHESAAKAVDELN-DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAK 320
           G+G +N  +  + AK  + +N   +F +    V     K ++  E   +   S LEK AK
Sbjct: 448 GYGKLNAHNIVALAKDWENVNPQVEFATDIKEVNEETDKEDKPIESTIEITASDLEK-AK 506

Query: 321 YQGVNLFVKNLDDSIDDEKLR--DEFAPFGAITSAKVMRDDAGNSKGF 366
           ++ V     N+D S ++      D  +PFG ++   V+R    +++GF
Sbjct: 507 FRSVEHVTINVDISTENRGTTTIDLISPFGVVSHLGVVRRKDDSNEGF 554

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 205 SKKDRQSKLEEAKSNFTNI-YVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRG 262
           S+ D+    E+  S+ + I Y+  +     + E    F+QFG +    L R+ + G  R 
Sbjct: 166 SENDKAKAKEDKSSDLSGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRH 225

Query: 263 FGFINFEDHESAAKAVDELND 283
           + F+ + + + A  A + +N+
Sbjct: 226 YAFLEYINKDDAVVAQESMNN 246

>KLLA0D12364g complement(1051765..1053660) some similarities with
           sp|P32770 Saccharomyces cerevisiae YDL167c ARP1
           singleton, hypothetical start
          Length = 631

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFG 245
           T +Y+ N+  +TTQ E E+ F QFG
Sbjct: 236 TVLYMNNLPPDTTQSELESWFAQFG 260

>CAGL0I05082g complement(473462..475276) some similarities with
           sp|P34217 Saccharomyces cerevisiae YBL051c, hypothetical
           start
          Length = 604

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 221 TNIYVKNIDLETTQEEFEALFTQFG-KITSAVLERDSEGKPRGFGFINFEDHESAAKAVD 279
           T I +KNI     +E+     T     +  A       G  RG  F N+      AK V+
Sbjct: 66  TAIVIKNIPFALKREQLLDFMTSLDLPLPYAFNYHFDNGTFRGLAFANYNSEVDTAKVVN 125

Query: 280 ELNDTDFKSQRLYV 293
           ELN+ +   + L V
Sbjct: 126 ELNEKEVGGRNLRV 139

>CAGL0C01419g complement(153063..154982) similar to sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 639

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 14/96 (14%)

Query: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAIT---EKN-----Q 386
           + +EKLR++   +G I S K++ +     K   FV FS+   A K ++   +KN     +
Sbjct: 335 LTEEKLREDLKEYGEIDSIKIIPE-----KDIAFVHFSSIATAIKVVSTLAQKNPFYQEK 389

Query: 387 QIVAGKPLYVAIAQRKDVRRSQ-LAQQIQARNQMRY 421
           +I  GK     I + +    +Q L  Q +  + MRY
Sbjct: 390 KIFYGKDRCAFITKTQQHNAAQFLGVQPEMEHLMRY 425

>CAGL0J05852g complement(554403..555434) weakly similar to sp|P40580
           Saccharomyces cerevisiae YIR036, hypothetical start
          Length = 343

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 11/56 (19%)

Query: 350 ITSAKVMRDDAGNSKG-------FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
           + +A+ ++ + GNSKG         F+ F+T  +A K I    Q+I+AGKPL + I
Sbjct: 79  LEAAESIKQEIGNSKGSISVVSGCDFLDFTTVPQAGKRI----QEILAGKPLNIII 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,223,791
Number of extensions: 883307
Number of successful extensions: 4784
Number of sequences better than 10.0: 279
Number of HSP's gapped: 4252
Number of HSP's successfully gapped: 744
Length of query: 589
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 482
Effective length of database: 12,891,983
Effective search space: 6213935806
Effective search space used: 6213935806
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)