Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1768.254254227740.0
Kwal_47.1745354454919520.0
AGR165W50054414660.0
YGL017W (ATE1)50354112531e-168
Scas_638.951055112191e-163
KLLA0A04862g50354512141e-162
CAGL0A00319g50955610981e-145
CAGL0M07766g238130984e-04
Sklu_2209.263664760.39
CAGL0I01342g38638683.3
AFR366W38238673.6
Scas_588.772664674.2
Sklu_2388.538974664.5
KLLA0F16775g39538664.9
Sklu_2393.638638664.9
YEL046C (GLY1)38738647.7
KLLA0D10824g50678658.2
KLLA0B00891g103662658.6
Scas_709.2038738648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1768.2
         (542 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement       1073   0.0  
Kwal_47.17453                                                         756   0.0  
AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH] complement(...   569   0.0  
YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase (...   487   e-168
Scas_638.9                                                            474   e-163
KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces c...   472   e-162
CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces cer...   427   e-145
CAGL0M07766g 781830..782546 no similarity, hypothetical start          42   4e-04
Sklu_2209.2 YNL216W, Contig c2209 1380-3290 reverse complement         34   0.39 
CAGL0I01342g complement(110120..111280) highly similar to sp|P37...    31   3.3  
AFR366W [3558] [Homologous to ScYEL046C (GLY1) - SH] complement(...    30   3.6  
Scas_588.7                                                             30   4.2  
Sklu_2388.5 YMR203W, Contig c2388 11199-12368 reverse complement       30   4.5  
KLLA0F16775g complement(1544839..1546026) highly similar to sp|P...    30   4.9  
Sklu_2393.6 YEL046C, Contig c2393 8682-9842 reverse complement         30   4.9  
YEL046C (GLY1) [1382] chr5 complement(67629..68792) Threonine al...    29   7.7  
KLLA0D10824g complement(922978..924498) similar to sp|P40016 Sac...    30   8.2  
KLLA0B00891g complement(68242..71352) similar to sp|P27692 Sacch...    30   8.6  
Scas_709.20                                                            29   8.8  

>Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement
          Length = 542

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/542 (96%), Positives = 524/542 (96%)

Query: 1   MEISDRLIISKPLYINDSSSNCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTLG 60
           MEISDRLIISKPLYINDSSSNCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTLG
Sbjct: 1   MEISDRLIISKPLYINDSSSNCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTLG 60

Query: 61  LQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCISR 120
           LQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCISR
Sbjct: 61  LQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCISR 120

Query: 121 FKKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTPE 180
           FKKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTPE
Sbjct: 121 FKKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTPE 180

Query: 181 KYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSKIQ 240
           KYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSKIQ
Sbjct: 181 KYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSKIQ 240

Query: 241 RVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSKIN 300
           RVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSKIN
Sbjct: 241 RVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSKIN 300

Query: 301 RDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSXXXXXXX 360
           RDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLS       
Sbjct: 301 RDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSNENNKKE 360

Query: 361 XXXXXXXXXXXLAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLTDL 420
                      LAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLTDL
Sbjct: 361 DDDEYYEEVNELAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLTDL 420

Query: 421 GIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLWQI 480
           GIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLWQI
Sbjct: 421 GIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLWQI 480

Query: 481 LQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAKSLI 540
           LQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAKSLI
Sbjct: 481 LQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAKSLI 540

Query: 541 II 542
           II
Sbjct: 541 II 542

>Kwal_47.17453
          Length = 544

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/549 (67%), Positives = 426/549 (77%), Gaps = 12/549 (2%)

Query: 1   MEISDRLIISKPLYINDSSSNCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTLG 60
           ME+SDRLIISKPLY  + +  CGYC   K+N YDYF T+SWY+ H+   K L+ NNCTLG
Sbjct: 1   MELSDRLIISKPLYFTEPNDKCGYCSGKKSNLYDYFATESWYKYHEDDAKTLQFNNCTLG 60

Query: 61  LQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCISR 120
           LQVEL PV++YD  CNLGFRRSGNFLYKADMLRNCCRLYTIRTTP++C++SKE KSC++R
Sbjct: 61  LQVELIPVDVYDKLCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPEKCQMSKELKSCVTR 120

Query: 121 FKKRIAPSSESSLSPG---GTPLATGGKGKK----QQPYDFVNEIISAELSSKNFYTRFE 173
           F+KRI+     + S G   GT   T  KG+     Q  YD+VNEI+ AE +S++F+ RFE
Sbjct: 121 FRKRISSQQSQTPSKGQNAGTIAQTARKGQAARNGQARYDYVNEIVQAEKNSESFHARFE 180

Query: 174 PAIYTPEKYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNL 233
           PA Y+ EKYQLFV+YQE VH D NNSVK+FK+FLCESPFPEDVV GT EEW +LNNW+++
Sbjct: 181 PATYSNEKYQLFVRYQENVHGDFNNSVKAFKRFLCESPFPEDVVAGTQEEWDQLNNWRDM 240

Query: 234 PPHSKIQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALREL 293
                ++RVGP HECYY+E KLIALAVTDFLPSGISSVYFIWDP++ +WSLGKLSALREL
Sbjct: 241 KEGEVLKRVGPAHECYYFEGKLIALAVTDFLPSGISSVYFIWDPDFPKWSLGKLSALREL 300

Query: 294 SLLSKINRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLS 353
           S+LSKINR YYYLGYYI+DCPKMKYKRKYGGDILDVCNN+YVPLD +  F+EHGKFF+L 
Sbjct: 301 SVLSKINRQYYYLGYYIDDCPKMKYKRKYGGDILDVCNNEYVPLDLVAPFIEHGKFFLLG 360

Query: 354 XXXXXXXXXXXXXXXXXXLAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDA 413
                                  ELPLDD  +   N    N+V+RIYGE GGA  SAN+A
Sbjct: 361 ANKENDDDDDDPTEHD-----CEELPLDDVPRLHLNASNTNVVDRIYGENGGAELSANEA 415

Query: 414 VDKLTDLGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPG 473
            +KL ++GIEYTP IF D YK K    +     E HYEEDDGD+ GYTN+IYHLPNVVPG
Sbjct: 416 AEKLAEMGIEYTPTIFPDPYKPKEFASLTSSEPEVHYEEDDGDVPGYTNQIYHLPNVVPG 475

Query: 474 LLPLWQILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLK 533
           LLPLWQIL I+ESGEINRLNNKLMLYNTR+GQI LV DFQ ESKR KRVICNVIRMIGLK
Sbjct: 476 LLPLWQILHIIESGEINRLNNKLMLYNTRSGQIHLVNDFQAESKRIKRVICNVIRMIGLK 535

Query: 534 NTAKSLIII 542
           NTAKSLIII
Sbjct: 536 NTAKSLIII 544

>AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH]
           complement(1054381..1055883) [1503 bp, 500 aa]
          Length = 500

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/544 (53%), Positives = 373/544 (68%), Gaps = 46/544 (8%)

Query: 1   MEISDRLIISKPLYINDSSS-NCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTL 59
           ME++DRLIISKPLYI++++   CGYCK  K++  +Y   +SW++ + +      +   T+
Sbjct: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNY-ACESWHERYAAG-GGAALRTATI 58

Query: 60  GLQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCIS 119
           GLQ EL PV++YD+ CN+GFRRSG+F+YK D LRNCCR+YTIRT+  Q   SKE +SC+ 
Sbjct: 59  GLQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVK 118

Query: 120 RFKKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTP 179
           RF + I   +                         V  +++AE +S  F TRFEPA +T 
Sbjct: 119 RFLRHIGAGAGGHG---------------------VEALVAAEQASTRFCTRFEPARFTQ 157

Query: 180 EKYQLFVKYQEKVHNDHNN-SVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSK 238
           EKY+LFV+YQ  VH+D        F KFLCESPFPEDVV+GT EEW ELN W++  P  +
Sbjct: 158 EKYELFVRYQRAVHHDTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQR 217

Query: 239 IQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSK 298
            +RVGPVHECYY++ KLIAL V+DFLPSG+SSVYFIWDP+Y++WSLGKLSALRE++++ +
Sbjct: 218 FRRVGPVHECYYFDGKLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVER 277

Query: 299 INRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSXXXXX 358
           I R YYYLGYYIEDCPKMKYK KYGG++LDVCNNQY+PL  LE F+EHG+FFVL      
Sbjct: 278 IGRSYYYLGYYIEDCPKMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPD 337

Query: 359 XXXXXXXXXXXXXLAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLT 418
                          PLSELPLDD  +  P  PL+++VERIYG  GGA  +AN AV+ L 
Sbjct: 338 ADCSDDEAGDD----PLSELPLDDRARLDPAAPLRDVVERIYGASGGAFAAANQAVEGLV 393

Query: 419 DLGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLW 478
           DLG+EYTPQ+   L+     P   P            D+     ++Y LPNVVPGL+PLW
Sbjct: 394 DLGVEYTPQLDVGLF-----PSETP------------DLRDCLADVYQLPNVVPGLVPLW 436

Query: 479 QILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAKS 538
           QIL+I++SGEI  +N KLM+Y+TR G++RLV DF  E+K TKRVICNVIR+IGLKNTA S
Sbjct: 437 QILKILKSGEIRHINTKLMIYDTRLGRVRLVRDFHQEAKTTKRVICNVIRLIGLKNTANS 496

Query: 539 LIII 542
           LI+I
Sbjct: 497 LIVI 500

>YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase
           (arg-tRNA protein transferase), transfers arg to N-Asp
           or N-Glu of proteins prior to degradation by the N-end
           rule pathway [1512 bp, 503 aa]
          Length = 503

 Score =  487 bits (1253), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 249/541 (46%), Positives = 335/541 (61%), Gaps = 45/541 (8%)

Query: 3   ISDRLIISKPLYINDSSSNCGYCKHSKNNDYD-YFPTDSWYQLHKSHIKDLEINNCTLGL 61
           +SDR +I  P   N+ ++ CGYC  +K  + D  F  DSW   + + +  ++I NCT+G 
Sbjct: 1   MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS 60

Query: 62  QVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCISRF 121
            VE   V  YD  CN+GFRRSG FLYK D LRNCCRLYTIRT P++  ++KE K CISRF
Sbjct: 61  FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF 120

Query: 122 KKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTPEK 181
             RI        S    P A           DFV +I++AE++SK FYTRFEPA+Y+ EK
Sbjct: 121 ATRIT-------SEDYCPAAVASS-------DFVGKIVNAEMNSKTFYTRFEPALYSEEK 166

Query: 182 YQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSKIQR 241
           Y LFVKYQEKVH D+NNS KSFK+FLC++PF  + V+GT E W +LNNW+ + P  K++ 
Sbjct: 167 YHLFVKYQEKVHQDYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKH 226

Query: 242 VGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSKINR 301
           +GPVHECYYYE KLIA+ V+D LPSGISSVYFIWDP+Y++WSLGKLSALR+L+++ + N 
Sbjct: 227 MGPVHECYYYEGKLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNL 286

Query: 302 DYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSXXXXXXXX 361
            YYYLGYYIEDCPKM YK  YG ++LDVC+++Y+PL  +++ +  GK FV+         
Sbjct: 287 QYYYLGYYIEDCPKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTK 346

Query: 362 XXXXXXXXXXLAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLTDL- 420
                            P D+  K+      KNI E IYG  G A +SAN++  +L +L 
Sbjct: 347 ELYLVDSETGRG--EGFPTDNVVKY------KNIAEEIYGVGGCAFKSANESALELKELY 398

Query: 421 GIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLWQI 480
           GI Y  +  + +Y LK   G  P                       +PNVVPGLLPLW++
Sbjct: 399 GIPYEEEDLDTIYHLKEHNGHAPNG---------------------IPNVVPGLLPLWEL 437

Query: 481 LQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAKSLI 540
           L I++SG+I  L  +L L+   T  IR +++F  E    K+ IC+VIR+ G +   K++I
Sbjct: 438 LDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRICDVIRLFGFETCMKAVI 497

Query: 541 I 541
           +
Sbjct: 498 L 498

>Scas_638.9
          Length = 510

 Score =  474 bits (1219), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 254/551 (46%), Positives = 338/551 (61%), Gaps = 50/551 (9%)

Query: 1   MEISDRLIISKPLYINDSSSNCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINN---C 57
           M + DRLII+KP+Y  +S+S CGYC   K N  +YFP DSWY+ +K    DL+  N    
Sbjct: 1   MSLQDRLIITKPMYFKESASECGYCHGKKKNPRNYFPLDSWYEKYKDGF-DLDAPNRGTY 59

Query: 58  TLGLQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSC 117
            LG Q EL  VE+YD  CNLGFRRSG F+Y+ DMLRNCCRL+TIRT+P Q +I+KE +  
Sbjct: 60  NLGFQAELMTVEMYDTLCNLGFRRSGKFIYRHDMLRNCCRLFTIRTSPDQFQITKELRKT 119

Query: 118 ISRFKKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIY 177
           + +FKK I               A      K Q +DF+ EIISAE +S +F T FEPAI+
Sbjct: 120 VKKFKKHITAVD-----------AIEEPSSKNQKFDFIKEIISAEKASPDFKTVFEPAIF 168

Query: 178 TPEKYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKN--LPP 235
           T EKY LF KYQE VHND  ++ KSFK+FLC+ PF   V+ GT EEW  LN W++     
Sbjct: 169 TQEKYDLFAKYQENVHNDFKHNPKSFKRFLCDGPFMPQVITGTAEEWKALNEWQDQDFNN 228

Query: 236 HSKIQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSL 295
            +KI R+GP HECYYY++KLIA+AV DFLPSG+SSVYFIWDP++ +WSLGK+SA+RE+++
Sbjct: 229 STKITRLGPTHECYYYKDKLIAMAVLDFLPSGVSSVYFIWDPDFKKWSLGKISAMREMAI 288

Query: 296 LSKINRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDEL--ENFLEHGKFFVLS 353
           LSK+ R YYY+GYY+EDCPKM YK  YGG++LDVCN +YV LD L  +  + +GK FV+ 
Sbjct: 289 LSKLQRKYYYMGYYVEDCPKMNYKGAYGGELLDVCNGEYVSLDFLHRKQMISNGKLFVMD 348

Query: 354 XXXXXXXXXXXXXXXXXXLAPLSE--LPLDDTKKFSPNKPLKNIVERIYGERGGAVQSAN 411
                             L+  SE   P  +TK  S     KNI E IYG  G A     
Sbjct: 349 ---ESETGTSSDSPLMRKLSAESENNFPSVNTKVKS-----KNIAENIYGVNGEAYDDIE 400

Query: 412 DAVDKLTDLGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVV 471
             +  L +  + Y  +  + +Y                     G I    + +  LPNV 
Sbjct: 401 QYISGLLNFDMPYLSEDEDAIY---------------------GVIKAGGDGMSALPNVS 439

Query: 472 PGLLPLWQILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIG 531
           PGLLPL ++  IVE  EI  LN KL++ +T   +IR +++   ES+ +KRVIC+++R +G
Sbjct: 440 PGLLPLQELYFIVELEEITDLNGKLLILDTDDNEIRPMLNIYGESESSKRVICDLVRTLG 499

Query: 532 LKNTAKSLIII 542
           L+ TA +++II
Sbjct: 500 LEITANTIVII 510

>KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase
           singleton, start by similarity
          Length = 503

 Score =  472 bits (1214), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 246/545 (45%), Positives = 340/545 (62%), Gaps = 45/545 (8%)

Query: 1   MEISDRLIISKPLYINDSSS-NCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTL 59
           M+ +D+LIIS+PLYI+D++   CGYC   K++ +  F +  W   +K     +E+ + T+
Sbjct: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHK-FASPGWSDFYKGDEDKVELQSSTV 59

Query: 60  GLQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCIS 119
           G   EL   E YD  CNLGFRRSG+F+YK DMLRNCCRLYTIRT  K   +SKE K+ + 
Sbjct: 60  GFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLK 119

Query: 120 RFKKRIAPSSESSLSPGGTPLATGGKGKKQQPY-DFVNEIISAELSSKNFYTRFEPAIYT 178
           RFKK+I                T  + K Q  Y  +++E+   E  S +F   FEPA +T
Sbjct: 120 RFKKKI----------------TSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFT 163

Query: 179 PEKYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSK 238
            EKY L+V+YQ  +H+D +N+   F+ FLC++PF +  + GT +EW +LNNW NL P  +
Sbjct: 164 DEKYDLYVRYQHYIHSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGER 223

Query: 239 IQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSK 298
           + + GP HECYY+  KLIAL+V DFLPSG+SSVYFIWDP+Y  WSLGK+SALREL+L+SK
Sbjct: 224 VTKNGPAHECYYHNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSK 283

Query: 299 INRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSXXXXX 358
           I R YYYLGYYI+DCPKM YK K+GG+ILDVCN +YVPL ++   ++H + FV       
Sbjct: 284 IGRPYYYLGYYIDDCPKMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFV------- 336

Query: 359 XXXXXXXXXXXXXLAPLSELPLDD-TKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKL 417
                         +P SE+ +   + K + ++P  N V+ IYG  G A Q+A  +V KL
Sbjct: 337 -------GLNSTVASPDSEILITSASDKINFDEPFINAVDDIYGPNGNASQNAITSVAKL 389

Query: 418 TDLGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPL 477
              GI Y+P +   +YK       E P D         D      ++Y +PNVVPGL+PL
Sbjct: 390 RKYGINYSPDLQRSIYK-------EIPNDGNSTSSASSD----KKDVYRIPNVVPGLVPL 438

Query: 478 WQILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKNTAK 537
            +I+ + ESG++N LNN ++L++T+   +R+V DF  E    K VI +VIR+IGL NT K
Sbjct: 439 MEIVSLFESGKMNELNNNVVLFDTKINALRIVRDFISEKPEIKTVITDVIRLIGLDNTKK 498

Query: 538 SLIII 542
           ++III
Sbjct: 499 AIIII 503

>CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase, start
           by similarity
          Length = 509

 Score =  427 bits (1098), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 230/556 (41%), Positives = 330/556 (59%), Gaps = 63/556 (11%)

Query: 3   ISDRLIISKPLYINDSSSNCGYCKHSKNNDYDYFPTDSWYQLHK----SHIKDLEINNCT 58
           + ++LII +PLY +D S +CGYC   K    D++  +SWY+  K    S +++L + +CT
Sbjct: 1   MENKLIIHRPLYFSDKS-DCGYCHGKKAKGSDFYSLESWYERIKENADSEVEELPVRSCT 59

Query: 59  LGLQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCI 118
           +G Q E   V +YD  CN+GFRRSG F+YK D LR+CCRLYTIRT P   K++K+ + CI
Sbjct: 60  VGFQCENMTVAMYDQMCNMGFRRSGLFVYKMDALRSCCRLYTIRTRPDWFKLTKDMRKCI 119

Query: 119 SRFKKRIAPSSESSLSPGGTPLATGGKGKKQQPY--DFVNEIISAELSSKNFYTRFEPAI 176
           +RF+K +           G P+A      K Q Y  D V+  I  +  S NFYTRF PA+
Sbjct: 120 NRFRKHVL----------GEPVANA----KTQGYVEDIVD--IEGQSDSINFYTRFGPAV 163

Query: 177 YTPEKYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPH 236
           YT EKY+LF  YQE+VH D ++S K FK+FLC++PF + V++GT EEW +LNNWK++ P 
Sbjct: 164 YTDEKYELFSIYQERVHQDFDHSKKGFKRFLCDAPFTQGVIMGTEEEWEQLNNWKSMKPG 223

Query: 237 SKIQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLL 296
            ++ R GPVHE YYY+ KLIALAVTDFLPSGISSVYFIW P+Y +WSLGKLSALRELSL+
Sbjct: 224 ERLLRTGPVHESYYYKGKLIALAVTDFLPSGISSVYFIWHPDYHKWSLGKLSALRELSLV 283

Query: 297 SKINRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSXXX 356
           SK N  YYYLGYYI+DC KM YK  YGG++LD C  +Y  L ++++ +  GK F++    
Sbjct: 284 SKTNLKYYYLGYYIDDCKKMNYKANYGGELLDSCTERYFKLSQVKDMIRGGKLFMVGTQG 343

Query: 357 XXXXXXXXXXXXXXXLAPLSELPLD---DTKKFSPNKPLKNIVERIYGERGGAV--QSAN 411
                             LS+   D    T  F       N+ E++YG        Q   
Sbjct: 344 HDISRE----------VALSDAIRDCIYQTDAFDIASD-DNVAEKVYGTSSNIYRPQYLK 392

Query: 412 DAVDKLTDLGIEYTPQIFND----LYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHL 467
           + +  L   G+EY   I+ND     Y  +     E P                    + +
Sbjct: 393 EVISFLKTSGLEYDFPIYNDGVFNQYAKRIAKDGEDPD-------------------FTI 433

Query: 468 PNVVPGLLPLWQILQIVESGEINR-LNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNV 526
           P++ PGL+PLW++  ++ SG++ + L  + ++++T  G IR +  ++ E   TK  IC+V
Sbjct: 434 PSICPGLIPLWELKDLLMSGKLQKELTGRTLVFDTSFGFIRKLEPWEDEDSTTKTAICDV 493

Query: 527 IRMIGLKNTAKSLIII 542
           +R++GL+  + S++++
Sbjct: 494 VRLLGLEMASNSIVVV 509

>CAGL0M07766g 781830..782546 no similarity, hypothetical start
          Length = 238

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 19/130 (14%)

Query: 46  KSHIKDLEINNCTLGLQVELFPVEIYDDWCNLG--FRRSGNFLYKAD-------MLRNCC 96
           +SH+ + +I +  L   +E+  +E   DW N    FR +  +L   D       MLR C 
Sbjct: 111 QSHLSNCKITSFDL---LEILKIEY--DWVNAEKYFRENFEWLQNMDNFNTTQKMLR-CQ 164

Query: 97  RLYTIRTTP--KQCKISKEFKSCISRFKKRIAPSSESSLSPGGTP--LATGGKGKKQQPY 152
           RL  I T P   + +++KE K+ I  FK++IA +   +LSP  T   L     GK+   Y
Sbjct: 165 RLVHIITEPLVDKIQMTKETKNEIDDFKQQIAANLMIALSPNHTQEILRHYRIGKRLDLY 224

Query: 153 DFVNEIISAE 162
           D  N I   E
Sbjct: 225 DITNTIAYLE 234

>Sklu_2209.2 YNL216W, Contig c2209 1380-3290 reverse complement
          Length = 636

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 420 LGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLWQ 479
           L +E   Q + D+++      M+P T +    EDDG  +     +   PN+VPG  PL+Q
Sbjct: 274 LALELKKQFYRDIFQ------MDPDTRKSLIAEDDGPNTVARRNMTMDPNLVPGQEPLFQ 327

Query: 480 ILQI 483
             ++
Sbjct: 328 NFKV 331

>CAGL0I01342g complement(110120..111280) highly similar to sp|P37303
           Saccharomyces cerevisiae YEL046c GLY1 L-threonine
           aldolase, start by similarity
          Length = 386

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 447 EEHYEEDDGDISGYTNEIYHLPNVVPGLL-PLWQILQI 483
           + HY  DDGDI G   ++  L N + G++ PL ++++I
Sbjct: 130 KSHYVPDDGDIHGAPTKVISLENTLHGIIYPLEELVRI 167

>AFR366W [3558] [Homologous to ScYEL046C (GLY1) - SH]
           complement(1099055..1100203) [1149 bp, 382 aa]
          Length = 382

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 447 EEHYEEDDGDISGYTNEIYHLPNVVPGLL-PLWQILQI 483
           ++HY  DDGDI G   ++  L N + G++ PL ++++I
Sbjct: 132 KKHYIPDDGDIHGAPTKVISLENTLHGIIHPLEELVRI 169

>Scas_588.7
          Length = 726

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 434 KLKPLPGMEPPTDEEHYEED-----DGDISGYTNEIYHLPNVVPGLLPLWQILQIVESGE 488
           KL      +PP  E+ Y  +     D D  G ++E + +  V   L+P W I+++   G+
Sbjct: 438 KLLRASSAKPPVSEQEYNSEVSCTGDWDYHGDSDEFWKIDLVEGSLIPCWNIMELDNVGQ 497

Query: 489 INRL 492
           +  L
Sbjct: 498 MCTL 501

>Sklu_2388.5 YMR203W, Contig c2388 11199-12368 reverse complement
          Length = 389

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 425 TPQIFNDLYKLKPLPGMEPPTDEEHYEE--DDGDISGYTNEIYHLPNVVPGLLPLWQILQ 482
           TP    D  K+  LPG+ P T E+  E       I  Y N++Y+       +    Q L 
Sbjct: 5   TPMPLGDFSKIPTLPGISPMTPEQKQESFWSSNPIFSYLNDVYN------NIHAHRQSLS 58

Query: 483 IVESGEINRLNNKL 496
           +V  G I  LN ++
Sbjct: 59  LVNPGTIENLNKEV 72

>KLLA0F16775g complement(1544839..1546026) highly similar to
           sp|P37303 Saccharomyces cerevisiae YEL046c GLY1
           L-threonine aldolase, low-specific singleton, start by
           similarity
          Length = 395

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 447 EEHYEEDDGDISGYTNEIYHLPNVVPGLL-PLWQILQI 483
           + HY  DDGDI G    +  L N + G++ PL ++++I
Sbjct: 139 KAHYIPDDGDIHGAPTRVLSLENTLHGIVYPLEELIRI 176

>Sklu_2393.6 YEL046C, Contig c2393 8682-9842 reverse complement
          Length = 386

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 447 EEHYEEDDGDISGYTNEIYHLPNVVPGLL-PLWQILQI 483
           ++HY  DDGDI G    +  L N + G++ PL ++++I
Sbjct: 130 KKHYIPDDGDIHGAPTRVLSLENTLHGIVYPLEELIRI 167

>YEL046C (GLY1) [1382] chr5 complement(67629..68792) Threonine
           aldolase, required for glycine biosynthesis [1164 bp,
           387 aa]
          Length = 387

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 447 EEHYEEDDGDISGYTNEIYHLPNVVPGLL-PLWQILQI 483
           + HY  DDGDI G    +  L N + G++ PL ++++I
Sbjct: 131 KSHYVPDDGDIHGAPTRLISLENTLHGIVYPLEELVRI 168

>KLLA0D10824g complement(922978..924498) similar to sp|P40016
           Saccharomyces cerevisiae YER021w SUN2 26S proteasome
           regulatory subunit singleton, start by similarity
          Length = 506

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 455 GDISGYTNEIYHLPNVVPGLLPLWQILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQL 514
           GDI   T   +H   +   LLP + I + V+ G++N     L  Y     Q     ++QL
Sbjct: 311 GDIPELT--FFHQKGLEKSLLPYYHITKAVKLGDLNLFTQSLSKYKKELVQDS---NYQL 365

Query: 515 ESKRTKRVICNVIRMIGL 532
             +    VI   IRMI L
Sbjct: 366 CVRLRSNVIKTGIRMISL 383

>KLLA0B00891g complement(68242..71352) similar to sp|P27692
           Saccharomyces cerevisiae YML010w SPT5 transcription
           elongation protein singleton, start by similarity
          Length = 1036

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 281 RWSLGKLSALRELSLLSKINRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQ--YVPLD 338
           +++L K    ++L +LS   RD Y    YIE  PK     K+   + DV +NQ   +P+ 
Sbjct: 266 KFNLDKSMGSKKLKILSIFQRDNYTGRIYIE-APKQSVIEKFVNGVPDVYSNQKLLIPVQ 324

Query: 339 EL 340
           EL
Sbjct: 325 EL 326

>Scas_709.20
          Length = 387

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 447 EEHYEEDDGDISGYTNEIYHLPNVVPGLL-PLWQILQI 483
           + HY  DDGDI G    +  L N + G++ PL ++++I
Sbjct: 131 KAHYIPDDGDIHGAPTRLISLENTLHGIIYPLEELVRI 168

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,997,866
Number of extensions: 961942
Number of successful extensions: 2651
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2668
Number of HSP's successfully gapped: 29
Length of query: 542
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 435
Effective length of database: 12,891,983
Effective search space: 5608012605
Effective search space used: 5608012605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)