Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1768.31851859851e-138
KLLA0A04840g1981915496e-72
Kwal_47.174511861795409e-71
Scas_638.81881874973e-64
CAGL0A00297g1981764872e-62
YGL018C (JAC1)1841814712e-60
AGR164C2001764621e-58
AFR639W15645800.011
AFR659W27372770.035
YOR254C (SEC63)66355720.19
AFL071C351110710.23
Kwal_26.887965655670.78
CAGL0D01584g30054670.80
Sklu_1285.165955670.87
Scas_706.898481651.6
KLLA0C09823g66954642.0
CAGL0J02750g38247632.3
ADL327W30525623.1
KLLA0F22539g64166633.1
Kwal_14.245260777623.2
YMR061W (RNA14)67749623.7
KLLA0E24552g79351624.2
KLLA0E02024g14625604.3
AFR507W47463614.3
AAL103W66955614.3
AGL339C43050615.2
Sklu_2109.465855615.4
KLLA0E04345g42892605.7
CAGL0L12276g45255606.1
Sklu_2174.639347606.7
Kwal_14.113628672596.9
ADR124C61156607.3
YGL174W (BUD13)26675597.4
AGR400W22634588.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1768.3
         (185 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1768.3 YGL018C, Contig c1768 3648-4205                           384   e-138
KLLA0A04840g complement(430541..431137) similar to sp|P53193 Sac...   216   6e-72
Kwal_47.17451                                                         212   9e-71
Scas_638.8                                                            196   3e-64
CAGL0A00297g complement(30179..30775) similar to sp|P53193 Sacch...   192   2e-62
YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type cha...   186   2e-60
AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH] (1053441..1...   182   1e-58
AFR639W [3831] [Homologous to ScYJR097W - NSH] complement(160398...    35   0.011
AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH] complemen...    34   0.035
YOR254C (SEC63) [5042] chr15 complement(805031..807022) Componen...    32   0.19 
AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH] (3...    32   0.23 
Kwal_26.8879                                                           30   0.78 
CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces c...    30   0.80 
Sklu_1285.1 YMR061W, Contig c1285 449-2428 reverse complement          30   0.87 
Scas_706.8                                                             30   1.6  
KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces c...    29   2.0  
CAGL0J02750g complement(270406..271554) highly similar to sp|P39...    29   2.3  
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....    28   3.1  
KLLA0F22539g 2102745..2104670 some similarities with sp|P47069 S...    29   3.1  
Kwal_14.2452                                                           28   3.2  
YMR061W (RNA14) [4020] chr13 (392754..394787) Component of pre-m...    28   3.7  
KLLA0E24552g 2178343..2180724 gi|28565054|gb|AAO32610.1 Kluyvero...    28   4.2  
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    28   4.3  
AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH] complement(...    28   4.3  
AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH] complement(1...    28   4.3  
AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..786...    28   5.2  
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            28   5.4  
KLLA0E04345g complement(400495..401781) similar to sp|P39101 Sac...    28   5.7  
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    28   6.1  
Sklu_2174.6 YER048C, Contig c2174 7478-8659                            28   6.7  
Kwal_14.1136                                                           27   6.9  
ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH] (926131..92...    28   7.3  
YGL174W (BUD13) [1816] chr7 (174549..175349) Protein that may be...    27   7.4  
AGR400W [4711] [Homologous to ScYOL147C (PEX11) - SH] complement...    27   8.4  

>Sklu_1768.3 YGL018C, Contig c1768 3648-4205
          Length = 185

 Score =  384 bits (985), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/185 (100%), Positives = 185/185 (100%)

Query: 1   MQRLYTRFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTNDDS 60
           MQRLYTRFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTNDDS
Sbjct: 1   MQRLYTRFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTNDDS 60

Query: 61  STLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESIT 120
           STLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESIT
Sbjct: 61  STLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESIT 120

Query: 121 TEEDLHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKP 180
           TEEDLHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKP
Sbjct: 121 TEEDLHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKP 180

Query: 181 VHLTH 185
           VHLTH
Sbjct: 181 VHLTH 185

>KLLA0A04840g complement(430541..431137) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone singleton, start by similarity
          Length = 198

 Score =  216 bits (549), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 137/191 (71%), Gaps = 7/191 (3%)

Query: 1   MQRLYTRFYS------TKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGS 54
           M RL  R YS      +K  +Q FPKTF  GKPQW VDL++LR+EYR+LQ+  HPD   S
Sbjct: 9   MHRLLLRSYSNASSKTSKTLFQWFPKTFTSGKPQWEVDLKKLRKEYRQLQSEHHPDVITS 68

Query: 55  TTNDDSSTLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHE 114
           T ++ SS LN+AY TL +PL RSQY+L     IDL++D  A ++  +DP+LLM VLD+HE
Sbjct: 69  TVDNVSSELNRAYKTLSKPLPRSQYILSLHG-IDLTQDGEAQKVMSKDPQLLMLVLDVHE 127

Query: 115 QLESITTEEDLHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKE 174
           QLE I +EEDL QI +ENKQR+   ++ L   + + D+ETAA LT+EL+YW NLDNAIKE
Sbjct: 128 QLEDINSEEDLKQIEQENKQRLNECEQKLKKAHESQDWETAAMLTVELRYWSNLDNAIKE 187

Query: 175 WEPGKPVHLTH 185
           WEPGKP+ LTH
Sbjct: 188 WEPGKPILLTH 198

>Kwal_47.17451
          Length = 186

 Score =  212 bits (540), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 130/179 (72%)

Query: 7   RFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTNDDSSTLNKA 66
           R YS ++ YQLFPKTF  G  +W VDLR+LR EYR+LQA  HPD   +     SS LN A
Sbjct: 8   RLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSELNHA 67

Query: 67  YHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEEDLH 126
           Y TLRQPL R++Y+L+ QA IDL  +Q A  I QQ+PELLM VLD+HEQLES+TTEED+ 
Sbjct: 68  YQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVA 127

Query: 127 QISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKPVHLTH 185
            +++EN++RM  +++ L   +   D++ A +LT+EL+YW +LD A+KEWEPG+ + ++H
Sbjct: 128 AVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQRLEMSH 186

>Scas_638.8
          Length = 188

 Score =  196 bits (497), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)

Query: 1   MQRLYTRFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPD-AQGSTTNDD 59
           M+R  T+      FY+LFP+TFP   P W+VD  +LR+EYR LQA  HPD AQ S   D 
Sbjct: 1   MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT 60

Query: 60  -SSTLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLES 118
            SS LNKAYH L++PLTRSQYL++   ++DL++D V  +ITQ DPE+LM V++IHEQL  
Sbjct: 61  HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD 120

Query: 119 ITTEEDLHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPG 178
           I TEED+ +I +EN +RM  ++  L++ +   DFETA +LT+ELKYW N+  AIKEW PG
Sbjct: 121 IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180

Query: 179 KPVHLTH 185
           K + + +
Sbjct: 181 KEIQINN 187

>CAGL0A00297g complement(30179..30775) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone, hypothetical start
          Length = 198

 Score =  192 bits (487), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 124/176 (70%), Gaps = 3/176 (1%)

Query: 13  NFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDA---QGSTTNDDSSTLNKAYHT 69
           ++Y+LFP TFP  +P+W VDL +LR+EYRKLQA  HPD    +    ++ SS LNKAYH 
Sbjct: 23  SYYELFPGTFPDSQPRWDVDLGKLRKEYRKLQAEVHPDKIQKEQEADSEQSSLLNKAYHA 82

Query: 70  LRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEEDLHQIS 129
           L+ PLTRSQ+++Q    +DL+ D VA E TQ DPELLM V+D+HEQL    + +++ +I 
Sbjct: 83  LKDPLTRSQHMIQILKDVDLTVDSVAREYTQMDPELLMDVMDVHEQLLDANSRDEVREIE 142

Query: 130 KENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKPVHLTH 185
           K NKQR+E+++  L +CY N ++E A  LT  LKYW N+ +A+K+W PGKP+ L H
Sbjct: 143 KVNKQRIEKIEAELKECYDNKEYERAINLTARLKYWKNVASAVKDWAPGKPIDLKH 198

>YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type
           chaperone protein, may be involved in assembly of
           mitochondrial iron-sulfur proteins [555 bp, 184 aa]
          Length = 184

 Score =  186 bits (471), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 128/181 (70%), Gaps = 7/181 (3%)

Query: 7   RFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDA--QGSTTNDDSSTLN 64
           RF ST  FY+LFPKTFPK  P WT+D  +LR+EYR+LQA  HPD   QGS   + SSTLN
Sbjct: 9   RFTST--FYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGS---EQSSTLN 63

Query: 65  KAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEED 124
           +AYHTL+ PL RSQY+L+   +IDL+++Q ++E+T  DP+LL+ VLDIH++L  +  E  
Sbjct: 64  QAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAG 123

Query: 125 LHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKPVHLT 184
           +  + K+NK+R++ ++  L  CY + D+  A +LT+ELKYW NL  A K+W PGK + + 
Sbjct: 124 VKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLEMN 183

Query: 185 H 185
           H
Sbjct: 184 H 184

>AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH]
           (1053441..1054043) [603 bp, 200 aa]
          Length = 200

 Score =  182 bits (462), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 123/176 (69%), Gaps = 2/176 (1%)

Query: 10  STKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTNDDSSTLNKAYHT 69
           + +N ++ FP TFP G+PQW VD+R+LR+EYR+LQ   HPD  G T ++ +  LN+AY T
Sbjct: 27  ADENPFRAFPATFPSGEPQWDVDVRRLRREYRQLQGQHHPDVAGGT-DEAAQRLNRAYGT 85

Query: 70  LRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEEDLHQIS 129
           L +PL R+Q+LL  Q  +D++ D  A EI Q+DP LLM VLD+HEQLE + +E D+ ++ 
Sbjct: 86  LVRPLARAQFLLARQG-VDVTADATAQEIMQRDPGLLMRVLDVHEQLEELESEADVRRLR 144

Query: 130 KENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKPVHLTH 185
           +EN+ RM  V+  L   +A   ++ AA+L +EL+YW N+++A++EWEPG   H+ H
Sbjct: 145 EENRARMAGVEAELGRAFAARAWDRAAQLAVELRYWDNVESAVREWEPGTVPHVKH 200

>AFR639W [3831] [Homologous to ScYJR097W - NSH]
          complement(1603985..1604455) [471 bp, 156 aa]
          Length = 156

 Score = 35.4 bits (80), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 35 QLRQEYRKLQAISHPDAQGSTTNDDSSTLNKAYHTLRQPLTRSQY 79
          ++RQ YR+    +HPD QG       + + +AY  L  P  RS Y
Sbjct: 19 EVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAY 63

>AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH]
          complement(1640183..1641004) [822 bp, 273 aa]
          Length = 273

 Score = 34.3 bits (77), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%)

Query: 10 STKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTT--NDDSSTLNKAY 67
            K+ Y L   +    +    VD  QLR ++R+L    HPD +   T  ND   ++ KAY
Sbjct: 12 GGKDLYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAY 71

Query: 68 HTLRQPLTRSQY 79
            L     R+ Y
Sbjct: 72 DILSNSSLRATY 83

>YOR254C (SEC63) [5042] chr15 complement(805031..807022) Component
           of ER protein-translocation subcomplex, which includes
           Sec62p, Sec63p, Sec66p, and Sec72p, member of DnaJ
           protein family [1992 bp, 663 aa]
          Length = 663

 Score = 32.3 bits (72), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 34  RQLRQEYRKLQAISHPD--AQGSTTNDDSST------LNKAYHTLRQPLTRSQYL 80
           R ++  YRKL    HPD  A+G T ++ S        + KAY +L   L R  YL
Sbjct: 139 RDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNYL 193

>AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH]
           (301720..302775) [1056 bp, 351 aa]
          Length = 351

 Score = 32.0 bits (71), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 23/110 (20%)

Query: 29  WTVDLRQLRQEYRKLQAISHPDA-----------QGSTTNDDSSTLNKAYHTLRQPLTRS 77
           W +D+ Q  Q+Y +L   S+ +A           QGS  ++ +  L +  H LR  L+RS
Sbjct: 127 WLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILRSFLSRS 186

Query: 78  ------------QYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQ 115
                       + +L   A+  L ++   + I +Q+ EL + V D+  Q
Sbjct: 187 ATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQ 236

>Kwal_26.8879
          Length = 656

 Score = 30.4 bits (67), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 34  RQLRQEYRKLQAISHPD--AQGSTTNDDS------STLNKAYHTLRQPLTRSQYL 80
           R++R  YRKL    HPD  ++  + N+ S        + KAY  L   +TR  YL
Sbjct: 131 REIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDEVTRENYL 185

>CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces
           cerevisiae YPR061c, hypothetical start
          Length = 300

 Score = 30.4 bits (67), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 31  VDLRQLRQEYRKLQAISHPDAQGSTTNDDSSTLNKAYHTLRQPLTRSQYLLQTQ 84
           VDL++L+ EY K   + HPD   S      S+L K++H +    T +QYL Q +
Sbjct: 69  VDLKKLKMEYHKYVKMYHPDLS-SHIQIRKSSLVKSHHAMEIANT-AQYLTQAE 120

>Sklu_1285.1 YMR061W, Contig c1285 449-2428 reverse complement
          Length = 659

 Score = 30.4 bits (67), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 12  KNFYQLFPKT---FPKGKPQWTVDLRQL--RQEYRKLQAISHPDAQGSTTNDDSS 61
           +N  Q+F K    FP   P WT+ L     R E+ K++AI      G+T N+D S
Sbjct: 63  ENVRQVFDKAHDQFPYFSPLWTMQLNYELERDEFAKVEAILAKALAGATENNDLS 117

>Scas_706.8
          Length = 984

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 51  AQGSTTNDDSSTLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVL 110
           A+ ++ N+D S L   Y  L Q +  S Y LQ   +++ +K  V ++ T Q  ++L T +
Sbjct: 295 AKLTSINEDQSMLISTYSKLTQKV--SFYKLQVGWNVNTAKPSVLNDPTLQIHQVLETTI 352

Query: 111 DIHEQLESITTEEDLHQISKE 131
           D  +   ++    +LH +SK 
Sbjct: 353 DQLDSAGNVLELINLHVVSKS 373

>KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces
           cerevisiae YOR254c SEC63 ER protein-translocation
           complex subunit singleton, start by similarity
          Length = 669

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 34  RQLRQEYRKLQAISHPDAQGSTTNDDSST--------LNKAYHTLRQPLTRSQY 79
           ++++  YRKL    HPD      N+   T        +NKAY  L   +T+  Y
Sbjct: 125 KEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDEITKENY 178

>CAGL0J02750g complement(270406..271554) highly similar to
          sp|P39101 Saccharomyces cerevisiae YER048c CAJ1, start
          by similarity
          Length = 382

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 35 QLRQEYRKLQAISHPDAQGSTTNDDSS--TLNKAYHTLRQPLTRSQY 79
          ++++ YRK+  ++HPD         +    + +AY  L  P  R QY
Sbjct: 21 EIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLNDPALRKQY 67

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 31  VDLRQLRQEYRKLQAISHPDAQGST 55
           VD RQL++ Y +L  + HPD  G+ 
Sbjct: 103 VDARQLKKRYHELAKLYHPDTAGAA 127

>KLLA0F22539g 2102745..2104670 some similarities with sp|P47069
           Saccharomyces cerevisiae YJL019w singleton, hypothetical
           start
          Length = 641

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 72  QPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEEDLHQISKE 131
           Q + RSQ++ + Q+HI   K+ ++ EI  +  +L        +QL ++  ++ +H+I   
Sbjct: 353 QYIERSQFIQELQSHIQAIKEDLSREIESKTSQLQTP-----QQLSTVVLKKMIHRIYNS 407

Query: 132 NKQRME 137
           N+ ++E
Sbjct: 408 NQHQLE 413

>Kwal_14.2452
          Length = 607

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 14/77 (18%)

Query: 10  STKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTN-------DDSST 62
           S KN+Y++       G PQ     + +R+ Y  +    HPD QG  +        +  S 
Sbjct: 502 SKKNYYKVL------GVPQQATG-KDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSE 554

Query: 63  LNKAYHTLRQPLTRSQY 79
           +N+AY  L     R +Y
Sbjct: 555 INEAYEILSDEGKRKEY 571

>YMR061W (RNA14) [4020] chr13 (392754..394787) Component of pre-mRNA
           cleavage and polyadenylation factor I (CFI) involved in
           poly(A) site choice, interacts with Rna15p, Fip1p,
           Pap1p, and Pcf11p [2034 bp, 677 aa]
          Length = 677

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 15  YQLFPKTFPKGKPQWTVDLRQ--LRQEYRKLQAISHPDAQGSTTNDDSS 61
           Y+ F  TFP   P WT+ L+    R E+  ++ I      G   N+D S
Sbjct: 65  YEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLS 113

>KLLA0E24552g 2178343..2180724 gi|28565054|gb|AAO32610.1
           Kluyveromyces lactis SMY2, start by similarity
          Length = 793

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 8   FYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTND 58
           F +  + YQL P+T+   +P  +VD   ++ +Y+   A    +A  ST ND
Sbjct: 360 FAAKSDTYQLAPQTYQTTQPIRSVDATSIKDQYQPTNA--QTEASNSTAND 408

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 27.7 bits (60), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 30  TVDLRQLRQEYRKLQAISHPDAQGS 54
            +D R LRQ++R+   ++HPD  GS
Sbjct: 97  ALDERLLRQKHRRAMIMNHPDKGGS 121

>AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH]
          complement(1347615..1349039) [1425 bp, 474 aa]
          Length = 474

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query: 34 RQLRQEYRKLQAISHP-DAQGSTTNDDSSTLNKAYHTLRQPLTRSQYLLQTQAHIDLSKD 92
          RQ    +R+LQ I  P +  G   +  +S + KAY           Y L  Q H D++KD
Sbjct: 27 RQFHSSWRRLQEIRDPYETLGVAKDASASQIKKAY-----------YKLAKQFHPDINKD 75

Query: 93 QVA 95
          + A
Sbjct: 76 EGA 78

>AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH]
           complement(161385..163394) [2010 bp, 669 aa]
          Length = 669

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 8/55 (14%)

Query: 34  RQLRQEYRKLQAISHPDAQGSTTNDDSST--------LNKAYHTLRQPLTRSQYL 80
           R++R  YRKL    HPD       D   +        + KAY  L    TR  +L
Sbjct: 129 REIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDDATRDNFL 183

>AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..78622)
           [1293 bp, 430 aa]
          Length = 430

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 35  QLRQEYRKLQAISHPD---AQGSTTNDDS--STLNKAYHTLRQPLTRSQY 79
           Q+ + +RK     HPD   A G++  +D+    + KA+ TL  P+ R+Q+
Sbjct: 115 QIIKAHRKQVLKHHPDKKSAAGASLEEDNFFKIIQKAFETLTDPVKRAQF 164

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 28.1 bits (61), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 8/55 (14%)

Query: 34  RQLRQEYRKLQAISHPDA--------QGSTTNDDSSTLNKAYHTLRQPLTRSQYL 80
           +++R  YRKL    HPD         Q S   +    + KAY  L   +T+  YL
Sbjct: 130 KEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDEITKENYL 184

>KLLA0E04345g complement(400495..401781) similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1 dnaJ homolog,
           start by similarity
          Length = 428

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 19/92 (20%)

Query: 28  QWTVDL--RQLRQEYRKLQAISHPDAQGSTTNDDSST------LNKAYHTLRQPLTRSQY 79
           Q +VD   +++++ YRKL   +HPD       DD         L KAY  L     R +Y
Sbjct: 12  QVSVDASPQEIKKSYRKLAIKTHPDKNP----DDPQAQTKFQELAKAYQVLIDDDLRKKY 67

Query: 80  LLQTQAHIDLSKDQVASEITQQDP-ELLMTVL 110
               Q  +D +  ++  +   QDP E+LMTV 
Sbjct: 68  ---DQFGLDETNGEIPMD---QDPYEMLMTVF 93

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
          cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 10/55 (18%)

Query: 35 QLRQEYRKLQAISHPD-AQGSTTNDDSST---------LNKAYHTLRQPLTRSQY 79
          ++++ YRKL    HPD A+G+   +DSS          +  AY  L     R++Y
Sbjct: 17 EIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLSDASLRAEY 71

>Sklu_2174.6 YER048C, Contig c2174 7478-8659
          Length = 393

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 35 QLRQEYRKLQAISHPDAQGSTTNDDSS--TLNKAYHTLRQPLTRSQY 79
          ++++ YRK   ++HPD   +  +  +    + +AY  L  P  RS+Y
Sbjct: 21 EIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSDPGLRSRY 67

>Kwal_14.1136
          Length = 286

 Score = 27.3 bits (59), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 22/72 (30%)

Query: 1  MQRLYTR-FYSTKNFYQ-----------LFPKTFPKGK----------PQWTVDLRQLRQ 38
          M  L TR FYS  + ++           +F   +PKG           P   VD R L++
Sbjct: 1  MVSLITRTFYSNGSVFKRMASHSTNAEPVFDSAWPKGSCPTPYEIFGMPPGQVDSRSLKK 60

Query: 39 EYRKLQAISHPD 50
          +Y  +  + HPD
Sbjct: 61 KYHAMAKLYHPD 72

>ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH]
           (926131..927966) [1836 bp, 611 aa]
          Length = 611

 Score = 27.7 bits (60), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 31  VDLRQLRQEYRKLQAISHPDAQGSTTN-------DDSSTLNKAYHTLRQPLTRSQY 79
            + + +R+ Y  L    HPD QG+ ++       +  S++N+AY  L     R +Y
Sbjct: 520 ANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDESKRKEY 575

>YGL174W (BUD13) [1816] chr7 (174549..175349) Protein that may be
           involved in bipolar budding and bud site selection,
           possibly involved in pre-mRNA splicing [801 bp, 266 aa]
          Length = 266

 Score = 27.3 bits (59), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 17/75 (22%)

Query: 50  DAQGSTTNDDS----STLNKAYHTLRQPLTRSQYL------------LQTQAHIDLSKDQ 93
           DAQG    +DS    S+ +++ +   +   R QYL            +   AH D  K+Q
Sbjct: 125 DAQGHKIQEDSKIDDSSFSRSKYEDEKAAEREQYLKNLNMGDVQKLGINVDAH-DKKKNQ 183

Query: 94  VASEITQQDPELLMT 108
            AS +T +DP +  T
Sbjct: 184 TASSLTIEDPAITFT 198

>AGR400W [4711] [Homologous to ScYOL147C (PEX11) - SH]
           complement(1462988..1463668) [681 bp, 226 aa]
          Length = 226

 Score = 26.9 bits (58), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 113 HEQLESITTEEDLHQISKENKQRMERVQELLDDC 146
             +L + + E+D  Q+SK  ++R   V+ L+ DC
Sbjct: 154 QRRLATASPEKDARQLSKTQEERFRAVRRLIWDC 187

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,325,724
Number of extensions: 260087
Number of successful extensions: 1415
Number of sequences better than 10.0: 99
Number of HSP's gapped: 1397
Number of HSP's successfully gapped: 101
Length of query: 185
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 90
Effective length of database: 13,307,399
Effective search space: 1197665910
Effective search space used: 1197665910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)