Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1837.21611395896e-79
ABL015C2201363793e-46
YMR233W226963786e-46
KLLA0B13024g124843419e-42
CAGL0M04939g233793222e-37
YOR295W (UAF30)228812542e-27
Kwal_55.2030878702292e-25
CAGL0G07557g241881872e-17
Scas_665.26249681522e-12
AER282W90935631.9
Kwal_27.1037690153622.6
KLLA0C12331g66262605.7
Kwal_14.147623736595.9
CAGL0F07425g61446596.6
KLLA0E20361g69354589.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1837.2
         (161 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement        231   6e-79
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...   150   3e-46
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...   150   6e-46
KLLA0B13024g complement(1138572..1138946) some similarities with...   135   9e-42
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...   128   2e-37
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...   102   2e-27
Kwal_55.20308                                                          93   2e-25
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    77   2e-17
Scas_665.26                                                            63   2e-12
AER282W [2784] [Homologous to ScYMR266W (RSN1) - SH] complement(...    29   1.9  
Kwal_27.10376                                                          28   2.6  
KLLA0C12331g 1049113..1051101 similar to sgd|S0002904 Saccharomy...    28   5.7  
Kwal_14.1476                                                           27   5.9  
CAGL0F07425g complement(722699..724543) similar to sp|P53137 Sac...    27   6.6  
KLLA0E20361g 1801106..1803187 some similarities with sp|P34226 S...    27   9.6  

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score =  231 bits (589), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 117/139 (84%)

Query: 1   MSQEELVKRDAKLAAKLQXXXXXXXXXXXXXXXXXXXXXXVSENANSIQARKVLLSKKLE 60
           MSQEELVKRDAKLAAKLQ                      VSENANSIQARKVLLSKKLE
Sbjct: 1   MSQEELVKRDAKLAAKLQKQEDDAKRKKKRKTDKPKKKRKVSENANSIQARKVLLSKKLE 60

Query: 61  QFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKILSK 120
           QFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKILSK
Sbjct: 61  QFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKILSK 120

Query: 121 HLFNPEDVVNGSKEKEELQ 139
           HLFNPEDVVNGSKEKEELQ
Sbjct: 121 HLFNPEDVVNGSKEKEELQ 139

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score =  150 bits (379), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (67%), Gaps = 2/136 (1%)

Query: 1   MSQEELVKRDAKLAAKLQXXXXXXXXXXXXXXXXXXXXXXV--SENANSIQARKVLLSKK 58
           +SQEELV+RD+++AA L                          S+N NS   R V LS+ 
Sbjct: 73  LSQEELVQRDSEMAAALVRGDAGRAKRPRKRDADKPRKKRANQSDNPNSFHMRPVQLSEP 132

Query: 59  LEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKIL 118
           L++ LGE +LPRTQVVK VWDYIK+H LQNP+DRREILCD AMEP+FGKKMTMFSMNKIL
Sbjct: 133 LQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKIL 192

Query: 119 SKHLFNPEDVVNGSKE 134
           S+HL NP+DV    ++
Sbjct: 193 SQHLTNPKDVSGSDQD 208

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score =  150 bits (378), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 67/96 (69%), Positives = 82/96 (85%)

Query: 42  SENANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAM 101
           S ++NSI  RKVLLS  L++FLG  ELPRTQVVK +W YIKEHDLQNP DRREILCD+ M
Sbjct: 113 SPDSNSISVRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKM 172

Query: 102 EPIFGKKMTMFSMNKILSKHLFNPEDVVNGSKEKEE 137
           EPIFGKKMTMFSMNK+L+KHLFNP+++V   +E+++
Sbjct: 173 EPIFGKKMTMFSMNKLLTKHLFNPDEIVKHEEEQKQ 208

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score =  135 bits (341), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 61/84 (72%), Positives = 73/84 (86%)

Query: 41  VSENANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDA 100
            ++N NSI  +KV LS +L++FL   E+PRTQVVK VWDYIKEHDLQNP DRREI+CDDA
Sbjct: 23  ANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDA 82

Query: 101 MEPIFGKKMTMFSMNKILSKHLFN 124
           M+PIFG+KMTMF++NKILSKHLFN
Sbjct: 83  MKPIFGEKMTMFTLNKILSKHLFN 106

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score =  128 bits (322), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%)

Query: 44  NANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEP 103
           N+N+I + K+ LS  L +FLGE ELPRTQVVK+VWDYIKEH+LQ+P DRREI+CDD M P
Sbjct: 130 NSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDDRMRP 189

Query: 104 IFGKKMTMFSMNKILSKHL 122
           IFG KMTMF++NKILSKHL
Sbjct: 190 IFGDKMTMFALNKILSKHL 208

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score =  102 bits (254), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (72%)

Query: 48  IQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGK 107
           I  RKV LSK L   LGE EL RT+VV+++W YIK H+LQNPN+++EILCD+ +E I GK
Sbjct: 119 ISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGK 178

Query: 108 KMTMFSMNKILSKHLFNPEDV 128
              MF M+KIL+ H+  P+ +
Sbjct: 179 STNMFEMHKILASHMTEPKKI 199

>Kwal_55.20308
          Length = 78

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 55/70 (78%)

Query: 68  LPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKILSKHLFNPED 127
           + RTQ+VKKVW++IK++ LQNP+DRREI CDD M+P+FG+K TMF++NK LS H+   ++
Sbjct: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60

Query: 128 VVNGSKEKEE 137
            V  SK  E+
Sbjct: 61  TVQPSKTAED 70

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (63%)

Query: 41  VSENANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDA 100
           V+ +  S+   K+ ++ +L+  +G     RT++V+ +W YIKEH+LQNP+D+R+I+ D  
Sbjct: 116 VTNSKKSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAM 175

Query: 101 MEPIFGKKMTMFSMNKILSKHLFNPEDV 128
           +EP+ GK   +F M++ L  H+  P  +
Sbjct: 176 LEPVLGKTSDIFMMHRALKHHILGPAPI 203

>Scas_665.26
          Length = 249

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%)

Query: 55  LSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSM 114
           +S+ L  F GETEL +++++ ++WDYI+ H L+  N+  EILCDD +  +FG+ +    +
Sbjct: 125 ISEPLRGFFGETELTKSEIMNRIWDYIELHKLKRSNNSEEILCDDKLGLVFGEVVLAHKI 184

Query: 115 NKILSKHL 122
             + SK+L
Sbjct: 185 PTMTSKYL 192

>AER282W [2784] [Homologous to ScYMR266W (RSN1) - SH]
           complement(1153079..1155808) [2730 bp, 909 aa]
          Length = 909

 Score = 28.9 bits (63), Expect = 1.9,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 45  ANSIQARKVLLSKKLEQFLGETELPRTQV-VKKVW 78
           A  + +R VL     EQ+L ETE  +  V VK++W
Sbjct: 199 AKKLSSRTVLFQSVPEQYLSETEFSKLFVGVKRIW 233

>Kwal_27.10376
          Length = 901

 Score = 28.5 bits (62), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 45  ANSIQARKVLLSKKLEQFLGETELPRT-QVVKKVWDYIKEHDLQNPNDRREIL 96
           A  + +R VL     +Q+L E E P+  + VK VW       L    D RE L
Sbjct: 182 AKKLSSRTVLFQSVPKQYLSEREFPKLFEGVKNVWIARGAGSLAKKVDEREKL 234

>KLLA0C12331g 1049113..1051101 similar to sgd|S0002904 Saccharomyces
           cerevisiae YDR496c, start by similarity
          Length = 662

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 41  VSENANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDA 100
           VS++A   + RK L  +KL++  GET     Q +K +W+ ++  +   P   RE LC++ 
Sbjct: 106 VSQHA---EQRKTLKERKLQRKSGET----VQQIKSLWERLRVKNPPIPKPVREKLCNEI 158

Query: 101 ME 102
            E
Sbjct: 159 WE 160

>Kwal_14.1476
          Length = 237

 Score = 27.3 bits (59), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 5/36 (13%)

Query: 65 ETELPRTQVV-----KKVWDYIKEHDLQNPNDRREI 95
          ET LP T +V     KK  ++ + ++ Q PND R I
Sbjct: 16 ETLLPDTYIVVRIDGKKFHEFSRYYEFQKPNDERAI 51

>CAGL0F07425g complement(722699..724543) similar to sp|P53137
           Saccharomyces cerevisiae YGL110c, hypothetical start
          Length = 614

 Score = 27.3 bits (59), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 77  VWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKILSKHL 122
           +W+ +K +  +NPN  R +L D +++P      T  +  K +  HL
Sbjct: 128 IWNLVKYYANRNPNSVRALL-DGSLKPQINTTRTQLNWAKQIQTHL 172

>KLLA0E20361g 1801106..1803187 some similarities with sp|P34226
           Saccharomyces cerevisiae YBL061c SKT5 protoplast
           regeneration and killer toxin resistance protein,
           hypothetical start
          Length = 693

 Score = 26.9 bits (58), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 70  RTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGK--KMTMFSMNKILSKH 121
           R Q +K+   Y+K+  ++   D + +L D     +FGK  +   FS+ +  +KH
Sbjct: 231 RQQFLKEALHYLKKLSVKGYKDAQYLLADSYSSGVFGKVNQKEAFSLFQASAKH 284

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,797,460
Number of extensions: 139192
Number of successful extensions: 361
Number of sequences better than 10.0: 29
Number of HSP's gapped: 359
Number of HSP's successfully gapped: 29
Length of query: 161
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 68
Effective length of database: 13,376,635
Effective search space: 909611180
Effective search space used: 909611180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 57 (26.6 bits)