Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1752.285885837310.0
Kwal_27.1094593551417630.0
KLLA0F18612g81450615890.0
YBR059C (AKL1)110857215660.0
Scas_661.27109538015550.0
AGR027C96154615120.0
CAGL0H10208g102738814330.0
CAGL0K11990g99138513191e-167
Kwal_27.115427913098365e-99
Scas_601.66613158092e-96
Sklu_2226.77953158182e-96
ADL217W7503127961e-93
Scas_671.167233157932e-93
KLLA0E08371g7773157935e-93
YIL095W (PRK1)8103157842e-91
CAGL0G02607g6883167674e-90
YNL020C (ARK1)6383057601e-89
CAGL0J03432g6223117381e-86
KLLA0C06138g7082822455e-21
Kwal_56.242743463382358e-21
Sklu_1962.23643562351e-20
Scas_700.288961972304e-19
Scas_644.157262832251e-18
YPL150W9012912233e-18
Sklu_2419.96952842204e-18
Sklu_2361.38842942214e-18
ACL006W7082332196e-18
CAGL0J11638g7463002171e-17
YHR102W (KIC1)10802452171e-17
Kwal_56.224766972842161e-17
Kwal_55.215458652412162e-17
YMR001C (CDC5)7052332143e-17
Kwal_26.87518482972143e-17
CAGL0M02299g8932002143e-17
CAGL0L11550g10722322135e-17
KLLA0E21780g10162292126e-17
KLLA0F11319g8432332117e-17
Scas_580.610152322082e-16
YPL236C3643392003e-16
AEL230W6083142018e-16
ACR133C8511932029e-16
ACL104C9472292011e-15
AFL101C3672361932e-15
KLLA0A03806g6023061963e-15
YDR477W (SNF1)6333131937e-15
Kwal_47.182335982891902e-14
Kwal_33.131125051901882e-14
Scas_660.286232451892e-14
Sklu_2419.105662191883e-14
CAGL0M08910g6123011865e-14
Scas_707.369152571804e-13
Sklu_2323.34001961764e-13
Kwal_26.778812672921786e-13
YNL298W (CLA4)8422831777e-13
AFR335C10331921761e-12
AFR696C11422351761e-12
ABL034W14251991761e-12
AEL205W7932401751e-12
ACR117W5242311731e-12
Scas_685.245151901731e-12
KLLA0A07403g8792391742e-12
YDR523C (SPS1)4901391722e-12
KLLA0C12485g9252581742e-12
Kwal_23.632515422791742e-12
Kwal_56.237178581901732e-12
KLLA0C00979g4833081713e-12
Scas_598.67902401723e-12
AGR058W10712021723e-12
Scas_458.13673501683e-12
KLLA0B02332g3612371674e-12
Kwal_56.226939841901714e-12
Kwal_56.240913811961675e-12
KLLA0C01650g11122351706e-12
YNR047W8933281698e-12
KLLA0E17127g8521901688e-12
CAGL0E05720g3582371658e-12
CAGL0M11396g11922021681e-11
Scas_564.712102031681e-11
YOL100W (PKH2)10811871671e-11
AER264C14833021671e-11
CAGL0I07513g10762791662e-11
CAGL0K02673g9151761662e-11
Scas_633.297893181652e-11
ABR014W9711771662e-11
YAR019C (CDC15)9742841662e-11
YCR073C (SSK22)13312511652e-11
AFR377C7261951633e-11
CAGL0G04609g9651981633e-11
KLLA0C08525g15512511634e-11
Scas_502.211162141624e-11
YLR096W (KIN2)11471911624e-11
CAGL0B01925g9442021625e-11
KLLA0F19536g11041901616e-11
Scas_629.169182921607e-11
CAGL0M03729g8612021607e-11
YKL101W (HSL1)15183081617e-11
KLLA0C18568g7742991608e-11
KLLA0B13112g7301811598e-11
CAGL0G09020g3612041569e-11
Kwal_23.52908192021591e-10
YDR122W (KIN1)10642031591e-10
YDL159W (STE7)5152021581e-10
Kwal_23.566816892291601e-10
Scas_627.73492041551e-10
KLLA0C03828g7933111581e-10
YDR507C (GIN4)11422931581e-10
CAGL0J03872g6611461571e-10
KLLA0F13552g12671991581e-10
ACR196C5301971562e-10
YOR233W (KIN4)8001431572e-10
Kwal_26.78619551761572e-10
YGL179C (TOS3)5602011552e-10
ACR281C12591671562e-10
CAGL0C03509g8952961562e-10
YPL140C (MKK2)5061891552e-10
Sklu_2437.1610712561563e-10
CAGL0K05709g11032351563e-10
Scas_693.1710492031553e-10
Sklu_2086.42431281484e-10
KLLA0F01276g5191801534e-10
KLLA0D07304g4652061524e-10
KLLA0B13607g9891761545e-10
CAGL0H01639g5211421525e-10
CAGL0M10153g8671761535e-10
YDR490C (PKH1)7661951536e-10
CAGL0F03311g10451901536e-10
Sklu_1995.27291811527e-10
Scas_675.25271891517e-10
Scas_616.1014611461528e-10
Scas_477.57031811519e-10
YCR091W (KIN82)7201521501e-09
Sklu_2366.54661831491e-09
Scas_493.211171831511e-09
Sklu_1843.34862351491e-09
Kwal_26.87098292431501e-09
Sklu_1603.24881701491e-09
Scas_548.613821771501e-09
Scas_640.165052371481e-09
Kwal_56.245844352001481e-09
Scas_713.216413241491e-09
Kwal_26.735514462811501e-09
KLLA0F14190g13382661501e-09
Kwal_27.100047351521491e-09
YJL095W (BCK1)14782951502e-09
Kwal_55.203267502011492e-09
CAGL0D02244g4872391472e-09
YJL187C (SWE1)8192261492e-09
YCL024W (KCC4)10371911492e-09
Kwal_47.1726311273211492e-09
Kwal_23.64588682911482e-09
ADR300C8901911472e-09
CAGL0K08514g14892551482e-09
Kwal_26.715412131261473e-09
Scas_700.348642371473e-09
AEL284C4791881463e-09
YPL209C (IPL1)3671981443e-09
CAGL0H06259g13361701473e-09
YER129W (PAK1)11422031464e-09
Scas_544.64892331454e-09
CAGL0C05005g10762441464e-09
CAGL0L03520g14472601464e-09
YAL017W (PSK1)13561221464e-09
YKL048C (ELM1)6401681454e-09
Scas_720.9416832611464e-09
Scas_651.183712041435e-09
CAGL0I03498g4512371435e-09
CAGL0F00913g12061231455e-09
YBR274W (CHK1)5271821445e-09
KLLA0C04191g7971921445e-09
YMR139W (RIM11)3701751426e-09
YPL141C8652371446e-09
AAR009W4532571426e-09
KLLA0B07205g4552011426e-09
YHL007C (STE20)9391761446e-09
KLLA0F07623g12291771446e-09
Scas_640.14*7281461437e-09
AFR724C4401921427e-09
YOL045W (PSK2)11011651447e-09
Scas_643.2010821711447e-09
YDL028C (MPS1)7643171437e-09
ABL011C7012181438e-09
Scas_700.354391931418e-09
Scas_602.1111863311438e-09
AEL115C3862441409e-09
KLLA0C16577g5041861411e-08
CAGL0M02519g7562051421e-08
Kwal_26.87034442691401e-08
CAGL0J03828g4671911401e-08
YOL113W (SKM1)6552681411e-08
AFR092W14232651421e-08
YPR054W (SMK1)3882331391e-08
Scas_720.1038042041411e-08
Scas_668.228931761411e-08
Scas_584.1110741911411e-08
Kwal_27.97638682011411e-08
Kwal_0.964272961392e-08
AEL185C5152411392e-08
KLLA0D03190g3722371382e-08
ADR317C8193181402e-08
CAGL0K01617g7742701392e-08
YPL203W (TPK2)3802371372e-08
Sklu_2429.54322501382e-08
Scas_653.256661521392e-08
CAGL0M08404g4621901373e-08
CAGL0L06820g3661821363e-08
ADR058C2951661343e-08
Kwal_33.141678383121383e-08
KLLA0F01507g4722111364e-08
Scas_711.2515152601375e-08
Kwal_55.201898121871375e-08
ADL315C4341701355e-08
KLLA0B07579g7222341365e-08
ADR167W8732551365e-08
KLLA0E07414g3651451345e-08
Scas_619.5*5101661355e-08
YOR231W (MKK1)5082381356e-08
YLR362W (STE11)7171811366e-08
CAGL0H07535g2981521326e-08
CAGL0M09361g11441431366e-08
ACR191C11491441357e-08
Kwal_47.178683651991337e-08
YHR082C (KSP1)10291561358e-08
Kwal_14.14163651701329e-08
CAGL0B02739g6761821349e-08
YJL164C (TPK1)3971901329e-08
ACL053C11812201341e-07
KLLA0E15378g7242501331e-07
Sklu_2073.311822141341e-07
KLLA0D09328g10462321341e-07
YNR031C (SSK2)15793281341e-07
ADR313W5782061331e-07
KLLA0A02717g4322011311e-07
AAL083W16982031331e-07
Scas_649.306482591321e-07
KLLA0D11990g3042001291e-07
CAGL0L05632g6772821321e-07
YOR267C (HRK1)7591511321e-07
KLLA0C04213g3942861311e-07
YKL166C (TPK3)3981981302e-07
Kwal_27.1058111541431322e-07
Sklu_2104.12991931292e-07
Kwal_33.141925771481312e-07
Sklu_2211.511751431322e-07
YBL105C (PKC1)11511431322e-07
KLLA0B11946g4392291302e-07
CAGL0J04972g3391741292e-07
ACR119W9311201312e-07
YNL307C (MCK1)3751441292e-07
Scas_715.3411501431312e-07
Kwal_33.138463751881292e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1752.2
         (858 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement        1441   0.0  
Kwal_27.10945                                                         683   0.0  
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   616   0.0  
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...   607   0.0  
Scas_661.27                                                           603   0.0  
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   587   0.0  
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   556   0.0  
CAGL0K11990g complement(1155395..1158370) some similarities with...   512   e-167
Kwal_27.11542                                                         326   5e-99
Scas_601.6                                                            316   2e-96
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          319   2e-96
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   311   1e-93
Scas_671.16                                                           310   2e-93
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   310   5e-93
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   306   2e-91
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   300   4e-90
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   297   1e-89
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   288   1e-86
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    99   5e-21
Kwal_56.24274                                                          95   8e-21
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          95   1e-20
Scas_700.28                                                            93   4e-19
Scas_644.15                                                            91   1e-18
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    91   3e-18
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          89   4e-18
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            90   4e-18
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    89   6e-18
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    88   1e-17
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    88   1e-17
Kwal_56.22476                                                          88   1e-17
Kwal_55.21545                                                          88   2e-17
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    87   3e-17
Kwal_26.8751                                                           87   3e-17
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    87   3e-17
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    87   5e-17
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    86   6e-17
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    86   7e-17
Scas_580.6                                                             85   2e-16
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    82   3e-16
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    82   8e-16
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    82   9e-16
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    82   1e-15
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    79   2e-15
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    80   3e-15
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    79   7e-15
Kwal_47.18233                                                          78   2e-14
Kwal_33.13112                                                          77   2e-14
Scas_660.28                                                            77   2e-14
Sklu_2419.10 , Contig c2419 14439-16135                                77   3e-14
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    76   5e-14
Scas_707.36                                                            74   4e-13
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            72   4e-13
Kwal_26.7788                                                           73   6e-13
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    73   7e-13
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    72   1e-12
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    72   1e-12
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    72   1e-12
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    72   1e-12
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    71   1e-12
Scas_685.24                                                            71   1e-12
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    72   2e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    71   2e-12
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    72   2e-12
Kwal_23.6325                                                           72   2e-12
Kwal_56.23717                                                          71   2e-12
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    70   3e-12
Scas_598.6                                                             71   3e-12
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    71   3e-12
Scas_458.1                                                             69   3e-12
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    69   4e-12
Kwal_56.22693                                                          70   4e-12
Kwal_56.24091                                                          69   5e-12
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    70   6e-12
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    70   8e-12
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    69   8e-12
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    68   8e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   1e-11
Scas_564.7                                                             69   1e-11
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    69   1e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    69   1e-11
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    69   2e-11
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    69   2e-11
Scas_633.29                                                            68   2e-11
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    69   2e-11
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    69   2e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    68   2e-11
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    67   3e-11
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    67   3e-11
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    67   4e-11
Scas_502.2                                                             67   4e-11
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    67   4e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    67   5e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    67   6e-11
Scas_629.16                                                            66   7e-11
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    66   7e-11
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    67   7e-11
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    66   8e-11
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    66   8e-11
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    65   9e-11
Kwal_23.5290                                                           66   1e-10
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    66   1e-10
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    65   1e-10
Kwal_23.5668                                                           66   1e-10
Scas_627.7                                                             64   1e-10
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    65   1e-10
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    65   1e-10
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    65   1e-10
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    65   1e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    65   2e-10
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    65   2e-10
Kwal_26.7861                                                           65   2e-10
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    64   2e-10
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    65   2e-10
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    65   2e-10
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    64   2e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      65   3e-10
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    65   3e-10
Scas_693.17                                                            64   3e-10
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                62   4e-10
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    64   4e-10
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    63   4e-10
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    64   5e-10
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    63   5e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    64   5e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    64   6e-10
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    64   6e-10
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            63   7e-10
Scas_675.2                                                             63   7e-10
Scas_616.10                                                            63   8e-10
Scas_477.5                                                             63   9e-10
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    62   1e-09
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       62   1e-09
Scas_493.2                                                             63   1e-09
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         62   1e-09
Kwal_26.8709                                                           62   1e-09
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         62   1e-09
Scas_548.6                                                             62   1e-09
Scas_640.16                                                            62   1e-09
Kwal_56.24584                                                          62   1e-09
Scas_713.21                                                            62   1e-09
Kwal_26.7355                                                           62   1e-09
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    62   1e-09
Kwal_27.10004                                                          62   1e-09
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    62   2e-09
Kwal_55.20326                                                          62   2e-09
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    61   2e-09
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    62   2e-09
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    62   2e-09
Kwal_47.17263                                                          62   2e-09
Kwal_23.6458                                                           62   2e-09
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    61   2e-09
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    62   2e-09
Kwal_26.7154                                                           61   3e-09
Scas_700.34                                                            61   3e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    61   3e-09
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    60   3e-09
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    61   3e-09
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    61   4e-09
Scas_544.6                                                             60   4e-09
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    61   4e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    61   4e-09
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    61   4e-09
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    60   4e-09
Scas_720.94                                                            61   4e-09
Scas_651.18                                                            60   5e-09
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    60   5e-09
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    60   5e-09
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    60   5e-09
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    60   5e-09
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    59   6e-09
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    60   6e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    59   6e-09
KLLA0B07205g complement(624606..625973) some similarities with s...    59   6e-09
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    60   6e-09
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    60   6e-09
Scas_640.14*                                                           60   7e-09
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    59   7e-09
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    60   7e-09
Scas_643.20                                                            60   7e-09
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    60   7e-09
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    60   8e-09
Scas_700.35                                                            59   8e-09
Scas_602.11                                                            60   8e-09
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    59   9e-09
KLLA0C16577g complement(1451181..1452695) some similarities with...    59   1e-08
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    59   1e-08
Kwal_26.8703                                                           59   1e-08
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    59   1e-08
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    59   1e-08
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    59   1e-08
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    58   1e-08
Scas_720.103                                                           59   1e-08
Scas_668.22                                                            59   1e-08
Scas_584.11                                                            59   1e-08
Kwal_27.9763                                                           59   1e-08
Kwal_0.96                                                              58   2e-08
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    58   2e-08
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    58   2e-08
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    59   2e-08
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    58   2e-08
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    57   2e-08
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        58   2e-08
Scas_653.25                                                            58   2e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    57   3e-08
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    57   3e-08
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    56   3e-08
Kwal_33.14167                                                          58   3e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    57   4e-08
Scas_711.25                                                            57   5e-08
Kwal_55.20189                                                          57   5e-08
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    57   5e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    57   5e-08
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    57   5e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    56   5e-08
Scas_619.5*                                                            57   5e-08
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    57   6e-08
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    57   6e-08
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    55   6e-08
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    57   6e-08
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    57   7e-08
Kwal_47.17868                                                          56   7e-08
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    57   8e-08
Kwal_14.1416                                                           55   9e-08
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    56   9e-08
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    55   9e-08
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    56   1e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    56   1e-07
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            56   1e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    56   1e-07
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    56   1e-07
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    56   1e-07
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    55   1e-07
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    56   1e-07
Scas_649.30                                                            55   1e-07
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    54   1e-07
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    55   1e-07
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    55   1e-07
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    55   1e-07
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    55   2e-07
Kwal_27.10581                                                          55   2e-07
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             54   2e-07
Kwal_33.14192                                                          55   2e-07
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          55   2e-07
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    55   2e-07
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    55   2e-07
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    54   2e-07
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    55   2e-07
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    54   2e-07
Scas_715.34                                                            55   2e-07
Kwal_33.13846                                                          54   2e-07
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    55   2e-07
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    54   2e-07
Kwal_27.11919                                                          52   2e-07
Scas_623.11                                                            54   2e-07
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    54   3e-07
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    54   3e-07
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    55   3e-07
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         55   3e-07
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    54   3e-07
Scas_634.5                                                             54   3e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   3e-07
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         54   3e-07
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    53   4e-07
Kwal_56.24059                                                          54   4e-07
Kwal_27.12559                                                          54   4e-07
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    54   4e-07
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    54   4e-07
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    53   5e-07
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    54   5e-07
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    54   5e-07
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    53   5e-07
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    53   5e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    54   6e-07
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    54   6e-07
Scas_721.46                                                            52   6e-07
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         53   6e-07
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    53   6e-07
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    53   6e-07
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    54   7e-07
Scas_689.25*                                                           53   7e-07
Kwal_47.16761                                                          54   7e-07
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    54   7e-07
Scas_683.12                                                            52   7e-07
Kwal_47.18307                                                          53   8e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    53   8e-07
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    53   8e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    52   9e-07
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    52   9e-07
Scas_683.6                                                             52   9e-07
Scas_703.5                                                             53   1e-06
Scas_635.1                                                             52   1e-06
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    53   1e-06
Kwal_26.8347                                                           53   1e-06
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    53   1e-06
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    53   1e-06
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    53   1e-06
Scas_710.28                                                            52   1e-06
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    52   1e-06
Kwal_55.22001                                                          52   1e-06
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    52   1e-06
KLLA0C03938g complement(358851..360632) some similarities with s...    52   1e-06
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    52   1e-06
Scas_690.13                                                            52   1e-06
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    52   1e-06
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    52   2e-06
Scas_660.20                                                            52   2e-06
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    52   2e-06
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    52   2e-06
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    52   2e-06
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            52   2e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    52   2e-06
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    50   2e-06
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    51   2e-06
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 51   2e-06
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    52   2e-06
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    52   2e-06
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         51   2e-06
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    52   3e-06
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    51   3e-06
Scas_713.38                                                            51   3e-06
KLLA0B06501g complement(576636..579089) some similarities with s...    51   3e-06
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            51   3e-06
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    50   3e-06
Scas_667.18                                                            51   3e-06
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    51   3e-06
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    50   4e-06
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    50   4e-06
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    50   4e-06
Kwal_27.9773                                                           50   4e-06
Kwal_33.14081                                                          51   4e-06
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    50   4e-06
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    50   4e-06
Kwal_26.8941                                                           51   4e-06
Scas_610.7                                                             51   4e-06
Scas_692.24                                                            51   4e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    51   4e-06
Kwal_14.2497                                                           50   5e-06
Kwal_14.1273                                                           50   5e-06
Kwal_33.14434                                                          50   5e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    50   5e-06
Kwal_56.23841                                                          50   5e-06
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    50   5e-06
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        50   6e-06
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    50   6e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    50   6e-06
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    50   6e-06
Scas_688.14                                                            50   6e-06
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    50   7e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    50   7e-06
Scas_201.1*                                                            49   7e-06
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    50   7e-06
Scas_336.1                                                             50   7e-06
Scas_718.90                                                            50   8e-06
Kwal_33.13681                                                          50   8e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    50   8e-06
Scas_678.24                                                            50   8e-06
Scas_593.14d                                                           50   8e-06
Kwal_17.2687                                                           49   8e-06
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    50   8e-06
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    50   8e-06
Scas_568.9*                                                            49   9e-06
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    50   9e-06
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         49   9e-06
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    49   9e-06
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    49   9e-06
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    49   1e-05
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    49   1e-05
Kwal_26.7552                                                           49   1e-05
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    49   1e-05
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          49   1e-05
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    49   1e-05
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    50   1e-05
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    49   1e-05
Scas_628.9                                                             49   1e-05
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    49   1e-05
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    49   1e-05
Kwal_23.5576                                                           49   1e-05
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    49   1e-05
Scas_721.110                                                           49   1e-05
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    49   1e-05
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    49   2e-05
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    49   2e-05
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    49   2e-05
Scas_618.8                                                             49   2e-05
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           49   2e-05
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             49   2e-05
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    49   2e-05
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    49   2e-05
Kwal_26.7635                                                           49   2e-05
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    49   2e-05
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    48   2e-05
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    48   3e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      48   3e-05
Kwal_0.307                                                             48   3e-05
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    48   3e-05
Scas_22.1                                                              47   3e-05
Kwal_55.21900                                                          48   3e-05
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    48   3e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    47   3e-05
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    47   4e-05
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    47   4e-05
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            47   4e-05
Scas_704.50                                                            47   4e-05
Scas_717.69                                                            47   4e-05
Kwal_23.3590                                                           47   4e-05
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    47   5e-05
Kwal_27.11803                                                          46   5e-05
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    47   5e-05
Scas_721.61                                                            47   5e-05
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    47   5e-05
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    47   5e-05
CAGL0K01661g complement(146952..148400) some similarities with t...    47   6e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    47   6e-05
Scas_721.124                                                           47   6e-05
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    47   7e-05
KLLA0E11979g complement(1060048..1061892) some similarities with...    47   7e-05
Scas_680.20                                                            47   8e-05
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         47   8e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    47   8e-05
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    47   8e-05
Scas_655.2                                                             47   9e-05
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    46   9e-05
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             46   1e-04
Scas_713.7                                                             47   1e-04
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    47   1e-04
Scas_673.20*                                                           46   1e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    45   1e-04
Kwal_23.3471                                                           45   1e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    46   1e-04
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    46   1e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    46   1e-04
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    46   1e-04
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    45   1e-04
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            46   1e-04
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    46   1e-04
Scas_582.1                                                             45   2e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    45   2e-04
Kwal_47.17252                                                          45   2e-04
Kwal_47.18098                                                          45   2e-04
Kwal_55.20221                                                          45   2e-04
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    45   2e-04
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    45   2e-04
Sklu_1484.2 YDL108W, Contig c1484 2977-3825 reverse complement         44   2e-04
Scas_705.23                                                            45   2e-04
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    45   2e-04
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         45   3e-04
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    45   3e-04
Scas_613.13*                                                           44   3e-04
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    45   3e-04
Kwal_56.22788                                                          45   3e-04
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    45   4e-04
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    44   4e-04
Sklu_1436.2 , Contig c1436 2420-3329 reverse complement                44   4e-04
Scas_654.12                                                            44   4e-04
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    44   4e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    44   5e-04
Kwal_33.13222                                                          42   5e-04
Kwal_26.7682                                                           44   5e-04
Kwal_27.11830                                                          44   5e-04
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    44   5e-04
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    44   5e-04
Scas_568.13                                                            44   6e-04
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    44   6e-04
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    44   7e-04
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    44   7e-04
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    44   8e-04
YPL042C (SSN3) [5397] chr16 complement(473035..474702) Cyclin-de...    43   8e-04
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    44   8e-04
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    43   8e-04
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    44   8e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    43   8e-04
Kwal_33.14554                                                          43   8e-04
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    42   0.001
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    43   0.001
Scas_584.8                                                             43   0.001
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    43   0.001
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       43   0.001
Kwal_26.7276                                                           43   0.001
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    43   0.001
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    43   0.001
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    42   0.001
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    42   0.001
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    42   0.002
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    42   0.002
Kwal_33.13831                                                          42   0.002
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    42   0.002
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    42   0.002
Kwal_27.11777                                                          42   0.002
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    42   0.002
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          42   0.002
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    42   0.002
CAGL0M08360g complement(833220..835520) some similarities with s...    42   0.002
Kwal_23.3992                                                           42   0.002
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    42   0.002
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    42   0.002
Scas_721.132                                                           42   0.003
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    42   0.003
Kwal_14.1159                                                           42   0.003
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    42   0.003
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    41   0.004

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score = 1441 bits (3731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/858 (85%), Positives = 731/858 (85%)

Query: 1   MANSGAAPTEPTSDVMTTRXXXXXXXPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIY 60
           MANSGAAPTEPTSDVMTTR       PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIY
Sbjct: 1   MANSGAAPTEPTSDVMTTRSASSSASPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIY 60

Query: 61  VVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYY 120
           VVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYY
Sbjct: 61  VVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYY 120

Query: 121 DSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMH 180
           DSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMH
Sbjct: 121 DSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMH 180

Query: 181 FLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQY 240
           FLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQY
Sbjct: 181 FLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQY 240

Query: 241 RAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSK 300
           RAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSK
Sbjct: 241 RAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSK 300

Query: 301 LINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAF 360
           LINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAF
Sbjct: 301 LINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAF 360

Query: 361 QYQLYISYHQKQDVDTLNDLFINCFEIAPKQPMDMGKRDLAEKPENLEKIQNQQDSRKQI 420
           QYQLYISYHQKQDVDTLNDLFINCFEIAPKQPMDMGKRDLAEKPENLEKIQNQQDSRKQI
Sbjct: 361 QYQLYISYHQKQDVDTLNDLFINCFEIAPKQPMDMGKRDLAEKPENLEKIQNQQDSRKQI 420

Query: 421 PIRDEEDIKMVQQHFPSVEDLEIYLHSEATHFENKSDRLSSLAVPNRXXXXXXXXXXXXV 480
           PIRDEEDIKMVQQHFPSVEDLEIYLHSEATHFENKSDRLSSLAVPNR            V
Sbjct: 421 PIRDEEDIKMVQQHFPSVEDLEIYLHSEATHFENKSDRLSSLAVPNRSKSLGSSSHASSV 480

Query: 481 TDLSNGSGNSPEEVSPGVMSSNPTAKSTASIKQHKSNNPFPKMXXXXXXXXXXXXXXXXN 540
           TDLSNGSGNSPEEVSPGVMSSNPTAKSTASIKQHKSNNPFPKM                N
Sbjct: 481 TDLSNGSGNSPEEVSPGVMSSNPTAKSTASIKQHKSNNPFPKMQQQQQPQQQQPQFYQQN 540

Query: 541 IDYFHDTSKEAANPLALNAQQIGYFHSIPTEAASKTQEIAYSPDNLIRAQKTHDQHPQDT 600
           IDYFHDTSKEAANPLALNAQQIGYFHSIPTEAASKTQEIAYSPDNLIRAQKTHDQHPQDT
Sbjct: 541 IDYFHDTSKEAANPLALNAQQIGYFHSIPTEAASKTQEIAYSPDNLIRAQKTHDQHPQDT 600

Query: 601 ANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDHF 660
           AN                                                      KDHF
Sbjct: 601 ANYLPEPVEPPEQYLQYYQQVPYPLPQQQQQQKQQQTQQPQQLQQPQQPQPQQLQQKDHF 660

Query: 661 SIPSFFQSAAPQPSHYVQTQQKQVPQEELLIDLSPEKKETSSVSPPKLNITIDQVDLSYR 720
           SIPSFFQSAAPQPSHYVQTQQKQVPQEELLIDLSPEKKETSSVSPPKLNITIDQVDLSYR
Sbjct: 661 SIPSFFQSAAPQPSHYVQTQQKQVPQEELLIDLSPEKKETSSVSPPKLNITIDQVDLSYR 720

Query: 721 DEDKTXXXXXXXXXXXXXXXXXMDLXXXXXXXXXXYSSDASFVTAXXXXXXXXXXXLDLK 780
           DEDKT                 MDL          YSSDASFVTA           LDLK
Sbjct: 721 DEDKTDEASVADESIASSESIAMDLKKKEKDTKPKYSSDASFVTAPPQSSRPSRRSLDLK 780

Query: 781 FQEINFSKSPSPKESSQRHQHKESSQRHQHKKIPSSSEMRKSLSRARKSLDLEGVKRESA 840
           FQEINFSKSPSPKESSQRHQHKESSQRHQHKKIPSSSEMRKSLSRARKSLDLEGVKRESA
Sbjct: 781 FQEINFSKSPSPKESSQRHQHKESSQRHQHKKIPSSSEMRKSLSRARKSLDLEGVKRESA 840

Query: 841 GGSDTTSKRKSFFGVFKS 858
           GGSDTTSKRKSFFGVFKS
Sbjct: 841 GGSDTTSKRKSFFGVFKS 858

>Kwal_27.10945
          Length = 935

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/514 (64%), Positives = 394/514 (76%), Gaps = 26/514 (5%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELE-TPSSSLKEGDLAC 85
           P LE+L  G+ +IVG+H+VEIVKYLAEGGFAHIYVV+F+E++NELE  P+  L+ GDLAC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145
           LKRVLVTDENGLNE+RNEV VMKQL    NIVQYYDS+ASR RDGS G+EV LLMELCPN
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205
            SLLDYMNQRLATKLSE+E+LKIM+DVT+A+AQMH+LP PLIHRD+KIENVLVD+ +NFK
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           LCDFGSTS+CFP+  THQ+IA+LTNNIYVHTTPQYR+PEMIDLYRCLPI+EKSDIWALGI
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 266 FLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           FLYKLLFYTTPFELTGQFAILHSKY+ P NNYSSKLINLIIIMLAENPNLRPNIYQV+  
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDN 365

Query: 326 VCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQKQDVDTLNDLFINCF 385
           +C+I+KV  P EDKYQ G Y F+KYS+YQ KLQ  QYQ+Y++Y  KQ +DTLND+FINCF
Sbjct: 366 LCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQIDTLNDMFINCF 425

Query: 386 EIAPKQPMDMGKRDLAEKPENLEKIQNQQ--DSRKQIPIRDEEDIKMVQQHFPSVEDLEI 443
           E+APKQP+D+  +  A  P + +  +N+   +    + +  EEDI +VQQ FPSVEDL+ 
Sbjct: 426 EVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQQFPSVEDLDH 485

Query: 444 YLHSEATHFENKSDRLSSLAVPNRXXXXXXXXXXXXVTDLS--NGSGNSPEEVSPGV--- 498
           YL  E     NKS    + +  +              TDLS    + + P E  P     
Sbjct: 486 YLDGENKRDTNKSSSNGAFSTEHSSGSSSK-------TDLSAIQHAPSVPLEELPSSKPT 538

Query: 499 -----------MSSNPTAKSTASIKQHKSNNPFP 521
                      M  + TA+ST S+KQHK  NPFP
Sbjct: 539 QNVQAVATSKNMVRDTTARSTNSVKQHKPTNPFP 572

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 87/180 (48%), Gaps = 20/180 (11%)

Query: 686 QEELLIDLSPEKKETSSVSPPKLNITIDQVDLS------YRDEDKTXXXXXXXXXXXXXX 739
           +EELL+D SP  K      P KL++T D VDLS      Y+DE                 
Sbjct: 769 EEELLVDFSPPLKR----EPQKLDLTYDSVDLSTLSKGEYKDE-----TDISEQSMASSE 819

Query: 740 XXXMDLXXXXXXXXXXYSSDASFVTAXXXXXXXXXXXLDLKFQEINFSKSPSPKESSQRH 799
              +DL             +     +           LDLKFQE++FS SPSP    Q  
Sbjct: 820 SVSVDLRQNERLSAKTRGQNVDDSVSAVKPSPRGRRSLDLKFQEMDFSNSPSPDIKLQ-- 877

Query: 800 QHKESSQRHQHKKIPSSSEMRKSLSRARKSLDLEGVKRES-AGGSDTTSKRKSFFGVFKS 858
             K  +  HQ +K   ++E +KS SRARKSLDLE  KR++ + G +T+SKRKSFFG FK 
Sbjct: 878 --KTKTVSHQQRKSNVAAEPKKSFSRARKSLDLERTKRDTPSNGENTSSKRKSFFGKFKG 935

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/506 (60%), Positives = 377/506 (74%), Gaps = 32/506 (6%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSS--LKEGDLA 84
           P    L+P T ++VG+H+ EI+++LAEGGFA+IY VKF+E +NE++    S  LK GD+A
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCP 144
           CLKRV+V DENGLNELRNEVE MKQL+ S NIVQYYDSNASR  DGSPG+E+LLLMELCP
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 145 NKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF 204
            KSLLDYMN +LATKL+E E+LKIMYDV+ A+AQMH+LPTPLIHRDIKIENVLVD ++NF
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 205 KLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264
           KLCDFGSTS CFPI++THQDIA+LTNNIYVHTTPQYR+PEMIDLYRCLPI+EKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 265 IFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIY 324
           IFLYKLLFYTTPFELTGQFAILHSKY+IP N YSSKLINLIIIMLAENP+LRPNIYQV++
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMH 323

Query: 325 QVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQKQ----DVDTLNDL 380
            VC+I+K DVPF DKY+ GPYDF KYS+Y  KLQ  QYQ++  Y  ++    DVD LNDL
Sbjct: 324 HVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFELYKNEKVTSGDVDKLNDL 383

Query: 381 FINCFEIAPKQPMD--MGKRDLAEKPENLEKIQNQQDSRKQIPIRDEEDIKMVQQHFPSV 438
           FI  FEIAPKQP+D  +G  D  E PE+LE                  DI  + + +P+V
Sbjct: 384 FIQNFEIAPKQPIDKGIGSVDQQEAPEDLET-----------------DIAKMDECYPTV 426

Query: 439 EDLEIYLHSEATHFENKSDRLSSLAVPNRXXXXXXXXXXXXVTDLSNGSGNSPEEV-SPG 497
           E LE    + A   ++   ++ S ++                  L +   +S   + +P 
Sbjct: 427 EKLE---SANAKERDDHHLQVLSTSLKQSSSRSISDLSNKSQVSLDSNERHSSHGIRAPS 483

Query: 498 VMSSNPTAKSTASI---KQHKSNNPF 520
            + S+   ++TA++   +QHK +NPF
Sbjct: 484 PLPSSQQPQNTANMSAARQHKQHNPF 509

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 777 LDLKFQEINFSKSPSPKESSQRHQHKESSQRHQHKKIPSSSEMRKSLSRARKSLDLEGVK 836
           LDLK+QEIN S      +  ++H+  ++S         S + +R+S+   R   D     
Sbjct: 747 LDLKYQEINLSN-----DDQRKHRKNKTSF--------SRTSVRRSVEMERMKHDSNSTS 793

Query: 837 RESAGGSDTTSKRKSFFGVFK 857
             +A      +KR+SFFGVFK
Sbjct: 794 NSNARDETKETKRRSFFGVFK 814

>YBR059C (AKL1) [250] chr2 complement(356821..360147)
           Serine/threonine protein kinase of unknown function
           [3327 bp, 1108 aa]
          Length = 1108

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/572 (54%), Positives = 387/572 (67%), Gaps = 75/572 (13%)

Query: 17  TTRXXXXXXXPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELE-TPS 75
           T+R       P +E+  PG ++ VG+HKVE+V YLAEGGFA IYVVKF+E+ NE + T S
Sbjct: 7   TSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTAS 66

Query: 76  SSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE 135
             LK GD+ACLKRVLV DENGLNE+RNEVEVMK+LK + NIVQY+DSNASRRRDG  G+E
Sbjct: 67  VPLKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFE 126

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           VLLLMELCPNKSLLDYMNQRL+TKL+E E++KIMYDV  +++QMH+LP  LIHRDIKIEN
Sbjct: 127 VLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIEN 186

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           VLVD++NNFKL DFGSTS+CFPI+TTHQDIALLT NIYVHTTPQYR+PEMIDLYRCLPI+
Sbjct: 187 VLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIN 246

Query: 256 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNL 315
           EKSDIWALG+FLYKLLF+TTPFE+TGQFAILHSKY+ P N YSSKLINLIIIMLAENPNL
Sbjct: 247 EKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNL 306

Query: 316 RPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQK---- 371
           RPNIYQV+Y +C I+ V+VP EDKY  G Y+F KY+++Q KLQ  Q Q+Y    +K    
Sbjct: 307 RPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKIMQN 366

Query: 372 -----QDVDTLNDLFINCFEIAPKQPMDM--GKRDLAEKP------ENLEKIQNQQDSRK 418
                 + + LND+F++ FEI+ K PM+   G   ++  P      E  E+ ++Q D RK
Sbjct: 367 NKLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQNVGQELEEEKESQSDQRK 426

Query: 419 QIPIRDE-----------------EDIKMVQQ-----------------HFPSVEDLEIY 444
                D+                 ++I  +Q                  ++PSV +L+ Y
Sbjct: 427 STLSEDKSSRTTSNANSSGTANNPQEINTIQSPGIEDKSIFENKTPGELYYPSVSELDTY 486

Query: 445 LHSEATH------FENKSDRLSSLAVPNRXXXXXXXXXXXXVTDLSNGSGNSPEEVSPGV 498
           L  E            +S RL++ ++P R             +  S+G G S +  S G 
Sbjct: 487 LDKELVKQSSDPTISEQSPRLNTQSLPQR---------QKSTSSYSSG-GRSMKSTSYGA 536

Query: 499 MS-------SNPTAKSTASIKQHKSNNPFPKM 523
            +       +N        +KQHKSNNPFPKM
Sbjct: 537 ATIGSDEALANEKTAGINKMKQHKSNNPFPKM 568

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (69%), Gaps = 5/46 (10%)

Query: 818  EMRKSLSRARKSLDLEGVKRES-----AGGSDTTSKRKSFFGVFKS 858
            EMRKS +RAR+SLDLE V+RE+     +    +  KR+SFF VF+S
Sbjct: 1061 EMRKSFARARQSLDLERVRREAMASSASSSGGSNGKRRSFFSVFRS 1106

>Scas_661.27
          Length = 1095

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/380 (72%), Positives = 323/380 (85%), Gaps = 11/380 (2%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETP--SSSLKEGDLA 84
           P  E+  PGT + VG+HKVEI+KY+AEGGFA IY VKF+EF NE E       L+ GD+A
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCP 144
           CLKRVLV DENGLNE+RNEVEVMKQL+ + NIVQYYDSNASRR +G PG+EVLLLMELCP
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136

Query: 145 NKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF 204
           NKSLLDYMNQRLATKL+EKE+LKIMYDVT AV+QMH+LPTPL+HRDIKIENVLVD++NNF
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 205 KLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264
           KLCDFGSTS+ FP++TTHQDIA+LT NIYVHTTPQYR+PEMIDLYRCLPIDEKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 265 IFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIY 324
           IFLYKLLF+TTPFELTGQFAILHSKY+ P NNYSSKLINLIIIMLAENPNLRPNIYQV++
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316

Query: 325 QVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQK---------QDVD 375
            +C+I  + VP ED+Y  GPYDF+KY+ +Q K+Q+ QYQLY+   +K          D++
Sbjct: 317 NICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQEKKFKTNGKLPQADIN 376

Query: 376 TLNDLFINCFEIAPKQPMDM 395
            LNDLF+  F+IA K P ++
Sbjct: 377 LLNDLFVTSFDIASKVPFEL 396

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 41/62 (66%), Gaps = 5/62 (8%)

Query: 801  HKESSQRHQHKKIPSSS----EMRKSLSRARKSLDLEGVKRESAGGSDTTSKRKSFFGVF 856
            +K S++ + +  IP S+    EM+KS ++AR+SLDLE V+RE+   SD   KR+S F +F
Sbjct: 1032 YKHSTKNNSNSSIPISTTNTNEMKKSFAKARQSLDLERVRREALLNSD-NGKRRSIFSMF 1090

Query: 857  KS 858
            + 
Sbjct: 1091 RG 1092

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 16/22 (72%), Gaps = 2/22 (9%)

Query: 504 TAKST--ASIKQHKSNNPFPKM 523
           TAKS      KQHKSNNPFPKM
Sbjct: 599 TAKSDLPGMAKQHKSNNPFPKM 620

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 398 RDLAEKPENLEKIQNQQDSRKQIPIRDEEDIKMVQQHFPSVEDLEIYLHSE 448
           RD+A  P N EK +N  +     PI + E      Q+FP+V +L+ YL +E
Sbjct: 458 RDIA-TPSNFEKKENVNEKSPGKPIENTE------QYFPTVGELDYYLDNE 501

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 372/546 (68%), Gaps = 49/546 (8%)

Query: 29  LEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKR 88
           LE L  G+ ++VG H+VE+++YLAEGGFAHIY V FV ++NEL+     L+ GD  CLKR
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85

Query: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL 148
           V V+DENGLNELRNEVEVMK+L+N  NIVQYYDSNASR  DG PGYEVLLLMELCPN SL
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145

Query: 149 LDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCD 208
           LDYMNQRLATKLSE EVLKIMYD+T  ++ MH+  TPLIHRDIKIENVLVD++NNFKLCD
Sbjct: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205

Query: 209 FGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLY 268
           FGSTS C P + +HQ+IA+L NNIYVHTTPQYR+PEMIDLYRCLPI+EKSDIWALGIFLY
Sbjct: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265

Query: 269 KLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCA 328
           KLLFYTTPFELTGQFAILHSKY+IP N++SSKLINL+IIMLAENP LRPN+YQV+Y +C+
Sbjct: 266 KLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICS 325

Query: 329 IMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQKQ----DVDTLNDLFINC 384
           +M+ +V  +D Y  GPY+FD Y +YQEKLQ  QY + +S+   Q    + D +NDLFI+ 
Sbjct: 326 MMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDLFIST 385

Query: 385 FEIAPKQPMDMGKRDLAEKPENLEKIQNQQDSRKQIPIRDEEDIKMVQQH---------- 434
           FE APKQPM MG+  +A++    +       +   +P+  ++ +     H          
Sbjct: 386 FECAPKQPMVMGQNAVAQQ----QIFVAPPSTNTSMPVDMQQSLPKPLDHNGPNAHGGLD 441

Query: 435 ----FPSVEDLEIYLHSEATHFENKSD-RLSSLAVPNRXXXXXXXXXXXXVTDLSNGSGN 489
                P   D+  Y  +E TH    +D + + + VP +               LS+ SGN
Sbjct: 442 SLQKLPKSADVGNYPVAE-THMHMYADAQKNYIQVPRKEVMMQHTDRSV----LSDHSGN 496

Query: 490 SPEEVSPGVMSSNPTA----KSTASIKQHKSNNPFPKMXXXXXXXXXXXXXXXXNIDYFH 545
                +P +  S P       +T   KQ+K NNPFPKM                  D+ H
Sbjct: 497 GTS--TPSLPGSCPVQHEQLANTPKSKQYKKNNPFPKMAKQ---------------DFVH 539

Query: 546 DTSKEA 551
           DT  E+
Sbjct: 540 DTYDES 545

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 49/96 (51%), Gaps = 19/96 (19%)

Query: 777 LDLKFQEINFSKSPSPKESSQRHQHKESSQRHQHKKIPSSSEM------------RKSLS 824
           L+L FQEI+ S SP+P  +S     K SS+ H       ++              RKS  
Sbjct: 871 LELDFQEIDLSSSPTPVSAS-----KTSSKAHLQPNRSGTANCGTSNSSSVVSGVRKSFH 925

Query: 825 RARKSLDLEGVKRESA--GGSDTTSKRKSFFGVFKS 858
           R RKS+DL+  K+ES     +  + KR+S FGVFKS
Sbjct: 926 RGRKSVDLDVSKKESKEEPTNSGSGKRRSIFGVFKS 961

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/388 (68%), Positives = 308/388 (79%), Gaps = 15/388 (3%)

Query: 18  TRXXXXXXXPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELET--PS 75
           +R       P  EK   G +I VG+H+VEIV YLAEGGFA IYVVKFVE+ NE E+    
Sbjct: 6   SRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSK 65

Query: 76  SSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE 135
           S++  GD+ACLKRV+V DE GLNE+RNEVEVMK+LK+S NIVQY+DSNASRR DG PG+E
Sbjct: 66  SAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE 125

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           VLLLMELCPNKSLLDYMNQRL TKLSE E+LKIMYDV+  ++ MH+L  PLIHRDIKIEN
Sbjct: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           VLVD+ NNFKLCD GSTS C P M ++QDIA++T NIYVHTTPQYRAPEMIDLYR LPI+
Sbjct: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245

Query: 256 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNL 315
           EKSDIWALGIFLYKLLFYTTPFE+TGQ AILHSKYD P N YSSK+INLIIIMLAENPNL
Sbjct: 246 EKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNL 305

Query: 316 RPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQ----- 370
           RPNI+QV+Y +C+IM + VP ED+Y  GPY+FD Y+K+Q K+Q  Q Q  I+Y Q     
Sbjct: 306 RPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQ--INYLQNKVVS 363

Query: 371 ------KQDVDTLNDLFINCFEIAPKQP 392
                 K+D   L++L+I  FE+ PK P
Sbjct: 364 SKSKLSKEDGLVLDELYIKTFEMIPKIP 391

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 31/43 (72%), Gaps = 3/43 (6%)

Query: 818  EMRKSLSRARKSLDLEGVKRESAGGSDT---TSKRKSFFGVFK 857
            EM++S ++AR+SLDLE  +R++   S++   T KRKS F +FK
Sbjct: 985  EMKRSFAKARQSLDLERARRDAMSRSNSGHETGKRKSLFSMFK 1027

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  512 bits (1319), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 242/385 (62%), Positives = 303/385 (78%), Gaps = 21/385 (5%)

Query: 30  EKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELE-----TPSSSLKEGDLA 84
           EK   G ++ VGSH+VE+V YLAEGGFA IYVVKFVE++NE E     + +  LK G  A
Sbjct: 94  EKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPA 153

Query: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSP----GYEVLLLM 140
           CLKRVLV DE GLN++R+EVEVMK+L+ + NIVQY+DSNASR RD S     G+EVLLLM
Sbjct: 154 CLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLM 213

Query: 141 ELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS 200
           ELCPNKSLLDYMNQRLATKL+E+E+ KIMYD+T AVAQMH+LP PLIHRDIKIENVLVD+
Sbjct: 214 ELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA 273

Query: 201 ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDI 260
            NNFKLCDFGSTS+CFP  T+ QDIA+L+ ++Y+HTTPQYR+PEMIDL++ +PI+EKSDI
Sbjct: 274 NNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDI 333

Query: 261 WALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIY 320
           WALG+FLYKLLF+TTPFE TGQFA+LHSK++ P N+YSSKLINLII+MLAENP+LRPNIY
Sbjct: 334 WALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIY 393

Query: 321 QVIYQVCAIMKVDVP---FEDKYQTGPYDFDKYSKYQEKLQAFQYQLYI---------SY 368
           QV+Y +  +   +VP     DKY  GPY+F+KY+++Q++ Q  Q QL           S 
Sbjct: 394 QVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKINDPNST 453

Query: 369 HQKQDVDTLNDLFINCFEIAPKQPM 393
            Q  D +  + ++++ F I P+ P+
Sbjct: 454 MQPADWELYDRMYMSAFTIVPQLPV 478

>Kwal_27.11542
          Length = 791

 Score =  326 bits (836), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 207/309 (66%), Gaps = 13/309 (4%)

Query: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94
           GT + VGSH+  I+KYL  GGFAHIY  +         +P+     G++ACLKRVLV D+
Sbjct: 12  GTALTVGSHQARIIKYLTSGGFAHIYSAEI--------SPADPNSIGNVACLKRVLVPDK 63

Query: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRR--RDGSPGYEVLLLMELCPNKSLLDYM 152
             LN LR EV+ MK L+ + ++V Y DS+A++   +DGS  YEV LLME C    L+D+M
Sbjct: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGS--YEVFLLMEYCSAGGLIDFM 121

Query: 153 NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST 212
           N RL  +L+E EVLKIM D+T+ +A MH L  PLIHRDIKIENVL+  +  FK+CDFGS 
Sbjct: 122 NTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSV 181

Query: 213 SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 272
                     Q+ + + N+I  +TT QYR+PEMIDLYR  PI+EKSDIWALG+FLYKL +
Sbjct: 182 CGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCY 241

Query: 273 YTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMK 331
           YTTPFE  G  AILHS++  PA   YS +L NLI +ML+ENPN RPNI QV+ +V  I  
Sbjct: 242 YTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQN 301

Query: 332 VDVPFEDKY 340
           V  P  + Y
Sbjct: 302 VPCPLRNFY 310

>Scas_601.6
          Length = 661

 Score =  316 bits (809), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 205/315 (65%), Gaps = 9/315 (2%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86
           P +    PGTL+ VGSHKV++VKYL  GGFA IY V+         +P       ++ACL
Sbjct: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQI--------SPPDKFTNTNVACL 55

Query: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146
           KRV+V D+  LN LR EV+ MK L+N+ ++V Y DS+A++       YEV LLME C   
Sbjct: 56  KRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMG 115

Query: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
            L+D+MN RL  +L E E+L IM  VT+ +A MH L  PL+HRDIKIENVL+ S+  +K+
Sbjct: 116 GLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKV 175

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFGS        +  Q+++ + ++I  +TT QYRAPEMIDLYR LPIDEKSDIWALG+F
Sbjct: 176 CDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVF 235

Query: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           LYKL +YTTPFE  G+ AILH+ +  P    YS +L  LI  ML E P+ RPN YQV+ +
Sbjct: 236 LYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEE 295

Query: 326 VCAIMKVDVPFEDKY 340
           V ++  V  P  + Y
Sbjct: 296 VSSMQNVQCPIPNFY 310

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  319 bits (818), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 204/315 (64%), Gaps = 10/315 (3%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86
           P LE    GT++ VGSHK  I+KYL  GGFAHIY       S E+  P  +     +ACL
Sbjct: 4   PPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIY-------SAEISPPDPN--SSSIACL 54

Query: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146
           KRVLV D+  LN LR EV+ MK LK    +V Y DS+A++    +  YEV LLME C   
Sbjct: 55  KRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARG 114

Query: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
            L+D+MN RL  +L E EVLKIM  V++ VA MH L  PLIHRDIKIENVL+  + NFK+
Sbjct: 115 GLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKV 174

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFGS           Q++  + ++I  +TT QYR+PEMIDLYR LP+DEKSDIWALG+F
Sbjct: 175 CDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVF 234

Query: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           LYKL +YTTPFE  G+ AILHSK+  PA   YS +L NLI  +L ENP  RPNI Q++ +
Sbjct: 235 LYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE 294

Query: 326 VCAIMKVDVPFEDKY 340
           V  I  V  P ++ Y
Sbjct: 295 VSRIQGVPCPVKNFY 309

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  311 bits (796), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 159/312 (50%), Positives = 207/312 (66%), Gaps = 14/312 (4%)

Query: 32  LAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV 91
           L PG ++ VGSH+V+I++YL  GGFA IY       S E+ +P     +G LACLKRV V
Sbjct: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIY-------SCEVLSPGP--IQGSLACLKRVHV 59

Query: 92  TDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASR--RRDGSPGYEVLLLMELCPNKSLL 149
            D+  LN LR EV+ MK LK   ++V Y DS+A++  R DG+  YEV LLME C    L+
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLI 117

Query: 150 DYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
           D+MN RL T+LSE EVLKIM  V + +  MH L  PLIHRDIKIENVL+  + +FK+CDF
Sbjct: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177

Query: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269
           GS S          +   + ++I  +TT QYRAPEMIDLYR LP+DEKSDIWALG+FLYK
Sbjct: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237

Query: 270 LLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCA 328
           + ++TTPFE  G+ AIL +K+  P+   Y+ +L NLI +ML+E+P  RPNI QV+ +V  
Sbjct: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297

Query: 329 IMKVDVPFEDKY 340
           I  V  P  + Y
Sbjct: 298 IQGVPCPLPNFY 309

>Scas_671.16
          Length = 723

 Score =  310 bits (793), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 204/315 (64%), Gaps = 9/315 (2%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86
           P +    PGTL+ VGSH  +I+KYL  GGFA IY  +         +P +       ACL
Sbjct: 4   PNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEI--------SPINPYNNSQTACL 55

Query: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146
           KRV+V D+ GLN LR EV+ MK LKN+ ++V Y DS+A+R    +  YEV LLME C   
Sbjct: 56  KRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGG 115

Query: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
            L+D+MN RL  +L+EKE+L I+    + V+ MH L   LIHRDIKIENVL+ ++  FK+
Sbjct: 116 GLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKI 175

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFGS  S        Q++A + +++  +TT QYRAPEM+DLYR LPI+EKSDIWALG+F
Sbjct: 176 CDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVF 235

Query: 267 LYKLLFYTTPFELTGQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           LYKL +YTTPFE  G+ AILHS+Y  PA   Y+ KL NLI   L E+P+ RPNI Q++ +
Sbjct: 236 LYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEE 295

Query: 326 VCAIMKVDVPFEDKY 340
           +  I  +  P  + Y
Sbjct: 296 ISRIQGIPCPINNFY 310

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  310 bits (793), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 205/315 (65%), Gaps = 9/315 (2%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86
           P +EK A GT++ VGSH+V+++KYLA GGFAH+Y V+         +P   +   ++ACL
Sbjct: 4   PQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI--------SPPDPVCPDNVACL 55

Query: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146
           KRV+V D+  LN LR EV+ MK L+ +  IV Y DS+A++       YEV LLME C   
Sbjct: 56  KRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGG 115

Query: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
            L+D+MN RL  +L E E+L IM  V++ VA MH L  PLIHRDIKIENVL+   + FKL
Sbjct: 116 GLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKL 175

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFGS S         ++   +  +I  +TT QYR PEMIDLYR LPIDEKSDIWALG+F
Sbjct: 176 CDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVF 235

Query: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           LYK  +YTTPFE  G+ AIL SK++ PA   YS ++ NLI +ML  +P  RPNI QV+ +
Sbjct: 236 LYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295

Query: 326 VCAIMKVDVPFEDKY 340
           V  I  +  P ++ Y
Sbjct: 296 VSRIQGIPCPIKNFY 310

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  306 bits (784), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 148/315 (46%), Positives = 201/315 (63%), Gaps = 10/315 (3%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86
           P +    PGT++ VGSH  +I+KYL  GGFA +Y  +         +P       ++ACL
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPPDPYSNANIACL 55

Query: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146
           KRV+V  + GLN LR EV+ MK L+N+ ++V Y DS+A+R  +G   YEV +LME C   
Sbjct: 56  KRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLMEFCERG 114

Query: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
            L+D+MN RL  +L E E+L+IM    + +  MH L  PLIHRDIKIENVL+  +  +K+
Sbjct: 115 GLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKV 174

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFGS S         Q+   + ++I  +TT QYR+PEMIDLYR LPIDEKSDIWALG+F
Sbjct: 175 CDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVF 234

Query: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           LYK+ +YTTPFE +G+  ILH++Y  P+   YS +L NLI +ML E P+ RPNI QV+ +
Sbjct: 235 LYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEE 294

Query: 326 VCAIMKVDVPFEDKY 340
           V  +     P  + Y
Sbjct: 295 VSRLQNKPCPIRNFY 309

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  300 bits (767), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 205/316 (64%), Gaps = 11/316 (3%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEG-DLAC 85
           P L+++  GT + VG+H V+I+KYL  GGFA IY V+ +         S  L  G ++AC
Sbjct: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEIL---------SMGLFNGSNVAC 54

Query: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145
           LKRV V D+  LN LR EV+ MK L N+ ++V Y DS+A+R       YEV LLME C  
Sbjct: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEG 114

Query: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205
             L+D+MN RL  +L+E E+L IM   T+ +A MH L  PL+HRDIKIENVL+     +K
Sbjct: 115 GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174

Query: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           +CDFGS S         Q++  + ++I  +TT QYR PEM+DLYR LPIDEK+DIWALG+
Sbjct: 175 VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGV 234

Query: 266 FLYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIY 324
           FLYKL +YTTPFE  G+ AILH+++  P+  NYS +L NLI  ML E+P+ RPN+ QV+ 
Sbjct: 235 FLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294

Query: 325 QVCAIMKVDVPFEDKY 340
           +V  +  V  P  + Y
Sbjct: 295 EVSRMQNVPCPIRNFY 310

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  297 bits (760), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 149/305 (48%), Positives = 196/305 (64%), Gaps = 9/305 (2%)

Query: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94
           GT + VGSH+VEI+KYL  GGFA +Y        + L  P        +ACLKRV+V D+
Sbjct: 12  GTQLTVGSHQVEIIKYLTSGGFAQVY--------SALINPPDPHSNSSVACLKRVIVPDK 63

Query: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154
             LN LR EV+ M+ LKN+  +V Y DS+A++    +  YEV +LME C    L+D+MN 
Sbjct: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNT 123

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214
           RL  +L E E+L+IM  VT+ VA MH L  PLIHRDIKIENVL+ + N +KLCDFGS   
Sbjct: 124 RLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCG 183

Query: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 274
                   Q+++ +  +I  +TT QYR+PEMID +R LPIDEKSDIWALGIFLYKL +YT
Sbjct: 184 IIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYT 243

Query: 275 TPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVD 333
           TPFE  G  AIL  K++ P   NYS +L  LI  +L ++P  RPN+YQ++ ++  +  V 
Sbjct: 244 TPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVP 303

Query: 334 VPFED 338
            P  D
Sbjct: 304 CPIND 308

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  288 bits (738), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 143/311 (45%), Positives = 202/311 (64%), Gaps = 9/311 (2%)

Query: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86
           P + K  PGT + VGSH V I+KYL  GG+A IY  + +        P+      ++A L
Sbjct: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIM--------PADQFLGTNMAVL 55

Query: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146
           KRV+V D++ LN LR EV+ MK+LK+   IV Y DS+A++ +     YEV L+ME C   
Sbjct: 56  KRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRG 115

Query: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
            L+D+MN RL  +L+E E+L I   +++ VA MH L  PLIHRDIKIENVL+ +++ +KL
Sbjct: 116 GLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKL 175

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFGS S       T +++A + ++I + TT QYRAPEM+DL +   +++KSDIWALG+F
Sbjct: 176 CDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVF 235

Query: 267 LYKLLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325
           LYKL +YTTPFE TG+  IL+   + P   +YS  +  LI+ MLA+NP  RPNI+Q+I  
Sbjct: 236 LYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295

Query: 326 VCAIMKVDVPF 336
           V  ++ V+ P 
Sbjct: 296 VSKLLNVNCPI 306

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 99.0 bits (245), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 131/282 (46%), Gaps = 46/282 (16%)

Query: 50  YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQ 109
           +L EGGFA  + +K               K      + ++ +  E    +L +E+++ K 
Sbjct: 95  FLGEGGFARCFQMK-----------DDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKS 143

Query: 110 LKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIM 169
           +K+  NIVQ+ D              V +L+E+CPN S+++ + QR    L+E EV   M
Sbjct: 144 MKHP-NIVQFTDCFED-------DTNVYILLEICPNGSVMELLRQR--KHLTEPEVRFCM 193

Query: 170 YDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLT 229
             +  A+  MH     +IHRD+K+ N+  D E N K+ DFG               A+L 
Sbjct: 194 IQIIGAIRYMH--SRRVIHRDLKLGNIFFDKEYNLKIGDFGLA-------------AVLA 238

Query: 230 NN----IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFEL----TG 281
           N+      +  TP Y APE++   +      + DIW++G+ LY LLF   PF+     T 
Sbjct: 239 NDKERKYTICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETI 297

Query: 282 QFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQV 322
              I    +  PA+   SS   NLI  +L  NP  RP++Y++
Sbjct: 298 YERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEI 339

>Kwal_56.24274
          Length = 346

 Score = 95.1 bits (235), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 144/338 (42%), Gaps = 70/338 (20%)

Query: 36  TLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDEN 95
           + + +   K  I K L EGG + +Y+V+               KEG+L  LK+       
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVES--------------KEGELFALKKTRCP--- 59

Query: 96  GLNELRNEVEVMKQLKN-----SDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLD 150
               + +    MK++ N     S  I Q  DS   + +DGS    V +L+      SL D
Sbjct: 60  -FGSIGSISPAMKEVANYQRFSSPYIAQIVDSQVVQEKDGSK--TVYVLLPYFAKGSLQD 116

Query: 151 YMNQRL--ATKLSEKEVLKIMYDVTKAVAQMH-------------FLPTPLI-------- 187
            +N+ L   T++SE ++L++   + + +  +H              +  P          
Sbjct: 117 LINRHLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLND 176

Query: 188 --------------HRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIY 233
                         HRD+K  N+++  E+   + D GS S     + + Q +        
Sbjct: 177 LELDTFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSS 236

Query: 234 VHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE----LTGQ---FAIL 286
            + T  Y APE++D+     I EK DIW+ G  +Y + F  +PFE    ++G    +AI 
Sbjct: 237 DNCTLSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAIT 296

Query: 287 HSKYDIP-ANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
             KY +P   +YSS LI LI   L+ NP  RP++ ++I
Sbjct: 297 TGKYTVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELI 334

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 154/356 (43%), Gaps = 82/356 (23%)

Query: 36  TLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDEN 95
           +++I G H   I + L EGGF+ +Y+V+             S +  DL  LK++     N
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ-------------SRENNDLFALKKIHCPFGN 65

Query: 96  --GLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153
              ++E   EV   K+ + S  I     S   + +DGS    V +L+   P  SLLD +N
Sbjct: 66  IESVSEAMREVNSYKKFR-SPYITHCVSSQVLQEQDGSK--TVFILLPYFPTGSLLDKIN 122

Query: 154 QRL--ATKLSEKEVLKIMYDVTKAVAQMH-------------FLPTPLIHRD-------- 190
             L   T +SE+E+++I+  V + +  MH              + T L +RD        
Sbjct: 123 THLLDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNE 182

Query: 191 --------------------------------IKIENVLVDSENNFKLCDFGSTSSCFPI 218
                                           IK  N++  S+    +CD GS S     
Sbjct: 183 DLRLLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVD 242

Query: 219 MTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
           +++   +         H T  +R+PE++++     IDEK DIW+LG  LY + F  +PFE
Sbjct: 243 ISSRSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFE 302

Query: 279 ----LTGQ---FAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQV 326
               L+G    +AI   K+ IP N NYS +LI +I   +  +   RP+I +++ ++
Sbjct: 303 REEQLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARL 358

>Scas_700.28
          Length = 896

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 98/197 (49%), Gaps = 28/197 (14%)

Query: 135 EVLLLMELCPNKSLLDYM--NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIK 192
           +V + +E CP K L D +    R+ T     E +++   +   V   H L    +HRD+K
Sbjct: 103 KVWMALEYCPGKELYDRVLSMHRVPTD----ECVQLFAQIVGGVHYAHSLN--CVHRDLK 156

Query: 193 IENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDL--YR 250
           +EN+L+D   + KL DFG T  C    TT + I           T  Y APE+I+   Y 
Sbjct: 157 LENILLDKSGDAKLTDFGFTRECM-TKTTLETIC---------GTTVYMAPELIERKSYD 206

Query: 251 CLPIDEKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYDIPANNYSSKLINLII 306
              I    DIW+LG+ LY ++  + PF    E   ++ I+H    +  N  ++   +LI+
Sbjct: 207 GFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLIL 262

Query: 307 IMLAENPNLRPNIYQVI 323
            +LA+NPN RP + Q++
Sbjct: 263 RLLAKNPNDRPTVEQIL 279

>Scas_644.15
          Length = 726

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 129/283 (45%), Gaps = 46/283 (16%)

Query: 50  YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQ 109
           +L EGGFA  + +K             S K      + ++ +  E    +L +E+++ K 
Sbjct: 97  FLGEGGFARCFQIK-----------DESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKS 145

Query: 110 LKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIM 169
           +K+  NIV + D              V +L+E+C N SL+D M +R    L+E EV    
Sbjct: 146 MKHP-NIVHFVDCFED-------DTNVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFT 195

Query: 170 YDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLT 229
             +  AV  MH     +IHRD+K+ N+  D + N K+ DFG               A+L 
Sbjct: 196 TQICGAVKYMH--SRRVIHRDLKLGNIFFDKDYNLKVGDFGLA-------------AVLA 240

Query: 230 NN----IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAI 285
           NN      V  TP Y APE++ + +      + DIW++G+ +Y LL    PF+      I
Sbjct: 241 NNRERKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVI 299

Query: 286 LH----SKYDIPANNY-SSKLINLIIIMLAENPNLRPNIYQVI 323
                  +Y  P + Y SS+   LI  +L  +P  RP+I ++I
Sbjct: 300 YDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREII 342

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 133/291 (45%), Gaps = 47/291 (16%)

Query: 37  LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENG 96
           L  VG++K  I+K + EG F  +Y+         L  P+         CLK    +D+N 
Sbjct: 35  LTEVGNYK--ILKQIGEGSFGKVYLA--------LHRPTHRK-----VCLK---TSDKND 76

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
            N +R EV   +Q  +   I + Y+   +  +       V + +E CP K L D++    
Sbjct: 77  PNIVR-EVFYHRQF-DFPYITKLYEVIVTESK-------VWMALEYCPGKELYDHLLS-- 125

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
             ++S  E  ++   ++ AV   H +    +HRD+K+EN+L+D   N KL DFG T  C 
Sbjct: 126 LRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECM 183

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
              T             V  T  Y APE+I+  R      K DIW+LG+ LY L+    P
Sbjct: 184 TKTTLET----------VCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGYLP 231

Query: 277 F----ELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
           F    E   ++ I++ +    A        +LI  +LA+NP  RP++ QV+
Sbjct: 232 FDDDDEAKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 133/284 (46%), Gaps = 48/284 (16%)

Query: 50  YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQ 109
           +L EGGFA  + +K             S K      + ++ +  E    +L +E+++ K 
Sbjct: 82  FLGEGGFARCFQMK-----------DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKS 130

Query: 110 LKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIM 169
           +K+  NIVQ+ D              V +L+E+CPN SL+D + +R    L+E EV    
Sbjct: 131 MKHP-NIVQFIDCFED-------DTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFT 180

Query: 170 YDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLT 229
             +  A+  MH     +IHRD+K+ N+  DS  N K+ DFG               A+L 
Sbjct: 181 TQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLA 225

Query: 230 NN----IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAI 285
           N+      V  TP Y APE++         E  DIW++G+ +Y LL    PF+   +  I
Sbjct: 226 NDRERKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNI 283

Query: 286 LHSK-----YDIPANNYSSKLINLIII-MLAENPNLRPNIYQVI 323
           ++ +     Y  P    +SK + ++I  +L+ +P  RP++ +++
Sbjct: 284 IYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 327

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 136/294 (46%), Gaps = 53/294 (18%)

Query: 37  LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT-DEN 95
           L+ +G++K  IVK + EG F  +Y                 L    L   K VL T ++N
Sbjct: 31  LVDIGNYK--IVKLIGEGSFGKVY-----------------LANHRLTHQKVVLKTGNKN 71

Query: 96  GLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR 155
             N +R EV   +Q  +  +I + Y+   +  +       V + +E CP K L +Y+   
Sbjct: 72  DPNVVR-EVFYHRQF-DFPHITKLYEVIVTESK-------VWMALEYCPGKELYEYL--L 120

Query: 156 LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSC 215
           +  ++S +E  K+   +  AV   H L    +HRD+K+EN+L+D +   K+ DFG T  C
Sbjct: 121 MQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFGFTREC 178

Query: 216 FPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDL--YRCLPIDEKSDIWALGIFLYKLLFY 273
                     A  T    V  T  Y APE+I+   Y    I    DIW+LG+ LY ++  
Sbjct: 179 ----------ATKTMLETVCGTTVYMAPELIERKSYDGFKI----DIWSLGVILYTMIHG 224

Query: 274 TTPF----ELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
           T PF    E   ++ I++ +     +  S    +LI  +L ++P+ RP + QV+
Sbjct: 225 TMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 89.0 bits (219), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 107/233 (45%), Gaps = 41/233 (17%)

Query: 50  YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQ 109
           +L EGGFA  + +K             S K      + ++ +  E    +L +E+++ K 
Sbjct: 78  FLGEGGFARCFQMK-----------DDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKS 126

Query: 110 LKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIM 169
           +K+  NIVQ+ D              V +L+E+CPN SL+D + QR   +L+E EV    
Sbjct: 127 MKHP-NIVQFTDCFED-------DTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFT 176

Query: 170 YDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLT 229
             +  A+  MH     +IHRD+K+ N+  D   N K+ DFG               A+L 
Sbjct: 177 TQIVGAIKYMH--SRRIIHRDLKLGNIFFDKHFNLKIGDFGLA-------------AVLA 221

Query: 230 NN----IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
           N+      +  TP Y APE++         E  DIW++G+ +Y LL    PF+
Sbjct: 222 NDRERKYTICGTPNYIAPEVLTGKHTGHSFE-VDIWSIGVMIYALLIGKPPFQ 273

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 134/300 (44%), Gaps = 46/300 (15%)

Query: 33  APGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT 92
            P +LI          ++L EGGFA  + +K             S K      + ++ + 
Sbjct: 69  TPPSLIKTRGRDYHRGQFLGEGGFARCFQIK-----------DDSGKIFAAKTVAKISIK 117

Query: 93  DENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM 152
            E    +L +E+++ K + ++ NIVQ+ D              V +L+E+CPN SL++ +
Sbjct: 118 SEKTRKKLLSEIQIHKSMSHT-NIVQFIDCFED-------NVNVYILLEICPNGSLMELI 169

Query: 153 NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST 212
            +R    ++E EV   M  +   +  MH     +IHRD+K+ N+  D   N K+ DFG  
Sbjct: 170 KKR--KTITEPEVRFFMTQICGGIQYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLA 225

Query: 213 SSCFPIMTTHQDIALLTNN----IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLY 268
                        A+L N+      +  TP Y APE++ + +      + DIW++G+ LY
Sbjct: 226 -------------AVLANDRERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLY 271

Query: 269 KLLFYTTPFEL----TGQFAILHSKYDIPANNYSSKLINLII-IMLAENPNLRPNIYQVI 323
            LL    PF+     T    I    +  P +   S+    +I  +L+ NP  RP+I +++
Sbjct: 272 ALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIM 331

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 117/245 (47%), Gaps = 29/245 (11%)

Query: 78  LKEGDLACLKRV-LVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEV 136
           +K G +  +K + L +D + + +++ E++ +  LK   NI +YY    S  +D S    +
Sbjct: 43  VKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYY---GSYLKDTS----L 95

Query: 137 LLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENV 196
            ++ME C   SL   +      K+ EK +  IM ++  A+  +H     +IHRDIK  NV
Sbjct: 96  WIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANV 150

Query: 197 LVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDE 256
           L+ +E N KLCDFG  +         Q +A          TP + APE+I     +  D 
Sbjct: 151 LITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDT 199

Query: 257 KSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSK-YDIPANNYSSKLINLIIIMLAE 311
           K DIW+LGI  Y++     P+     L     I+ SK   +   +YS+ L   I + L E
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 312 NPNLR 316
           +P  R
Sbjct: 260 DPKER 264

>Kwal_56.22476
          Length = 697

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 132/284 (46%), Gaps = 48/284 (16%)

Query: 50  YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQ 109
           +L EGGFA  + +K               K      + ++ +  E    +L +E+++ K 
Sbjct: 84  FLGEGGFARCFQIK-----------DDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKS 132

Query: 110 LKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIM 169
           ++++ NIVQ+ D              V +L+E+CPN SL+D + +R    L+E EV    
Sbjct: 133 MRHT-NIVQFVDCFED-------DTNVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFT 182

Query: 170 YDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLT 229
             +  AV  MH     +IHRD+K+ N+  D   N K+ DFG               A+L 
Sbjct: 183 TQIVGAVKYMH--SRRVIHRDLKLGNIFFDKHYNLKVGDFGLA-------------AVLA 227

Query: 230 NN----IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAI 285
           N+      V  TP Y APE++   +      + DIW+ G+ +Y LL    PF+   +  I
Sbjct: 228 NDRERKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNI 285

Query: 286 LHSK-----YDIPANNY-SSKLINLIIIMLAENPNLRPNIYQVI 323
           ++ +     +  P + + S + + LI  +L+ +P  RP++ ++I
Sbjct: 286 IYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEII 329

>Kwal_55.21545
          Length = 865

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 115/241 (47%), Gaps = 30/241 (12%)

Query: 85  CLKRVLVTD--ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMEL 142
           C  +VL  D  ++ + +++ E++ +  LK   NI  YY S  +  +       + ++ME 
Sbjct: 45  CAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHYYGSYLNDTK-------LWVIMEY 97

Query: 143 CPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN 202
           C   SL   +      K+ E+ +  IM ++  A+  MH     +IHRDIK  NVL+ ++ 
Sbjct: 98  CAGGSLRTLLR---PGKIGEQYIGVIMRELLTAL--MHIHKDGVIHRDIKAANVLITNDG 152

Query: 203 NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWA 262
           + KLCDFG  +         Q +A          TP + APE+I     +  D K DIW+
Sbjct: 153 HIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWS 201

Query: 263 LGIFLYKLLFYTTPF-ELTGQFAI-LHSKYDIP---ANNYSSKLINLIIIMLAENPNLRP 317
           LGI  Y++     P+ E+    A+ L +K   P      +SS L  +I + L E+P  RP
Sbjct: 202 LGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERP 261

Query: 318 N 318
           +
Sbjct: 262 S 262

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 110/233 (47%), Gaps = 41/233 (17%)

Query: 50  YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQ 109
           +L EGGFA  + +K  + S E+    +  K           +  E    +L +E+++ K 
Sbjct: 87  FLGEGGFARCFQIK--DDSGEIFAAKTVAKAS---------IKSEKTRKKLLSEIQIHKS 135

Query: 110 LKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIM 169
           + +  NIVQ+ D       D S    V +L+E+CPN SL++ + +R    L+E EV    
Sbjct: 136 MSHP-NIVQFIDCF----EDDS---NVYILLEICPNGSLMELLKRRKV--LTEPEVRFFT 185

Query: 170 YDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLT 229
             +  A+  MH     +IHRD+K+ N+  DS  N K+ DFG               A+L 
Sbjct: 186 TQICGAIKYMH--SRRVIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLA 230

Query: 230 N----NIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
           N       +  TP Y APE++ + +      + DIW+LG+ LY LL    PF+
Sbjct: 231 NESERKYTICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ 282

>Kwal_26.8751
          Length = 848

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 88/297 (29%), Positives = 137/297 (46%), Gaps = 65/297 (21%)

Query: 40  VGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVL-VTDENGLN 98
           VG++K  I+K + EG F  +Y+                     L   K VL +  +N  N
Sbjct: 34  VGNYK--ILKIVGEGSFGKVYLASHC-----------------LTHQKVVLKMGSKNDPN 74

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
            +R EV   +Q   S +I + Y+   +          V + +E CP K L +Y+   LA 
Sbjct: 75  VVR-EVFYHRQFDYS-HITKLYEVIVTENY-------VWMALEYCPGKELYEYL---LAK 122

Query: 159 K-LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
           K +  +E  ++   +  AV   H +    +HRD+K+EN+L+D + + KL DFG T  C  
Sbjct: 123 KHIPLEECSELFSQIVGAVYYAHSMK--CVHRDLKLENILLDKKGHAKLTDFGFTRECAT 180

Query: 218 --IMTTHQDIALLTNNIYVHTTPQYRAPEMIDL--YRCLPIDEKSDIWALGIFLYKLLFY 273
             I+ T            +  T  Y APE+I+   Y    I    D W+LGI LY ++  
Sbjct: 181 KGILET------------ICGTTVYMAPELIERKPYEGYKI----DTWSLGIILYTMIHG 224

Query: 274 TTPF----ELTGQFAILH--SKYDIPANNY-SSKLINLIIIMLAENPNLRPNIYQVI 323
           T PF    E+  ++ I+H    YD   N+Y  S    LI  +L ++PN RP++ QV+
Sbjct: 225 TMPFDEVDEVKTKYKIVHYNPTYD---NDYIDSNGKELISQLLEKDPNQRPSLTQVL 278

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 99/200 (49%), Gaps = 34/200 (17%)

Query: 135 EVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
           +V + +E CP K L D++  +  ++L   E  ++   +T AV   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 195 NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
           NVL+D   N KL DFG T      MT     A+L     V  T  Y APEMI   +  P 
Sbjct: 163 NVLLDKNGNAKLTDFGFTRES---MTK----AVLET---VCGTTVYMAPEMI---QHKPY 209

Query: 255 DE-KSDIWALGIFLYKLLFYTTPFE-----LTGQFAI-----LHSKYDIPANNYSSKLIN 303
           D  K DIW+LG+ LY LL    PF+     LT Q  I     +  +  IP      +  N
Sbjct: 210 DGFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIP------EAQN 263

Query: 304 LIIIMLAENPNLRPNIYQVI 323
           LI  +L+++P  RPN   ++
Sbjct: 264 LIEQLLSKDPTERPNTSAIL 283

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 107/232 (46%), Gaps = 28/232 (12%)

Query: 90  LVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLL 149
           L + E+ + +++ E++ +  LK   NI +YY S          G  + ++ME C   SL 
Sbjct: 49  LDSSEDEVEDVQREIQFLASLKQIPNITRYYGSYLR-------GTSLWIIMEYCAGGSLR 101

Query: 150 DYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
             +      K+ EK +  IM ++  A+  +H     +IHRDIK  NVL+ +E   KLCDF
Sbjct: 102 SLLR---PGKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAANVLITNEGQVKLCDF 156

Query: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269
           G  +         Q +A          TP + APE+I     +  D K DIW+LGI  Y+
Sbjct: 157 GVAAQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 205

Query: 270 LLFYTTPF----ELTGQFAILHSK-YDIPANNYSSKLINLIIIMLAENPNLR 316
           +     P+     L     I+ SK   +   NY+ +L   I + L E+P  R
Sbjct: 206 IATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQER 257

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 104/229 (45%), Gaps = 28/229 (12%)

Query: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153
           E+ + ++R E++ +  LK + NI  YY S     +       + ++ME C   SL   + 
Sbjct: 53  EDEVEDIRKEIQFLSSLKQTPNITHYYGSYLIDTK-------LWVIMEYCAGGSLRTLLR 105

Query: 154 QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS 213
             +   + EK +  IM ++  A+  +H     +IHRDIK  N+L+ +  + KLCDFG  +
Sbjct: 106 PGI---IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFGVAA 160

Query: 214 SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 273
                M   Q +A          TP + APE+I     +  D K DIW+LGI  Y++   
Sbjct: 161 QLSQSMLKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATG 209

Query: 274 TTPF----ELTGQFAILHSK-YDIPANNYSSKLINLIIIMLAENPNLRP 317
             P+     +     I  SK   +    YS  L   I + L E+P  RP
Sbjct: 210 NPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 113/233 (48%), Gaps = 30/233 (12%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           V +++E C    L +++ +    +LS +E  K+   +  AV   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLKE--QRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           VL+D   + KL DFG T      M T   +  +        T  Y APE+I+  +C    
Sbjct: 159 VLLDGNGHAKLTDFGFTRE----MATRSQLETICG------TTVYMAPELIE-RKCYD-G 206

Query: 256 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYDIPANNYSSKLINLIIIMLAE 311
            K DIW+LGI LY ++    PF    ++  +  I++ + D      S   I+LI  ML +
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRK 266

Query: 312 NPNLRPNIYQVI-------YQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKL 357
           NPN R ++ QV+       + V A  K D     K + G   F  +SK++++L
Sbjct: 267 NPNERISLAQVLSHPFLQPWGVVAKEKTDKVLL-KQRGGHVHF--HSKHEKRL 316

>Scas_580.6
          Length = 1015

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 113/232 (48%), Gaps = 28/232 (12%)

Query: 90  LVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLL 149
           L +DE+ + +++ EV+ +  LK   NI +YY    S  +D S    + ++ME C   SL 
Sbjct: 70  LDSDEDEVEDVQREVQFLSSLKQIPNITRYY---GSYLKDTS----LWIIMEYCAGGSLR 122

Query: 150 DYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
             +      K+ EK +  IM ++  A+  +H     +IHRDIK  NVL+ +E + KLCDF
Sbjct: 123 SLLR---PGKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDF 177

Query: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269
           G  +         Q +A          TP + APE+I     +  D K DIW+LGI  Y+
Sbjct: 178 GVAAQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 226

Query: 270 LLFYTTPF-ELTGQFAI-LHSKYDIP---ANNYSSKLINLIIIMLAENPNLR 316
           +     P+ E+    A+ L +K   P   + +Y+  L   I + L E+P  R
Sbjct: 227 IATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 89/339 (26%), Positives = 142/339 (41%), Gaps = 70/339 (20%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFS----NELETPSSSLKEGDLACLKRVLVTD 93
           I V   +  I + L EGG + +Y+V+  + S    N + TP       +L  LK+++   
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATP-------ELYALKKIICPS 75

Query: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPG-YEVLLLMELCPNKSLLDYM 152
              ++    E+E  K+ + S  +++  DS   + +DGS   Y VL    L    SL D +
Sbjct: 76  VESISNGMREIENYKRFQ-SPYVIKSIDSQVMQEKDGSKTIYIVLPYYSL---GSLQDSI 131

Query: 153 NQRL--ATKLSEKEVLKIMYDVTKAVAQMH-----------------------------F 181
           N+RL   T +SE E ++IM  VT+ +  +H                              
Sbjct: 132 NRRLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLL 191

Query: 182 LPTPL---------------IHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIA 226
             TPL                HRDI   N+L  S+    + D GS S     +     ++
Sbjct: 192 EDTPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLS 251

Query: 227 LLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQ---- 282
            L   +  + T  Y  PE+++L     +  K DIW+LG   Y L+F  +PFE   Q    
Sbjct: 252 ELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGA 311

Query: 283 ---FAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRP 317
              +AI   KY  P N+ +S  L+++I   +  +P  RP
Sbjct: 312 SLTYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 82.0 bits (201), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 148/314 (47%), Gaps = 57/314 (18%)

Query: 34  PGTLII---VGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVL 90
           PG++ I   +G  K +++K L EG F  + +   V          S+ ++  L  + + +
Sbjct: 27  PGSIPIGQRIG--KYQVIKTLGEGSFGKVKLAHHV----------STGQKVALKIINKKV 74

Query: 91  VTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLD 150
           +   +    +  E+  ++ L++  +I++ YD   S+        E+++++E   N+ L D
Sbjct: 75  LAKSDMQGRIEREISYLRLLRHP-HIIKLYDVIKSKD-------EIIMVIEYAGNE-LFD 125

Query: 151 YMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG 210
           Y+ QR   K+SE E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG
Sbjct: 126 YIVQR--DKMSENEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG 181

Query: 211 STSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMID--LYRCLPIDEKSDIWALGI 265
            ++             ++T+  ++ T   +P Y APE+I   LY    +    D+W+ G+
Sbjct: 182 LSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGV 224

Query: 266 FLYKLLFYTTPFE---LTGQFA-ILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQ 321
            LY +L    PF+   +   F  I +  Y IP    S    NLI  ML  NP  R  I++
Sbjct: 225 ILYVMLCRRLPFDDESIPVLFKNISNGVYSIP-KFLSQGAANLIKRMLIVNPLNRITIHE 283

Query: 322 VIYQVCAIMKVDVP 335
           ++       KVD+P
Sbjct: 284 IMED--EWFKVDLP 295

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 89/193 (46%), Gaps = 22/193 (11%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           V + +E CP   L DY+   L  ++   E  ++   +  AV   H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           +L+D      L DFG T  C          A  T    V  T  Y APE+I   R     
Sbjct: 159 ILLDKNGYAMLTDFGFTREC----------ATKTQLETVCGTTVYMAPELIK--REAYDG 206

Query: 256 EKSDIWALGIFLYKLLFYTTPFE-----LTGQFAILHSKYDIPANNYSSKLINLIIIMLA 310
            K D W+LGI LY +L    PF+      TG   I+H +  +     S +  +LI+ +L 
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTG-LKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 311 ENPNLRPNIYQVI 323
           +N   RPN+ +V+
Sbjct: 266 KNAAQRPNLNEVL 278

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 105/229 (45%), Gaps = 28/229 (12%)

Query: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153
           E+ + +++ E++ +  LK   NI +YY S     +       + ++ME C   SL   + 
Sbjct: 62  EDEVEDVQKEIQFLASLKQVPNITRYYGSYLYDTK-------LWVIMEYCAGGSLRTLLR 114

Query: 154 QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS 213
                K+ EK +  I+  +  A+  +H     +IHRDIK  NVL+ +E + KLCDFG  +
Sbjct: 115 ---PGKIDEKYLGVIVRKLLIALVYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVAA 169

Query: 214 SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 273
                    Q +A          TP + APE+I     +  + K+DIW+LGI  Y++   
Sbjct: 170 QLTAANHKRQTMA---------GTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATG 218

Query: 274 TTPF----ELTGQFAILHSK-YDIPANNYSSKLINLIIIMLAENPNLRP 317
             P+     L     I  SK   +   NYS  L   I + L E+P  RP
Sbjct: 219 NPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERP 267

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 104/236 (44%), Gaps = 41/236 (17%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTD---ENGLNELRN 102
           EI K L +G F  +Y V+ +E              G +  LK +   D    N   + R 
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIE-------------SGFVCALKAMEKKDIIQYNIEKQFRR 156

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EVE+   L++  N+ Q Y      +R       V LLME   N  L  ++  R  +  ++
Sbjct: 157 EVEIQSSLRHP-NLTQLYGYFHDEKR-------VYLLMEYLVNGELYKHLKGR--SHFND 206

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTH 222
                 +Y +  A+  MH     ++HRDIK EN+++   N  KL DFG  S   P  +  
Sbjct: 207 VVASYYVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG-WSVITPKGSKR 263

Query: 223 QDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
           + +           T  Y +PE+I   R    +EK D+WALG+  Y+LL  + PFE
Sbjct: 264 KTLC---------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFE 307

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 144/306 (47%), Gaps = 54/306 (17%)

Query: 41  GSH--KVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLN 98
           G H  K +I+K L EG F  + +   +          S+ ++  L  + + ++   +   
Sbjct: 29  GQHIGKYQIIKTLGEGSFGKVKLAYHI----------STGQKVALKIINKKVLAKSDMQG 78

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
            +  E+  ++ L++  +I++ YD   S+        E+++++E   N+ L DY+ QR   
Sbjct: 79  RIEREISYLRLLRHP-HIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--D 127

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
           K+ E+E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG ++     
Sbjct: 128 KMPEQEARRFFQQIISAVDYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN----- 180

Query: 219 MTTHQDIALLTNNIYVHT---TPQYRAPEMID--LYRCLPIDEKSDIWALGIFLYKLLFY 273
                   ++T+  ++ T   +P Y APE+I   LY    +    D+W+ G+ LY +L  
Sbjct: 181 --------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCR 228

Query: 274 TTPFE---LTGQFA-ILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAI 329
             PF+   +   F  I +  Y IP N  S    +LI  ML  NP  R  +++++      
Sbjct: 229 RLPFDDESIPVLFKNISNGVYTIP-NFLSQGAASLIKKMLIVNPVNRITVHEIMQD--EW 285

Query: 330 MKVDVP 335
            KVD+P
Sbjct: 286 FKVDLP 291

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 79.0 bits (193), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 148/313 (47%), Gaps = 54/313 (17%)

Query: 34  PGTLIIVGSH--KVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV 91
           P + +  G+H    +IVK L EG F  +          +L   +++ ++  L  + + ++
Sbjct: 42  PKSSLADGAHIGNYQIVKTLGEGSFGKV----------KLAYHTTTGQKVALKIINKKVL 91

Query: 92  TDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDY 151
              +    +  E+  ++ L++  +I++ YD   S+        E+++++E   N+ L DY
Sbjct: 92  AKSDMQGRIEREISYLRLLRHP-HIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDY 142

Query: 152 MNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGS 211
           + QR   K+SE+E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG 
Sbjct: 143 IVQR--DKMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGL 198

Query: 212 TSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMID--LYRCLPIDEKSDIWALGIF 266
           ++             ++T+  ++ T   +P Y APE+I   LY    +    D+W+ G+ 
Sbjct: 199 SN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVI 241

Query: 267 LYKLLFYTTPFE---LTGQFA-ILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQV 322
           LY +L    PF+   +   F  I +  Y +P    S     LI  ML  NP  R +I+++
Sbjct: 242 LYVMLCRRLPFDDESIPVLFKNISNGVYTLP-KFLSPGAAGLIKRMLIVNPLNRISIHEI 300

Query: 323 IYQVCAIMKVDVP 335
           +       KVD+P
Sbjct: 301 MQD--DWFKVDLP 311

>Kwal_47.18233
          Length = 598

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 134/289 (46%), Gaps = 50/289 (17%)

Query: 44  KVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNE 103
           K +I+K L EG F  + +   V    ++           L  + + ++   +    +  E
Sbjct: 30  KYQIIKTLGEGSFGKVKLAYHVTTGQKVA----------LKIINKKVLAKSDMQGRIERE 79

Query: 104 VEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEK 163
           +  ++ L++  +I++ YD   S+        E+++++E   N+ L DY+ QR   K+SE 
Sbjct: 80  ISYLRLLRHP-HIIKLYDVVKSKD-------EIVMVIEYAGNE-LFDYIVQR--DKMSEN 128

Query: 164 EVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQ 223
           E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG ++          
Sbjct: 129 EARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN---------- 176

Query: 224 DIALLTNNIYVHT---TPQYRAPEMID--LYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
              ++T+  ++ T   +P Y APE+I   LY    +    D+W+ G+ LY +L    PF+
Sbjct: 177 ---IMTDGNFLRTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFD 229

Query: 279 ---LTGQFA-ILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
              +   F  I +  Y +P    S    NLI  ML  NP  R  I++++
Sbjct: 230 DESIPVLFKNISNGIYTLP-KFLSPGAANLIKRMLIVNPLNRITIHEIM 277

>Kwal_33.13112
          Length = 505

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 88/190 (46%), Gaps = 24/190 (12%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + ++ME C   S  D +      +L E +V  I+ +V   +  +H      IHRD+K  N
Sbjct: 107 MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLH--SQRKIHRDVKAAN 164

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           +L+  E   KL DFG +          Q +A L  N +V  TP + APE+I   R    D
Sbjct: 165 ILLTDEGEVKLGDFGVSG---------QIMATLKRNTFV-GTPYWMAPEIIA--RDNGYD 212

Query: 256 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPA-------NNYSSKLINLIIIM 308
           EK+DIW+LGI   +LL    P+       +L    +IP          ++S   + I + 
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDPMKVL---MNIPLRKPPRLQGRFTSSARDFIALC 269

Query: 309 LAENPNLRPN 318
           L ++P LRP 
Sbjct: 270 LTKDPALRPT 279

>Scas_660.28
          Length = 623

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 115/245 (46%), Gaps = 47/245 (19%)

Query: 41  GSH--KVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLN 98
           GSH    +IVK L EG F  + +   +    ++           L  + + ++   +   
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVA----------LKIINKKVLAKSDMQG 89

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
            +  E+  ++ L++  +I++ YD   S+        E++++ME   N+ L DY+ QR   
Sbjct: 90  RIEREISYLRLLRHP-HIIKLYDVIKSKD-------EIIMVMEYAGNE-LFDYIVQR--D 138

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
           K+SE E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG ++     
Sbjct: 139 KMSEDEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN----- 191

Query: 219 MTTHQDIALLTNNIYVHT---TPQYRAPEMID--LYRCLPIDEKSDIWALGIFLYKLLFY 273
                   ++T+  ++ T   +P Y APE+I   LY    +    D+W+ G+ LY +L  
Sbjct: 192 --------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCR 239

Query: 274 TTPFE 278
             PF+
Sbjct: 240 RLPFD 244

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 105/219 (47%), Gaps = 36/219 (16%)

Query: 115 NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTK 174
           NIVQ+ D              V +L+E+CPN SL+D + +R    L+E EV      +  
Sbjct: 5   NIVQFIDCFEDDT-------NVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFTTQIVG 55

Query: 175 AVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNN--- 231
           A+  MH     +IHRD+K+ N+  DS  N K+ DFG               A+L N+   
Sbjct: 56  AIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANDRER 100

Query: 232 -IYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK- 289
              V  TP Y APE++         E  DIW++G+ +Y LL    PF+   +  I++ + 
Sbjct: 101 KYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERI 158

Query: 290 ----YDIPANNYSSKLINLIII-MLAENPNLRPNIYQVI 323
               Y  P    +SK + ++I  +L+ +P  RP++ +++
Sbjct: 159 KSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 197

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 143/301 (47%), Gaps = 54/301 (17%)

Query: 32  LAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV 91
           LA G+   VG++  +IVK L EG F  + +   V    ++           L  + + ++
Sbjct: 30  LADGSR--VGNY--QIVKTLGEGSFGKVKLAYHVTTGQKVA----------LKIINKKVL 75

Query: 92  TDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDY 151
              +    +  E+  ++ L++  +I++ YD   S+        E+++++E   N+ L DY
Sbjct: 76  AKSDMQGRIEREISYLRLLRHP-HIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDY 126

Query: 152 MNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGS 211
           + QR   K+SE+E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG 
Sbjct: 127 IVQR--NKMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGL 182

Query: 212 TSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMID--LYRCLPIDEKSDIWALGIF 266
           ++             ++T+  ++ T   +P Y APE+I   LY    +    D+W+ G+ 
Sbjct: 183 SN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVI 225

Query: 267 LYKLLFYTTPFE---LTGQFA-ILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQV 322
           LY +L    PF+   +   F  I +  Y +P    S    +LI  ML  NP  R +I+++
Sbjct: 226 LYVMLCRRLPFDDESIPVLFKNISNGVYTLP-KFLSPGASDLIKRMLIVNPLNRISIHEI 284

Query: 323 I 323
           +
Sbjct: 285 M 285

>Scas_707.36
          Length = 915

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 115/257 (44%), Gaps = 45/257 (17%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNEL---ETPSSSLKEGDLACLKRVLVTDENGLNELRN 102
           EIVK L  G    + + K +  +N+L   +  +   K+   A  KR      N  N+++ 
Sbjct: 94  EIVKELGNGQHGKVKLAKDIR-ANQLVAIKMVNRYEKKTYFAGPKR------NDPNKIKK 146

Query: 103 EVEVMKQLKNSD--NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDY------MNQ 154
           E+ +MK+  N     +++  D  +SR+        + L++E C    +L        ++ 
Sbjct: 147 EIAIMKKCNNKHVVKLIEILDDLSSRK--------IYLVLEYCEKGPILWCPRDQLEIDS 198

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214
           R   +LS +   +I  DV   +  +H     +IHRDIK  N+L+D     K+ DFG + +
Sbjct: 199 RGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDKNGVVKISDFGVSLA 256

Query: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--------------DLYRCLPIDEKSDI 260
               + T+ D   LT  +    TP + APE+               +L+    I  K DI
Sbjct: 257 ANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDI 313

Query: 261 WALGIFLYKLLFYTTPF 277
           WALGI LY LLF   PF
Sbjct: 314 WALGITLYCLLFGMLPF 330

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 92/196 (46%), Gaps = 25/196 (12%)

Query: 83  LACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMEL 142
           L  +++  +T  N   + R EVE+   L++  N+ Q Y      +R       V LLME 
Sbjct: 168 LKAMEKKEITQYNVQKQFRREVEIQASLRHP-NLTQLYGYFYDDKR-------VYLLMEY 219

Query: 143 CPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN 202
             N  L  Y + R+    ++      +  +  A+  MH     ++HRDIK EN+L+  +N
Sbjct: 220 LVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMH--DRNVLHRDIKPENILIGFQN 275

Query: 203 NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWA 262
             KL DFG +     I TT      L   +       Y +PE++  YR    DEK D+WA
Sbjct: 276 TLKLTDFGWSV----ISTTGAKRKTLCGTL------DYLSPELVK-YR--EYDEKVDVWA 322

Query: 263 LGIFLYKLLFYTTPFE 278
           LG+  Y+LL  T PFE
Sbjct: 323 LGVLAYELLVGTPPFE 338

>Kwal_26.7788
          Length = 1267

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 127/292 (43%), Gaps = 57/292 (19%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNEL----R 101
           ++ K L +G    + + K +E              G LA +K V  T  +    L     
Sbjct: 59  KLGKTLGKGSSGRVRLAKNME-------------TGKLAAIKIVPKTKSSRTGSLPYGIE 105

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
            E+ +MK L +  N++  Y+   ++        E+ L++E      L DY+  R   +L 
Sbjct: 106 REIIIMK-LISHPNVMGLYEVWENK-------LELFLVLEYVDGGELFDYLVSR--GRLP 155

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN-NFKLCDFGSTSSCFPIMT 220
           EKE +     + +  A  H     + HRD+K EN+L+D +N   K+ DFG          
Sbjct: 156 EKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIADFGMA-------- 205

Query: 221 THQDIALLTNNIYVHT---TPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFYTT 275
                AL T+N  + T   +P Y +PE++    Y   P    SD+W+ GI L+ LL    
Sbjct: 206 -----ALQTSNKLLETSCGSPHYASPEIVMGKNYNGGP----SDVWSCGIILFALLTGHL 256

Query: 276 PFELTGQFAIL----HSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
           PF       +L      KY +P  + SS   +LI  +L  +P+ R +I +++
Sbjct: 257 PFNDDNIKRLLLKVQAGKYQMP-QSVSSGAQDLISRILVVDPDKRISINEIL 307

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 128/283 (45%), Gaps = 39/283 (13%)

Query: 6   AAPTEPTSDVMTTRXXXXXXXPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFV 65
           A P +P    M+T          + KL   T+    S   ++++   +G    +Y+ +  
Sbjct: 514 AKPKKPARPTMSTAE-------IMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERT 566

Query: 66  EF---SNELETPSSSLKE---GDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQY 119
                SN +E  ++ + E   GD   +K+++++ +     + NE+ VMK  ++  NIV +
Sbjct: 567 HIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHK-NIVNF 625

Query: 120 YDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM-----NQRLATKLSEKEVLKIMYDVTK 174
            +  A  R D     ++ ++ME     SL D +     N    + L+E ++  I+ +  +
Sbjct: 626 LE--AYLRTDD----DLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQ 679

Query: 175 AVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYV 234
            +  +H     +IHRDIK +NVL+D+    K+ DFG    C  +       A +      
Sbjct: 680 GLKFLH--DKHIIHRDIKSDNVLLDTRARVKITDFG---FCARLTDKRSKRATMVG---- 730

Query: 235 HTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
             TP + APE++        DEK D+W+LGI   ++L    P+
Sbjct: 731 --TPYWMAPEVVKQRE---YDEKIDVWSLGIMTIEMLEGEPPY 768

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 92/192 (47%), Gaps = 15/192 (7%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           +  L+E  PN   L  M +R  T LSE+        +  A+  +H     +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM-KRFGT-LSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI-DLYRCLPI 254
           +L+D     KL DFG T+        ++   L T +     T +Y +PE++ D Y    +
Sbjct: 332 ILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY----V 386

Query: 255 DEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIPANNYSSKLINLIIIMLA 310
           D + DIWA G  L++++    PF+ T ++     ++  +Y   A  +   L +LI  +L 
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTA-GFPMILRDLIKQLLV 445

Query: 311 ENPNLRPNIYQV 322
           + P  R  I Q+
Sbjct: 446 KKPEQRLTILQI 457

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 108/235 (45%), Gaps = 39/235 (16%)

Query: 100 LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK 159
           +  E+ +MK L N  N+++ YD   +         ++ +++E      L + + QR    
Sbjct: 75  IEREIIIMKLL-NHPNVLRLYDVWET-------AQDLYMVLEYVEKGELFNLLVQR--GP 124

Query: 160 LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIM 219
           L E E ++    +   ++  H L   ++HRD+K EN+L+D + N KL DFG         
Sbjct: 125 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMA------- 175

Query: 220 TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFYTT 275
                 AL + +  + T   +P Y APE++     LP    +SD+W+ G+ LY LL    
Sbjct: 176 ------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRL 226

Query: 276 PF-ELTGQ-----FAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVI 323
           PF E  G        +   KY+IP  +  S +  +LI+ +L   P  R    +++
Sbjct: 227 PFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREIL 281

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 93/199 (46%), Gaps = 32/199 (16%)

Query: 135 EVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
           E+ L++E      L DY+  R   KL E+E +     + + V+  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 195 NVLVDSEN-NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMI--DL 248
           N+L+D +N   K+ DFG               AL T N  + T   +P Y +PE++    
Sbjct: 194 NLLLDKKNKTVKIADFGMA-------------ALETTNRLLETSCGSPHYASPEIVMGQK 240

Query: 249 YRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYDIPANNYSSKLINL 304
           Y   P    SD+W+ GI L+ LL    PF       +L    H +Y +P+ N S +  +L
Sbjct: 241 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS-NVSKEAKDL 295

Query: 305 IIIMLAENPNLRPNIYQVI 323
           I  +L  +P  R  + +++
Sbjct: 296 ISKILVVDPEKRITVDKIL 314

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 109/240 (45%), Gaps = 27/240 (11%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKE-----GDLACLKRVLVTDENGLNEL 100
           ++++   +G    +Y+ + ++     E    S  E     GD   +K+++++ +     +
Sbjct: 499 QMIEKAGQGASGSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELI 558

Query: 101 RNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKL 160
            NE+ VMK  ++  NIV + ++      D      + ++ME     SL D +   + +  
Sbjct: 559 VNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDVIENSIGSDA 611

Query: 161 SEKEVL--KIMYDVTKAVAQMHFLPTP-LIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
           SE  +   +I Y V +    + FL    +IHRDIK +NVL+D+    K+ DFG    C  
Sbjct: 612 SESPMTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFG---FCAK 668

Query: 218 IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
           +       A +        TP + APE++        DEK D+W+LGI   ++L    P+
Sbjct: 669 LTDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLEGEPPY 719

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 39/231 (16%)

Query: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL 148
            L TD+    ++  E++  K  K SD IV+YY               + + ME    +SL
Sbjct: 269 TLTTDQESQKQIFRELQFNKSCK-SDYIVRYYGMFTDEEHS-----SIYIAMEYMGGRSL 322

Query: 149 LDYMNQRL---ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205
            D + + L     ++ EK + KI   V + ++ +H     +IHRDIK +N+L++     K
Sbjct: 323 -DAIYKHLLKHGGRVGEKVLGKIAESVLRGLSYLH--QRKIIHRDIKPQNILLNEAGQVK 379

Query: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           LCDFG +      + T       T   Y      Y APE I   +  P    SD+W+LG+
Sbjct: 380 LCDFGVSGEAVNSLAT-----TFTGTSY------YMAPERI---QGQPYSVTSDVWSLGL 425

Query: 266 FLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLR 316
            L ++     PF+ +G+FA      ++P        I L++++L   P L+
Sbjct: 426 TLLEVAQAHFPFD-SGKFAA-----NMPP-------IELLMLILTFTPQLK 463

>Scas_685.24
          Length = 515

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 84/190 (44%), Gaps = 25/190 (13%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + ++ME C   S  D +       L EK+V  I  ++ K +  +H      IHRDIK  N
Sbjct: 93  MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAAN 150

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEM----IDLYRC 251
           +L+  E + KL DFG +      +     +           TP + APE+    I+ Y  
Sbjct: 151 ILLTEEGHVKLGDFGVSGQLKSTLRRGTIVG----------TPYWMAPEVASQNIEGY-- 198

Query: 252 LPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAILH--SKYDIP--ANNYSSKLINLIII 307
              DEK DIW+LGI +++LL    P        +L   S+   P     YS    + + +
Sbjct: 199 ---DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVAL 255

Query: 308 MLAENPNLRP 317
            L +NPN RP
Sbjct: 256 CLIKNPNERP 265

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 113/239 (47%), Gaps = 31/239 (12%)

Query: 47  IVKYLAEGGFAHIYVVKFVE---FSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNE 103
           +V+   +G    +Y+ + ++   + +ELE   + L  G+   +K+++++ +     + NE
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQL--GNKVAIKQMILSKQPRKELIVNE 647

Query: 104 VEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA-----T 158
           + VMK  K+ +NIV + ++      D      + ++ME     SL D +          +
Sbjct: 648 ILVMKDSKH-NNIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPTGSSGQS 700

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
            L+E ++  I+ +  + +  +H     +IHRDIK +NVL+D+    K+ DFG    C  +
Sbjct: 701 PLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRGRVKITDFG---FCAKL 755

Query: 219 MTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
                  A +        TP + APE++        DEK D+W+LGI   ++L    P+
Sbjct: 756 TDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 805

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 74/139 (53%), Gaps = 19/139 (13%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + ++ME C   S  D + +     L E++V  I+++VT  +  +H      IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAAN 146

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           +L++ E   KL DFG +     I +T      L  + +V  TP + APE++    C  +D
Sbjct: 147 ILLNEEGMVKLGDFGVSGH---IRST------LKRDTFVG-TPYWMAPEVV----CCEVD 192

Query: 256 ---EKSDIWALGIFLYKLL 271
              EK+DIW+LGI  Y+LL
Sbjct: 193 GYNEKADIWSLGITTYELL 211

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 121/258 (46%), Gaps = 37/258 (14%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           E   +++LKN+  I+  Y +     +D S  Y    L+E  PN  LL  M  R    ++E
Sbjct: 203 EKNTLQRLKNTKGIISLYFT----FQDESSLY---FLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTH 222
           K        +  A+  MH     +IHRD+K EN+L+D +   KL DFG+        T+ 
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTAR--LLDSTSE 309

Query: 223 QDIA--LLTNNIYVHTTPQYRAPEMI-DLYRCLPIDEKSDIWALGIFLYKLLFYTTPFEL 279
            D+   LLT +     T +Y +PE++ D Y    +D + DIWA G  L++++    PF+ 
Sbjct: 310 DDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPPFKA 365

Query: 280 TGQF----AILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQV-IYQVCAIMKVDV 334
             ++     ++  ++   A  +   + +L+  +L +NP  R  I Q+  +Q  A    DV
Sbjct: 366 NNEYLTFQKVMKVQFAFTA-GFPMTVRDLVKNILIKNPERRLLINQIKAHQFFA----DV 420

Query: 335 PF-------EDKYQTGPY 345
            F       +D  + GPY
Sbjct: 421 NFGNGSVWDKDPPELGPY 438

>Kwal_23.6325
          Length = 1542

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 123/279 (44%), Gaps = 33/279 (11%)

Query: 77   SLKEGDLACLKRVLVTDENGLNE----LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSP 132
            +L  G++  +K + + D   + +    ++ E+ V++ L N  N+VQYY     R +    
Sbjct: 1268 NLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEML-NHPNVVQYYGVEVHRDK---- 1322

Query: 133  GYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIK 192
               V L ME C   SL     Q L     E E++  +Y +       +   + ++HRDIK
Sbjct: 1323 ---VNLFMEYCEGGSLA----QLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIK 1375

Query: 193  IENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMIDLY 249
             EN+L+D     K  DFG+  S     T   ++        V++   TP Y +PE I   
Sbjct: 1376 PENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESITGA 1435

Query: 250  RCLPIDEKSDIWALGIFLYKLLFYTTP-FELTGQFAILHSKYDIPANN---------YSS 299
            +        DIW+LG  + +++    P F L  ++AI+   Y + A +          S 
Sbjct: 1436 KKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIM---YHVAAGHVPQLPTKEELSP 1491

Query: 300  KLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFED 338
            + I+ ++  L ++PN R    +++     I   ++ F++
Sbjct: 1492 QGIDFLLRCLKQDPNKRSTAMELLLHPWMIEIRELAFDN 1530

>Kwal_56.23717
          Length = 858

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q     L E+   K    +  A+  +H     ++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHM--NNIVHRDLKIENIM 65

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           + +    K+ DFG ++   P    H        ++Y      + APE+  L  C     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPKKQLH----TFCGSLY------FAAPEL--LKACPYTGPE 113

Query: 258 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNY----SSKLINLIIIMLAENP 313
            D+W+ G+ L+ L+    PF+     ++LH K       Y    S ++I+L+  ML  +P
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDP 172

Query: 314 NLRPNIYQVI 323
             R ++ QV+
Sbjct: 173 TKRASLKQVV 182

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 135/308 (43%), Gaps = 38/308 (12%)

Query: 39  IVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLN 98
           ++   + ++++ + +G F  +Y+  ++  SN+  T     K   LA     L      ++
Sbjct: 1   MLSLQQFQLLECVGKGNFGDVYLAHYLG-SNQEPTDPKIPKNVPLAIKCINLEHSNEPID 59

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
            L  E+  +  L +   I  YY +             + ++ME C N SLL+ +  R  +
Sbjct: 60  LLLKEIYFLSTL-HCPYITHYYGTFTG-------DCNLYIVMEYCSNGSLLNLL--RYYS 109

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
           +L+E+    I+  V  A+  +H     LIHRD+K  N+L++ +   +L D G T      
Sbjct: 110 RLTEQTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFN 167

Query: 219 MTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF- 277
            T H    L   N +V  TP + APE+I   +    D K DIW+LGI   +LL    P  
Sbjct: 168 STRHGGKNL---NTFV-GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPMS 220

Query: 278 ELTGQFAILHSKYDIPANNYSSKLINL---------IIIMLAENPNLRPNIYQVI----Y 324
            L    A++     IP  N  S L N+         I   L ++PN RP   Q++     
Sbjct: 221 HLDSMKALMR----IPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQHKWL 276

Query: 325 QVCAIMKV 332
           + C+I  +
Sbjct: 277 KKCSITNI 284

>Scas_598.6
          Length = 790

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 34/240 (14%)

Query: 46  EIVKYLAEGGFAHIYVVKFV-----EFSNELETPSSSLKEGDLACLKRVLVTDENGLNEL 100
           ++++   +G    +Y+ + +     EF    ETP    + GD   +K+++++ +     +
Sbjct: 503 QMIEKAGQGASGSVYLAERIAIPPGEFD---ETP----EVGDKVAIKQMILSKQPRKELI 555

Query: 101 RNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKL 160
            NE+ VMK  ++  NIV + ++      D      + ++ME     SL D +    AT  
Sbjct: 556 VNEILVMKDSRHK-NIVNFLEAYLKTEDD------LWVVMEFMEGGSLTDIIENSPATGS 608

Query: 161 SEKEVL--KIMYDVTKAVAQMHFLPTP-LIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
           S   +   +I Y V +    + FL    +IHRDIK +NVL+D+    K+ DFG    C  
Sbjct: 609 SSSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFG---FCAK 665

Query: 218 IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
           +       A +        TP + APE++        DEK D+W+LGI   ++L    P+
Sbjct: 666 LTDQRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 716

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 88/202 (43%), Gaps = 21/202 (10%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q     L E+   K    +  A+  +H     ++HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLHL--NNIVHRDLKIENIM 212

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           + S    ++ DFG ++   P    H        ++Y      + APE++  +       +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDPKKQLH----TFCGSLY------FAAPELLKAHPY--TGPE 260

Query: 258 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKL----INLIIIMLAENP 313
            DIW+ G+ LY L+    PF+     ++LH K       Y   L    I+L+  ML  +P
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVVDP 319

Query: 314 NLRPNIYQVIYQVCAIMKVDVP 335
             R  + QV++        D P
Sbjct: 320 YKRATLKQVVHHQWMQKGYDFP 341

>Scas_458.1
          Length = 367

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 146/350 (41%), Gaps = 67/350 (19%)

Query: 32  LAPGT--LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRV 89
           L+ GT  +I + +   +I K L +   ++ Y+V+ ++     E P    + G L  LKR+
Sbjct: 15  LSSGTNSIISINARDYKIEKLLQDENLSYSYLVRTLDS----EPP---FENGPLFVLKRI 67

Query: 90  LV--TDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKS 147
                D   ++   NE+   K+   + +I+   D    ++ DGS   +VL         S
Sbjct: 68  YCPFGDIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSKQIDVLF--PFYHYGS 125

Query: 148 LLDYMNQRL-------ATKLSEKEVLKIMYDVTKAVAQMH------------------FL 182
           + D +N+ L        T + EK+ +KIM  + + +  +H                    
Sbjct: 126 VQDDINRHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSE 185

Query: 183 PTPLIHRDIKIEN--------------------VLVDSENNFKLCDFGSTSSCFPIMTTH 222
             PL+  D+ +E                     +L+  + N  + D  S       ++T 
Sbjct: 186 NAPLLLNDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTE 245

Query: 223 QDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE---- 278
             +      I  H T Q+ APE++ L     I  K DIW+LG  LY ++F  +PFE    
Sbjct: 246 IQLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQ 305

Query: 279 LTG---QFAILHSKYDIP--ANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
           L G   ++ I   KY IP     YS ++I+++   L  +P+ RP++  ++
Sbjct: 306 LNGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGIL 355

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 96/237 (40%), Gaps = 43/237 (18%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVL----VTDENGLNELR 101
           EI K L +G F  +Y VK               +E  L C  + +    +       + R
Sbjct: 101 EIGKILGKGKFGKVYCVKH--------------RETGLICALKAMEKKEIVQYTIQKQFR 146

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
            EVE+    K+  N+ Q Y      +R       V LLME      L  ++       L+
Sbjct: 147 REVEIQGSFKHK-NLTQLYGFFYDEKR-------VYLLMEYVYYGELYKFLKNN--GPLN 196

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E      +Y +  A+  MH     ++HRDIK EN+L+   N  KL DFG +         
Sbjct: 197 ETLASYFVYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFGWSV----YNED 250

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
            Q    L   I       Y +PE+I   +    + K D+WALG+  Y+LL  + PFE
Sbjct: 251 GQKRKTLCGTI------DYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFE 298

>Kwal_56.22693
          Length = 984

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 92/190 (48%), Gaps = 15/190 (7%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
            L+E  PN   L  + +     LS++  +     +  A+  +H     ++HRDIK EN+L
Sbjct: 234 FLLEYAPNGDFLSVIKK--FGSLSQECAVYYSAQILDAIDYLHH--KGIVHRDIKPENIL 289

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI-DLYRCLPIDE 256
           +D +   KL DFG T+       T Q   LL  +     T +Y +PE++ D Y    +D 
Sbjct: 290 LDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----VDY 344

Query: 257 KSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIPANNYSSKLINLIIIMLAEN 312
           K DIWA G  L++++    PF+ T ++     ++  +Y   A  +   + +LI  +L ++
Sbjct: 345 KCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPLVIRDLIKKILVKS 403

Query: 313 PNLRPNIYQV 322
           P  R +  Q+
Sbjct: 404 PEQRLDASQI 413

>Kwal_56.24091
          Length = 381

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 89/196 (45%), Gaps = 25/196 (12%)

Query: 83  LACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMEL 142
           L  +K+  +   N   + R EVE+   LK+  N+ + Y      +R       V LLME 
Sbjct: 151 LKAMKKSEIVQYNVQKQFRREVEIQSSLKHP-NLTRLYGYFHDEKR-------VYLLMEY 202

Query: 143 CPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN 202
             N  L  Y + R     ++      ++ +  A+  MH     ++HRDIK EN+L+  +N
Sbjct: 203 LVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENILLGFQN 258

Query: 203 NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWA 262
             KL DFG + S    +   +   L         T  Y +PE+I   +    D K D+WA
Sbjct: 259 TLKLTDFGWSVSN---VGNSKRKTLC-------GTMDYLSPELI---KSREYDNKVDVWA 305

Query: 263 LGIFLYKLLFYTTPFE 278
           LG+  Y+LL  + PFE
Sbjct: 306 LGVLTYELLVGSPPFE 321

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 111/235 (47%), Gaps = 39/235 (16%)

Query: 100 LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK 159
           +  E+ +MK L N  N+++ YD   + +       ++ +++E      L + + +R    
Sbjct: 73  IEREIIIMKLL-NHPNVLRLYDVWETSK-------DLYMVLEYVEKGELFNLLVER--GP 122

Query: 160 LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIM 219
           L E E ++    +   ++  H L   ++HRD+K EN+L+D + N KL DFG         
Sbjct: 123 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMA------- 173

Query: 220 TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFYTT 275
                 AL + +  + T   +P Y APE++     LP    +SD+W+ G+ LY LL    
Sbjct: 174 ------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRL 224

Query: 276 PF-ELTGQ-----FAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVI 323
           PF E  G        +   K+++P ++  SS+  +LI  +L  +P  R    +++
Sbjct: 225 PFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL 279

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 85/328 (25%), Positives = 133/328 (40%), Gaps = 59/328 (17%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE--- 94
           I+VG    E ++ L +G    +++V+               K   +  LK VL  DE   
Sbjct: 489 IMVGPQSFEKIRLLGQGDVGKVFLVR-------------EKKTNRVYALK-VLSKDEMIK 534

Query: 95  -NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153
            N +  +  E E++    N   IV  Y S  S          + L ME C        + 
Sbjct: 535 RNKIKRVLTEQEILA-TSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFFRALQ 586

Query: 154 QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG--- 210
            R    + E +      +VT A+  +H L    I+RD+K EN+L+    +  L DF    
Sbjct: 587 TRKTKCICEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLSI 644

Query: 211 -STSSCFPIM-----TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDEKSDIW 261
            +  S  P++     +T  D  + ++    ++   T +Y APE+I   R        D W
Sbjct: 645 QAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWW 701

Query: 262 ALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYDIPANNYSSKLI-NLIIIMLAENPNLR 316
            LGI +Y++LF  TPF+       F  IL ++   P NN  S+   +LI  +L +N + R
Sbjct: 702 TLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNESKR 761

Query: 317 PNIYQVIYQVCAIMKVDV---PFEDKYQ 341
                     C +   DV   PF  K Q
Sbjct: 762 LG--------CKMGAADVKKHPFFKKVQ 781

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 84/190 (44%), Gaps = 40/190 (21%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EV++  ++    NI + YD            ++  ++ME C    L + +   +  + + 
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKT- 163

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTH 222
           K V  I+  +  AV  +H     + HRDIK EN+L+    N KL D+G       + TT 
Sbjct: 164 KNVTNIINQILDAVEYVH--SRGIYHRDIKPENILIAGNWNIKLTDWG-------LATT- 213

Query: 223 QDIALLTNNIYVHTTPQYRAPEMI----------DLYRCLPIDEKSDIWALGIFLYKLLF 272
            D   +  N+    + +Y APE+           D Y C     K DIWA+GI +  ++F
Sbjct: 214 -DKTSMERNV---GSERYMAPELFESNLDREERTDAYDCA----KVDIWAIGIVMLNIVF 265

Query: 273 YTTPFELTGQ 282
           +  PF +  Q
Sbjct: 266 HKNPFTVANQ 275

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 103/237 (43%), Gaps = 43/237 (18%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE----NGLNELR 101
           E+ + L +G F  +Y V+               K+    C  + +  +E    N L +L+
Sbjct: 101 EVGRKLGKGKFGKVYCVRH--------------KKSGFICALKAIEKNEILQFNLLKQLK 146

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
            EV++   + +  NI++ Y      +R       V LLME   N  L  Y + +     +
Sbjct: 147 REVDIQLGM-DHPNIIKLYAHFHDEKR-------VYLLMEHSINGEL--YKSLKNNGPFN 196

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           +      +Y +  A+  MH     +IHRD+K ENVL+  +N  KL DFG  S   P  + 
Sbjct: 197 DVLASHYIYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG-WSILNPEGSK 253

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
            + +           T  Y +PEMI        DE+ D+WALG+  Y+L+    PFE
Sbjct: 254 RKTLC---------GTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFE 298

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 21/202 (10%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q  +  L E    K    V  A+  +H     ++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQHGS--LREHHARKFARGVASALQYLH--ANNIVHRDLKIENIM 264

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           + +    K+ DFG ++    +  T + +     ++Y      + APE++  +       +
Sbjct: 265 ISNSGEIKIIDFGLSN----VYDTRKQLHTFCGSLY------FAAPELLKAHPY--TGPE 312

Query: 258 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNY----SSKLINLIIIMLAENP 313
            D+W+ G+ LY L+    PF+     ++LH K       Y    S ++++L+  ML  +P
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYPQHLSIEVMSLLSKMLVVDP 371

Query: 314 NLRPNIYQVIYQVCAIMKVDVP 335
           + R ++ QV+         D P
Sbjct: 372 SRRASLKQVVEHPWMTKGYDTP 393

>Scas_564.7
          Length = 1210

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 94/203 (46%), Gaps = 23/203 (11%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q  +  L E    K    +  A+  +H     ++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEYIHA--NNIVHRDLKIENIM 318

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           + +    K+ DFG ++    +    + +     ++Y      + APE++  +       +
Sbjct: 319 ISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 258 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYDIPANNYSSKLINLIIIMLAEN 312
            D+W+ G+ LY L+    PF+     ++LH      K D P N+ S ++I+L+  ML  +
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYP-NHLSIEVISLLSKMLVVD 424

Query: 313 PNLRPNIYQVIYQVCAIMKVDVP 335
           P  R ++ QV+         D P
Sbjct: 425 PLRRASLKQVVEHPWMTRGYDYP 447

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 87/187 (46%), Gaps = 24/187 (12%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           E   +++L NS ++V+ +    S  +D S  Y    L+E  PN   L  M +  +  L E
Sbjct: 227 EKTALQKLNNSPSVVRLF----STFQDESSLY---FLLEYAPNGDFLSLMKKYGS--LDE 277

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI--MT 220
                    +  A+  +H     +IHRDIK EN+L+D E   KL DFG+     P     
Sbjct: 278 TCARYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSV 335

Query: 221 THQDIALLTNNIYVHTTPQYRAPEMID----LYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
           +  +  L T +     T +Y +PE+++     YRC       DIWA G  L++++    P
Sbjct: 336 SKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRC-------DIWAFGCILFQMIAGKPP 388

Query: 277 FELTGQF 283
           F+ T ++
Sbjct: 389 FKATNEY 395

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 123/302 (40%), Gaps = 41/302 (13%)

Query: 50   YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNE----LRNEVE 105
            ++  G F  +Y              + +L  GD+  +K +   D   + +    +R+E+ 
Sbjct: 1196 FIGGGSFGSVY-------------SAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMT 1242

Query: 106  VMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEV 165
            V++ L N  N+VQYY     R R       V + ME C   SL       LA    E E+
Sbjct: 1243 VLEML-NHPNVVQYYGVEVHRDR-------VNIFMEYCEGGSLASL----LAHGRIEDEM 1290

Query: 166  LKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDI 225
            +  +Y +       +   + + HRDIK EN+L+D     K  DFG+        +   ++
Sbjct: 1291 VTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNL 1350

Query: 226  ALLTNNIYVHTTPQYRAPEMID--LYRCLPIDEKSDIWALGIFLYKLLFYTTPF-ELTGQ 282
                    +  TP Y +PE I    Y     D   DIW+LG  + +++    P+  L  Q
Sbjct: 1351 EQHMEGEKMIGTPMYMSPEAISGTGYGKFGSD---DIWSLGCVILEMVTGRRPWANLDNQ 1407

Query: 283  FAILH--SKYDIPA----NNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPF 336
            +AI++  +   IP     N  S   I  +   L ++PN R    +++     I    + F
Sbjct: 1408 WAIIYQVAAGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELLMDPWIIEIRTIAF 1467

Query: 337  ED 338
             D
Sbjct: 1468 GD 1469

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 124/279 (44%), Gaps = 34/279 (12%)

Query: 71  LETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDG 130
           L T   S K+  +  L +  +  +  +  +  E   +++L NS  IV+ + +     +D 
Sbjct: 198 LATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFT----FQDE 253

Query: 131 SPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRD 190
           S  Y    L+E  PN   L  M +  +  LSE         +   +  +H     +IHRD
Sbjct: 254 SSLY---FLLEYAPNGDFLSVMKKYGS--LSEDCTRYYSAQIIDGIKYLH--SKGIIHRD 306

Query: 191 IKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQ--DIALLTNNIYVHTTPQYRAPEMI-D 247
           IK EN+L+D +   K+ DFG+     P        +  LLT +     T +Y +PE++ D
Sbjct: 307 IKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLND 366

Query: 248 LYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIPANNYSSKLIN 303
            Y    +D + DIWA G  +++++    PF+ T ++     ++  +Y   A  +   + +
Sbjct: 367 SY----VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPVVVRD 421

Query: 304 LIIIMLAENPNLRPNIYQV----IYQVCAIMKVDVPFED 338
           L+  +L + P  R  I Q+     Y+       D+ FED
Sbjct: 422 LVKRILLKVPEQRLTIPQIEKHHFYK-------DISFED 453

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 87/176 (49%), Gaps = 25/176 (14%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VM++ K+S NIV + DS  ++        ++ ++ME     SL D +   L   LS
Sbjct: 664 NEILVMRESKHS-NIVNFIDSYLAK-------GDLWIVMEYMEGGSLTDVVTHCL---LS 712

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E ++  +  +  K +  +H     ++HRDIK +N+L+  + N KL DFG     F     
Sbjct: 713 EGQIGAVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFG-----FCAQIN 765

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
             ++   T    +  TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 766 ENNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>Scas_633.29
          Length = 789

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 132/318 (41%), Gaps = 60/318 (18%)

Query: 31  KLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVL 90
           KLA    I V   + E ++ L  GG + +Y VK                +  +  LKRV 
Sbjct: 286 KLAKRNTITVNDTEYEKIELLGRGGSSRVYKVKN--------------SQNKVFALKRVS 331

Query: 91  VT--DENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL 148
               D++ ++  + E+E++++L N   +V+ +D              VL L+  C +  L
Sbjct: 332 FDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDS--------GVLFLIMECGDHDL 383

Query: 149 LDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCD 208
              ++QR    L    V     +V + +  +H     ++H D+K  N  V  +   K+ D
Sbjct: 384 SQILSQRSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVFVKGILKIID 440

Query: 209 FGSTSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMI---------DLYRCLPIDE 256
           FG  ++  P  T          NIY      TP Y APE +         D      + +
Sbjct: 441 FG-IANAIPDHTV---------NIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGK 490

Query: 257 KSDIWALGIFLYKLLFYTTPFE-LTGQ---FAILHSKYDI-----PANNYS--SKLINLI 305
            SDIW+ G  +Y++++   P+    GQ    AI++    +      ANN S    LI+L+
Sbjct: 491 PSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLM 550

Query: 306 IIMLAENPNLRPNIYQVI 323
              L  +P  R ++ QV+
Sbjct: 551 KGCLTRDPEKRWSVDQVL 568

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 87/177 (49%), Gaps = 27/177 (15%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VMK  ++ +NIV + DS   +        ++ ++ME     SL D +   +   L+
Sbjct: 727 NEILVMKGSRH-NNIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 162 EKEVLKIMYDVTKAVAQMHFLPT-PLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMT 220
           E ++  +  +  +    +HFL +  +IHRDIK +N+L+  + N KL DFG    C  I  
Sbjct: 776 EGQIAAVSRETLRG---LHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFG---FCAQINE 829

Query: 221 THQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
           T+     +        TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 830 TNLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 138/284 (48%), Gaps = 39/284 (13%)

Query: 83  LACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMEL 142
           +  +K V+  ++  LN++  E+ ++K L N +NIV+Y+      R+     YE+ +L+E 
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKYH---GFIRK----SYELYILLEY 101

Query: 143 CPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN 202
           C N SL   ++ R +T LSE E    +      +  +H     +IHRDIK  N+L+ ++N
Sbjct: 102 CANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLH--GEGVIHRDIKAANILLSADN 158

Query: 203 NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWA 262
             KL DFG        ++T  + + LT    +  T  + APE++       +   SDIW+
Sbjct: 159 TVKLADFG--------VSTIVNSSALT----LAGTLNWMAPEILGNRGASTL---SDIWS 203

Query: 263 LGIFLYKLLFYTTPFE-LTGQ---FAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPN 318
           LG  + ++L    P+  LT     +A+ +  Y  P +++S  L + +     +N   RP 
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTY-YPPSSFSEPLKDFLSKCFVKNMYKRPT 262

Query: 319 IYQVIYQVCA----IMKVDV--PFEDKYQTGPYDFDKYSKYQEK 356
             Q++  V       +KVD    F++ +    Y +D  + +QE+
Sbjct: 263 ADQLLKHVWINSTENVKVDKLNKFKEDFTDADYHWD--ADFQEE 304

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 114/251 (45%), Gaps = 39/251 (15%)

Query: 50   YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNEL----RNEVE 105
            ++  G F  +Y              + +L+ G++  +K + + D   + ++    + E+ 
Sbjct: 1039 FIGGGTFGQVY-------------SAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMT 1085

Query: 106  VMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEV 165
            V++ L N  NIVQYY     R +       V + ME C   SL   ++     ++ ++ V
Sbjct: 1086 VLEML-NHPNIVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLDH---GRIEDEMV 1134

Query: 166  LKI-MYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMT---- 220
             ++  +++ + +A +H   + ++HRDIK EN+L+D     K  DFG+  +     T    
Sbjct: 1135 TQVYTFELLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVR 1192

Query: 221  --THQDIALLTNNIY-VHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
                QD  + T ++  +  TP Y APE I            D+WALG  + ++     P+
Sbjct: 1193 NAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPW 1252

Query: 278  -ELTGQFAILH 287
              L  ++AI++
Sbjct: 1253 SNLDNEWAIMY 1263

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 90/195 (46%), Gaps = 27/195 (13%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
            +M+L P   LL  + ++     SE      M  +   V  +H +   +IHRD+K ENVL
Sbjct: 88  FVMDLAPGGELLQLLRRQRV--FSEAWARHYMCQLVDTVEYIHSMG--VIHRDLKPENVL 143

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           +D E    + DFG+  +              T+ +    T +Y +PE++       ++ K
Sbjct: 144 LDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFV---GTAEYVSPELL-------LENK 193

Query: 258 ----SDIWALGIFLYKLLFYTTPF------ELTGQFAILHSKYDIPANNYSSKLINLIII 307
               SD+WALG  LY+ L  T PF      E   Q   L   + IPAN  ++ L++ I++
Sbjct: 194 SYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLVSKILV 253

Query: 308 MLAENPNLRPNIYQV 322
           +   +P+ R  + Q+
Sbjct: 254 L---DPSQRYTLEQI 265

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 94/198 (47%), Gaps = 24/198 (12%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           +  L+E  PN   L  + ++  T L+E+  +     +  A+  MH     +IHRDIK EN
Sbjct: 193 LYFLLEYAPNGDFLSLI-KKFGT-LNEECTIYYSAQIIDAIGSMH--SHGIIHRDIKPEN 248

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQD------IALLTNNIYVHTTPQYRAPEMI-DL 248
           +L+D     KL DFG+      ++    D        LLT +     T +Y +PE++ D 
Sbjct: 249 ILLDGNMKIKLTDFGTAK----LLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDN 304

Query: 249 YRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIPANNYSSKLINL 304
           Y     D K DIWA G  +Y+++    PF+ T ++     ++  ++   A  + + + +L
Sbjct: 305 Y----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTA-GFPTIIRDL 359

Query: 305 IIIMLAENPNLRPNIYQV 322
           +  +L + P  R  I Q+
Sbjct: 360 VKNILVKQPEKRLTIPQI 377

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 109/251 (43%), Gaps = 44/251 (17%)

Query: 50   YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNE----LRNEVE 105
            ++  G F  +Y              + +L  GD+  +K + + D   + +    L+ E+ 
Sbjct: 1264 FIGSGSFGTVY-------------SAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMR 1310

Query: 106  VMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ-RLATKLSEKE 164
            VM+ L N  NIVQYY     R +       V + ME C   SL   +   R+     E E
Sbjct: 1311 VMEIL-NHPNIVQYYGVEVHRDK-------VNIFMEFCEGSSLASLLEHGRI-----EDE 1357

Query: 165  VLKIMY--DVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTH 222
            ++  +Y   + + +A +H   + ++HRDIK EN+L+D     K  DFG+           
Sbjct: 1358 MVTQVYTLQLLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAK--LIAKNGS 1413

Query: 223  QDIALLTNNIYVH-----TTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
            + I+L  NN          TP Y APE +            DIW+LG  + +++    P+
Sbjct: 1414 KRISLDANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGS-DDIWSLGCVVLEMVTGRRPW 1472

Query: 278  -ELTGQFAILH 287
              L  ++AI++
Sbjct: 1473 ANLDNEWAIMY 1483

>Scas_502.2
          Length = 1116

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 102/214 (47%), Gaps = 17/214 (7%)

Query: 71  LETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDG 130
           L T + S K+  +  L +  +  +  +  +  E   +++L NS +I++ + +     +D 
Sbjct: 190 LATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSRSIIRLFFT----FQDE 245

Query: 131 SPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRD 190
           +  Y    L+E  PN  LL  M +     L+E+        +  A+  MH     +IHRD
Sbjct: 246 ASLY---FLLEYAPNGDLLSLMKK--FGSLNEECCCYYGAQIIDAIKFMH--SKGIIHRD 298

Query: 191 IKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI-DLY 249
           IK EN+L+D +   K+ DFG T+             LLT +     T +Y +PE++ D Y
Sbjct: 299 IKPENILLDKDMKVKITDFG-TAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPELLNDNY 357

Query: 250 RCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQF 283
                D +SDIWA G  +++++    PF+ T ++
Sbjct: 358 ----TDARSDIWAFGCIVFQMIAGKPPFKATNEY 387

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 87/191 (45%), Gaps = 23/191 (12%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q     L E    K    +  A+  +H     ++HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQH--GSLKEHHARKFARGIASALQYLHA--NNIVHRDLKIENIM 255

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLP-IDE 256
           + S    K+ DFG ++    I    + +     ++Y      + APE++   +  P    
Sbjct: 256 ISSSGEIKIIDFGLSN----IFDYRKQLHTFCGSLY------FAAPELL---KAQPYTGP 302

Query: 257 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKL----INLIIIMLAEN 312
           + DIW+ GI LY L+    PF+     +ILH K      +Y S L    I+L+  M+  +
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVD 361

Query: 313 PNLRPNIYQVI 323
           P  R  +  V+
Sbjct: 362 PLRRATLKNVV 372

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 89/202 (44%), Gaps = 21/202 (10%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +  E      LLDY+ Q  +  L E    K+   +  A+  +H     ++HRD+KIEN++
Sbjct: 168 MFFEFISGGQLLDYIIQHGS--LKENHARKVSRGILSALQYLH--ANNIVHRDLKIENIM 223

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           +      KL DFG ++   P     + +     ++Y      + APE++  +  L    +
Sbjct: 224 LSKTGEIKLIDFGLSNMYDP----RKSLQTFCGSLY------FAAPELLKAHPYL--GPE 271

Query: 258 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNY----SSKLINLIIIMLAENP 313
            D+W+ G+ LY L+    PF+     A LH K       Y    S  +I+L+  +L  +P
Sbjct: 272 VDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVVDP 330

Query: 314 NLRPNIYQVIYQVCAIMKVDVP 335
             R  + QV+     +   D P
Sbjct: 331 QKRATLQQVVNHQWMLKGYDFP 352

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 89/190 (46%), Gaps = 23/190 (12%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q     L E+   K +  +  A+  +H     ++HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLHL--NNIVHRDLKIENIM 254

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLP-IDE 256
           + +    K+ DFG ++    +    + +     ++Y      + APE++   +  P I  
Sbjct: 255 ISTSGEIKIIDFGLSN----LYDNKKQLHTFCGSLY------FAAPELL---KANPYIGP 301

Query: 257 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKL----INLIIIMLAEN 312
           + DIW+ G+ +Y L+    PF+     ++LH K       Y   L    I+L+  ML  +
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVD 360

Query: 313 PNLRPNIYQV 322
           P  R ++ QV
Sbjct: 361 PLKRASLKQV 370

>Scas_629.16
          Length = 918

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 120/292 (41%), Gaps = 40/292 (13%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGL 97
           I VG    E +K L +G    +Y+V+  + +N L           L    +  +     +
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVREKK-TNRLYA---------LKIFSKSEMIKRKKI 561

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
             +  E E++    N   +V  Y S  S          +   ME C        +  R  
Sbjct: 562 KRILAEQEIL-ATSNHPFVVTLYHSFQSEDY-------LYFCMEYCMGGEFFRALQTRRT 613

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG----STS 213
             +SE +      +VT A+  +H L    I+RD+K EN+L+    +  L DF     +  
Sbjct: 614 KCISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQAKD 671

Query: 214 SCFPIM-----TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           +  P+M     +T  D  + ++    ++   T +Y APE+I   R        D W LGI
Sbjct: 672 AKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGI 728

Query: 266 FLYKLLFYTTPFELTGQ---FA-ILHSKYDIPANN-YSSKLINLIIIMLAEN 312
            +Y++LF  TPF+ +     F+ IL +    P NN  S    +LI  +L +N
Sbjct: 729 LIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKN 780

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 96/202 (47%), Gaps = 26/202 (12%)

Query: 81  GDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLM 140
           GD   +K+++++ +     + NE+ VM   ++ +NIV + ++      D      + ++M
Sbjct: 607 GDKVAIKQMVLSKQPRKELIVNEIMVMNDSRH-ENIVNFLEAYLKTEDD------LWVVM 659

Query: 141 ELCPNKSLLDYM-----NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           E     SL D +     N    + LSE ++  I+ +  K +  +H     +IHRDIK +N
Sbjct: 660 EYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH--DKNIIHRDIKSDN 717

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           VL+D++   K+ DFG    C  +       A +        TP + APE++   +    D
Sbjct: 718 VLLDTKARVKITDFG---FCAKLTDQRSKRATMVG------TPYWMAPEVV---KQKEYD 765

Query: 256 EKSDIWALGIFLYKLLFYTTPF 277
            K D+W+LGI   ++L    P+
Sbjct: 766 AKVDVWSLGIMAIEMLEGEPPY 787

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 137/308 (44%), Gaps = 49/308 (15%)

Query: 36  TLIIVGSHKVEIVKYLAEGGFAHIYVV----KFVEFSNELETP---SSSLKEGDLACLKR 88
           TL    S +V + K +  G  A I +V     FV  SN    P   SSS+   +++    
Sbjct: 86  TLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNVSSPS- 144

Query: 89  VLVTDENGLNELRN------EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMEL 142
            + + E+  +   N      E+ +MK + ++ N++  ++   ++        E+ L++E 
Sbjct: 145 -IASREHSNHSQTNPYGIEREIVIMKLISHT-NVMALFEVWENKS-------ELYLVLEY 195

Query: 143 CPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN 202
                L DY+  +   KL E+E +     + + V+  H     + HRD+K EN+L+D +N
Sbjct: 196 VDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKKN 251

Query: 203 -NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSD 259
              K+ DFG  +   P         LL  +     +P Y +PE++    Y   P    SD
Sbjct: 252 RRIKIADFGMAALELP-------NKLLKTSC---GSPHYASPEIVMGRPYHGGP----SD 297

Query: 260 IWALGIFLYKLLFYTTPFELTGQFAIL----HSKYDIPANNYSSKLINLIIIMLAENPNL 315
           +W+ GI L+ LL    PF       +L      KY +P+ N SS+  +LI  +L  +P  
Sbjct: 298 VWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS-NLSSEARDLISKILVIDPEK 356

Query: 316 RPNIYQVI 323
           R    +++
Sbjct: 357 RITTQEIL 364

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 123/299 (41%), Gaps = 46/299 (15%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGL 97
           I+VG    E ++ L +G    +Y+V+  + +N L           L    +  +     +
Sbjct: 372 ILVGPQSFEKIRLLGQGDVGRVYLVREKQ-TNRLYA---------LKIFSKPEMIKRKKI 421

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
             +  E E++    N   IV  Y S  +          + L ME C        +  R  
Sbjct: 422 KRILTEQEIL-ATSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRALQTRKT 473

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF-------- 209
             +SE +      +VT A+  +H +    I+RD+K EN+L+    +  L DF        
Sbjct: 474 KCISEDDARFYSSEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLSDFDLSVQAKD 531

Query: 210 -------GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWA 262
                  G+ S          D    TN+     T +Y APE+I   R        D W 
Sbjct: 532 TKNPQVKGNASHSLVDTKICSD-GFRTNSFV--GTEEYIAPEVI---RGNGHTAAVDWWT 585

Query: 263 LGIFLYKLLFYTTPFEL--TGQ-FA-ILHSKYDIPANNYSSKLI-NLIIIMLAENPNLR 316
           LGI +Y++LF  TPF+   T Q F+ IL ++  IP NN +S+   +LI  +L +N N R
Sbjct: 586 LGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLIKNENKR 644

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 21/181 (11%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++ L++E+ ++K+L + +NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 512 IDALQHEMNILKELHH-ENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNNY- 562

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
                E  V      +   +A +H     +IHRDIK  N+L+D +   K+ DFG +    
Sbjct: 563 -GPFDEPLVKNFTRQILIGLAYLH--KRNIIHRDIKGANILIDIKGGVKITDFGISKKLS 619

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
           P+       A L  ++Y      + APE++   + +   EK+DIW++G  + ++     P
Sbjct: 620 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVIVEMFTGKHP 670

Query: 277 F 277
           F
Sbjct: 671 F 671

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 36/204 (17%)

Query: 171 DVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTN 230
           +VT A+  +HF    +I+RD+K EN+L+D   + K+ DFG       +  T         
Sbjct: 157 EVTLALEYLHF--HNIIYRDLKPENILLDRNGHIKITDFGFAKEVETVTWT--------- 205

Query: 231 NIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQF----AIL 286
              +  TP Y APE+I      P ++  D W+LG+ +Y++L   TPF  T        IL
Sbjct: 206 ---LCGTPDYIAPEVI---ATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 287 HSKYDIPANNYSSKLINLIIIMLAENPNLR--------------PNIYQVIYQVCAIMKV 332
           H K   P   ++S +I+L+  +L  +   R              P   +V+++      +
Sbjct: 260 HGKVVYP-QFFNSDVIDLLSKLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDI 318

Query: 333 DVPFEDKYQTGPYDFDKYSKYQEK 356
           + P+E     G  D   + +Y E+
Sbjct: 319 ETPYEPPITAGVGDTSLFDQYPEE 342

>Kwal_23.5290
          Length = 819

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 95/202 (47%), Gaps = 26/202 (12%)

Query: 81  GDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLM 140
           GD   +K+++++ +     + NE+ VMK  ++  NIV + ++      D      + ++M
Sbjct: 565 GDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVVM 617

Query: 141 ELCPNKSLLDYMNQRLA-----TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           E     SL D +    A     + L+E ++  I+ +  + +  +H     +IHRDIK +N
Sbjct: 618 EYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDN 675

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           VL+D+    K+ DFG    C  +       A +        TP + APE++        D
Sbjct: 676 VLLDNRARVKITDFG---FCAKLTDKRSKRATMVG------TPYWMAPEVVKQRE---YD 723

Query: 256 EKSDIWALGIFLYKLLFYTTPF 277
           EK D+W+LGI   ++L    P+
Sbjct: 724 EKVDVWSLGIMTIEMLEGEPPY 745

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 94/203 (46%), Gaps = 23/203 (11%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q  + +  E +  K    +  A+  +H     ++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLH--ANNIVHRDLKIENIM 276

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLP-IDE 256
           +   +  K+ DFG ++    I  + + +     ++Y      + APE++   +  P    
Sbjct: 277 ISDSSEIKIIDFGLSN----IYDSRKQLHTFCGSLY------FAAPELL---KANPYTGP 323

Query: 257 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNY----SSKLINLIIIMLAEN 312
           + D+W+ G+ L+ L+    PF+     ++LH K       Y    S ++I+L+  ML  +
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVD 382

Query: 313 PNLRPNIYQVIYQVCAIMKVDVP 335
           P  R  + QV+     +   + P
Sbjct: 383 PKRRATLKQVVEHHWMVRGFNGP 405

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 98/202 (48%), Gaps = 42/202 (20%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN--- 153
           +N+L  E+ ++K +K  +NI+ +Y +  ++  +     E+++LME     SL   ++   
Sbjct: 232 INQLVRELSIVKNVKPHENIITFYGAYYNQHINN----EIIILMEYSDCGSLDKILSVYK 287

Query: 154 ---QRLA-----TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205
              QR       T  +E  + KI Y V   +  + +    +IHRDIK  NVL++S+   K
Sbjct: 288 RFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSKGQIK 346

Query: 206 LCDFGSTSSCFPIMTTHQDIALLTNNI---YVHTTPQYRAPEMI--DLYRCLPIDEKSDI 260
           LCDFG +               L N+I   +V T+  Y +PE I  ++Y       K D+
Sbjct: 347 LCDFGVSKK-------------LINSIADTFVGTST-YMSPERIQGNVYSI-----KGDV 387

Query: 261 WALGIFLYKLLFYTTPFELTGQ 282
           W+LG+ + +L+  T  F L G 
Sbjct: 388 WSLGLMIIELV--TGEFPLGGH 407

>Kwal_23.5668
          Length = 1689

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 109/229 (47%), Gaps = 35/229 (15%)

Query: 113 SDNIVQYYDSNASRR------RDGSPGYEVLLLMELCPNKSLLDYMN-QRLATKLSEKEV 165
           S+++ Q+ D N   R      R+      + + ME C N++L D ++ + L  +  ++E 
Sbjct: 783 SNSMSQFRDLNGPNRLSDHLKRNRIVKSTLFIQMEYCENRTLFDLIHTENLCAQ--KEEY 840

Query: 166 LKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDI 225
            ++  ++  A++ +H     +IHRD+K  N+ +D   N K+ DFG   +       H+ +
Sbjct: 841 WRLFREILDALSYIH--SQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNV------HKSV 892

Query: 226 ALLTNNIYVHT-----------TPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF-Y 273
            LL  + ++ T           T  Y A E+  L      +EK D+++LGI  +++++ +
Sbjct: 893 DLLRMDSHISTASTEDLTSAIGTALYVATEV--LTGSGNYNEKIDMYSLGIIFFEMVYSF 950

Query: 274 TTPFELTGQF-AILHSKYDIPANNYSSKLI---NLIIIMLAENPNLRPN 318
            T  E       I  S  D P++  SSKL     +I  +L  +PN RPN
Sbjct: 951 NTGMERVNDIKKIRTSAIDFPSDFDSSKLAVEKKIITQLLDHDPNRRPN 999

>Scas_627.7
          Length = 349

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 88/204 (43%), Gaps = 29/204 (14%)

Query: 79  KEGDLACLKRVL----VTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGY 134
           KE    C  +V+    +   N   + R EVE+   L N  N+ + Y      +R      
Sbjct: 111 KETGFICALKVMDKAEIVQYNLQKQFRREVEIQTSL-NHPNLTKLYGHFHDEKR------ 163

Query: 135 EVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            V LLME      L  Y   R     ++    + ++ +  A+  +H     +IHRD+K E
Sbjct: 164 -VYLLMEYLVYGEL--YKLLRSHGPFNDVIASRFVFQIADALNYLH--DKQIIHRDLKPE 218

Query: 195 NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
           N+L+   N  KL DFG  S   P     + +           T  Y +PEMI   R    
Sbjct: 219 NILIGFNNVIKLTDFG-WSIINPRGVKRKTLC---------GTIDYLSPEMI---RSREY 265

Query: 255 DEKSDIWALGIFLYKLLFYTTPFE 278
           D+K D+WALG+  Y+L+  + PFE
Sbjct: 266 DDKVDVWALGVLTYELIVGSPPFE 289

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 127/311 (40%), Gaps = 60/311 (19%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT--DEN 95
           I V     E V+ L +GG   +Y VK           SS  K   +  LKRV     DE+
Sbjct: 465 ITVNGTAYEKVELLGKGGSGKVYKVK-----------SSDHK---VYALKRVSFDEFDES 510

Query: 96  GLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR 155
            ++  + E+E++K+L+N   +V+  D +         G  VL L+  C    L   + QR
Sbjct: 511 SIDGFKGEIELLKKLENKQRVVKLIDYHM--------GQGVLFLLMECGEHDLSQVLTQR 562

Query: 156 LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSC 215
                  + V     ++ K V  +H     ++H D+K  N  V  +   K+ DFG  ++ 
Sbjct: 563 SKIPFDTEFVRYHFQEMIKCVKVVH--DADIVHSDLKPAN-FVFVKGMLKIIDFG-IANA 618

Query: 216 FPIMTTHQDIALLTNNIYVHT---TPQYRAPEMI---DLYRC------LPIDEKSDIWAL 263
            P  T          NIY      TP Y APE +   +  R         + + SD+W+ 
Sbjct: 619 VPDHTV---------NIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSC 669

Query: 264 GIFLYKLLFYTTPF-ELTGQ---FAILHSKYDIPANNYSS-------KLINLIIIMLAEN 312
           G  LY++++   P+    G    +AI++    IP     S        +I+ I   L  N
Sbjct: 670 GCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERN 729

Query: 313 PNLRPNIYQVI 323
           P  R  I Q++
Sbjct: 730 PISRVTIDQLL 740

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 130/293 (44%), Gaps = 51/293 (17%)

Query: 36  TLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDEN 95
           TL +  + KV++ +  + G  A + V+    F+            G+++    V  T  +
Sbjct: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT-----------GNVSGTSIVGSTTPD 72

Query: 96  GL-NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154
            L   +  E+ +MK L N  N+++ YD   +         ++ L++E      L + + +
Sbjct: 73  ALPYGIEREIIIMKLL-NHPNVLRLYDVWET-------NTDLYLVLEYAEKGELFNLLVE 124

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214
           R    L E E ++    +   V+  H L   ++HRD+K EN+L+D + N K+ DFG    
Sbjct: 125 R--GPLPEHEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA-- 178

Query: 215 CFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDE-KSDIWALGIFLYKL 270
                      AL T    + T   +P Y APE++     +P     SD+W+ G+ L+ L
Sbjct: 179 -----------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFAL 224

Query: 271 LFYTTPF-ELTGQFAIL-----HSKYDIPANN-YSSKLINLIIIMLAENPNLR 316
           L    PF E  G    L       ++++P+++  S +  +LI  +L  +P  R
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERR 277

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 69/146 (47%), Gaps = 20/146 (13%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + +++E         Y+ ++   +L E    ++   +   V  MH     L+HRD+K+EN
Sbjct: 128 IGIVLEYASGGEFYKYIQRK--RRLKESTACRLFAQLISGVTYMH--SKNLVHRDLKLEN 183

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCL 252
           +L+D   N  + DFG  +   P            +N Y+ T   +P Y APE++   R  
Sbjct: 184 LLLDKNENLVITDFGFVNEFLP------------DNEYMKTSCGSPCYAAPELVISTRPY 231

Query: 253 PIDEKSDIWALGIFLYKLLFYTTPFE 278
            +  K+D+W+ GI LY +L    P++
Sbjct: 232 -VARKADVWSCGIILYAMLAGYLPWD 256

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 92/199 (46%), Gaps = 32/199 (16%)

Query: 135 EVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
           E+ L++E      L DY+  +   KL E E +     + +AVA  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 195 NVLVDSE-NNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTT---PQYRAPEMI--DL 248
           N+L+D +  + K+ DFG               AL T++  + T+   P Y +PE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 249 YRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYDIPANNYSSKLINL 304
           Y   P    SD+W+ GI L+ LL    PF       +L      KY +P    S +  +L
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP-QWLSVEAKDL 305

Query: 305 IIIMLAENPNLRPNIYQVI 323
           I  +L  +PN R  I Q++
Sbjct: 306 ISRILVVDPNRRITIDQIL 324

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 96/197 (48%), Gaps = 34/197 (17%)

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMEL--CPNKSLLDYMNQR 155
           N+L  E+ +MK +K   NIV +Y +  +  ++    +E+++LME   C +   +    +R
Sbjct: 236 NQLMRELTIMKNVKEQKNIVGFYGAYYTAIKN----HEIIILMEYMDCGSLDKISSTYRR 291

Query: 156 LATK-----------LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF 204
             ++            +E  + KI Y V   ++ + +    +IHRDIK  N+L++S+   
Sbjct: 292 YCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNILINSKGFV 350

Query: 205 KLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264
           K+CDFG +            IA    + +V T+  Y +PE I    C   + K D+W+LG
Sbjct: 351 KICDFGVSKKMI------DSIA----DTFVGTS-TYMSPERIQ-GSCY--NTKGDVWSLG 396

Query: 265 IFLYKLLFYTTPFELTG 281
           + + +L+  T  F L G
Sbjct: 397 LMIIELV--TGEFPLGG 411

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 14/143 (9%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + +++E         Y+ ++   +L E    ++   +   V  MH+    L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYIQRK--RRLKESSACRLFAQLISGVNYMHY--KGLVHRDLKLEN 180

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           +L+D   N  + DFG  +  F      +D  L+  +     +P Y APE++   +     
Sbjct: 181 LLLDKHENLVITDFGFVNEFF------EDNELMKTSC---GSPCYAAPELVVSTKAYEA- 230

Query: 256 EKSDIWALGIFLYKLLFYTTPFE 278
            K+D+W+ G+ LY +L    P++
Sbjct: 231 RKADVWSCGVILYAMLAGYLPWD 253

>Kwal_26.7861
          Length = 955

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 84/176 (47%), Gaps = 25/176 (14%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VMK  K++ NIV + DS   R        ++ ++ME     SL D +   +   L+
Sbjct: 711 NEILVMKASKHA-NIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E ++  +  +  K +  +H     +IHRDIK +NVL+      KL DFG    C  I   
Sbjct: 760 EGQIGAVSRETLKGLQFLH--SKGVIHRDIKSDNVLLSMSGEIKLTDFG---FCAQI--- 811

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
             +I L    +    TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 812 -NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 89/201 (44%), Gaps = 22/201 (10%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           E+EVMK+  + +N+V+ Y+       +     +V L++E C    +      ++  K   
Sbjct: 104 EIEVMKRCHH-ENVVELYEI-----LNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 163 KEVL------KIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG----ST 212
             +L      K++ DV   +  +H     + HRDIK  N+L+ S    K+ DFG    + 
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLH--SQGITHRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 213 SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 272
           +    I ++H+   LL +      TP + APE+    +        DIW+LG+ +Y LLF
Sbjct: 216 TGSTNIQSSHEQ--LLKSRAL--GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLF 271

Query: 273 YTTPFELTGQFAILHSKYDIP 293
              PF       +  S  + P
Sbjct: 272 GKLPFNANSGLELFDSIINKP 292

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 79/167 (47%), Gaps = 22/167 (13%)

Query: 156  LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSC 215
            L T ++E E   +   V   +  +H     ++HRDIK ENV+VD+    K+ DFGS +  
Sbjct: 1101 LKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAY- 1157

Query: 216  FPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFY 273
                     +     +++V T   Y APE++  D Y   P     D+WA+G+ LY +++ 
Sbjct: 1158 ---------VKRGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIYK 1203

Query: 274  TTPFELTGQFAILHSKYDI-PANNYSSKLINLIIIMLAENPNLRPNI 319
              PF    +  IL     I PA   S + + LI  +L  + N RP +
Sbjct: 1204 ENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTV 1248

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 126/296 (42%), Gaps = 40/296 (13%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGL 97
           I VG    E ++ L +G    +Y+VK  + +N L           L    +  +     +
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVK-EKRTNRLYA---------LKIFSKSEMIKRKKI 539

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
             +  E E++    N   +V  Y S  S          + L ME C        +  R +
Sbjct: 540 KRILAEQEIL-ATSNHPFVVTLYHSFQSEDY-------LYLCMEYCMGGEFFRALQTRKS 591

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG----STS 213
             +SE++      +VT A+  +H L    I+RD+K EN+L+    +  L DF     +  
Sbjct: 592 KCISEEDAKFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLSIQAKD 649

Query: 214 SCFPIM-----TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           +  P++     +T  D  + ++    ++   T +Y APE+I   R        D W LGI
Sbjct: 650 AKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGI 706

Query: 266 FLYKLLFYTTPF--ELTGQ-FA-ILHSKYDIPANNYSSK-LINLIIIMLAENPNLR 316
            +Y++LF  TPF  E T + F+ IL      P NN  S+   +LI  +L +N + R
Sbjct: 707 LIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNESKR 762

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 87/189 (46%), Gaps = 24/189 (12%)

Query: 92  TDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL-LD 150
           TD     ++  E++  K  K SD IVQYY      +        + + ME    KSL   
Sbjct: 250 TDPEYQKQIFRELQFNKSFK-SDYIVQYYGMFTDEQSS-----SIYIAMEYMGGKSLEAT 303

Query: 151 YMNQ-RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
           Y N  +   ++SE+ + KI   V + ++ +H     +IHRDIK +N+L++ +   KLCDF
Sbjct: 304 YKNLLKRGGRISERVIGKIAESVLRGLSYLH--ERKVIHRDIKPQNILLNEKGEIKLCDF 361

Query: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269
           G +             A+ +  +    T  Y APE I   +  P     D+W+LG+ L +
Sbjct: 362 GVSGE-----------AVNSLAMTFTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLE 407

Query: 270 LLFYTTPFE 278
           +     PFE
Sbjct: 408 VAGGRFPFE 416

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 116/256 (45%), Gaps = 21/256 (8%)

Query: 71  LETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDG 130
           L T + S K+  +  L +  +  +  +  +  E   +++L NS  +++ Y +     +D 
Sbjct: 198 LATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSRGVIKLYFT----FQDE 253

Query: 131 SPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRD 190
           +  Y    L+E  PN   L  M +     L+E+        +  A+  +H     ++HRD
Sbjct: 254 ASLY---FLLEYAPNGDFLSVMKK--FGSLNEECCRYYGAQMLDAIDFIH--KNGVVHRD 306

Query: 191 IKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYR 250
           IK EN+L+D     KL DFG+               LL  +     T +Y +PE+++   
Sbjct: 307 IKPENILLDEHMKVKLTDFGTAK--LLDRDEKSGYNLLKKSRSFVGTAEYVSPELLN-DN 363

Query: 251 CLPIDEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIPANNYSSKLINLII 306
           C  ++ K DIWA G  LY+++    PF+ T ++     ++  +Y   A  +   + +L+ 
Sbjct: 364 C--VNYKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPLVIRDLVK 420

Query: 307 IMLAENPNLRPNIYQV 322
            +L ++P  R N  QV
Sbjct: 421 QLLVKSPEARLNASQV 436

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 112/235 (47%), Gaps = 39/235 (16%)

Query: 100 LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK 159
           +  E+ +MK L N  N+++ +D   +         ++ L++E      L + + +R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWET-------NSDLYLVLEYAEKGELFNMLVER--GP 125

Query: 160 LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIM 219
           L E E ++    +   ++  H L   ++HRD+K EN+L+D++ N K+ DFG         
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPENLLLDNKLNIKIADFGMA------- 176

Query: 220 TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFYTT 275
                 AL + +  + T   +P Y APE+I     LP +   SD+W+ G+ L+ LL    
Sbjct: 177 ------ALESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRL 227

Query: 276 PF-ELTGQ-----FAILHSKYDIPANNYSSKLI-NLIIIMLAENPNLRPNIYQVI 323
           PF E  G        +   ++++P ++  +K   +L+  +L  +P+ R  I +++
Sbjct: 228 PFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREIL 282

>Scas_693.17
          Length = 1049

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 91/203 (44%), Gaps = 23/203 (11%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +L E      LLDY+ Q  +  L E         +  A+  +H     ++HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQHGS--LKESRARTFTRQICSALKYLH--SHNIVHRDLKIENIM 232

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLP-IDE 256
           +  + N KL DFG ++    +      +     ++Y      + APE++   +  P I  
Sbjct: 233 ISKDGNIKLIDFGLSN----LYDKCNKLKTYCGSLY------FAAPELL---KATPYIGP 279

Query: 257 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNY----SSKLINLIIIMLAEN 312
           + D+W+ G+ LY L+    PF+      +LH K       Y    S ++I+L+  ML  +
Sbjct: 280 EIDVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVD 338

Query: 313 PNLRPNIYQVIYQVCAIMKVDVP 335
           P  R  + QV+     +   D P
Sbjct: 339 PFKRATLDQVMNHHWMVRDCDGP 361

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 59/128 (46%), Gaps = 27/128 (21%)

Query: 156 LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST--- 212
           L T ++E E   I   V   +  +H     ++HRDIK EN++VD++   KL DFGS    
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAYV 142

Query: 213 -SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYK 269
            S  F +                  T  Y APE++  D Y   P     DIWA+G+ LY 
Sbjct: 143 KSGPFDVFV---------------GTIDYAAPEVLGGDPYEGKP----QDIWAIGVLLYT 183

Query: 270 LLFYTTPF 277
           ++F   PF
Sbjct: 184 IIFKENPF 191

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 88/180 (48%), Gaps = 24/180 (13%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EV++  +  N  N+++  D N S      P   + + MEL     L D +   +     +
Sbjct: 65  EVKLHSRCSNFVNVLKVIDCNLS-----DPF--LWIAMELAEGGDLFDKIEPDIGV---D 114

Query: 163 KEVLKIMY-DVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
            EV +  Y  + KA++ +H     + HRDIK EN+L+D + N KL DFG  S     +  
Sbjct: 115 SEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPENILLDKDGNLKLADFGLAS-----LFK 168

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFYTTPFEL 279
            +D +   +     + P Y APE+I  D Y      + +DIW++G+ L+ LL   TP+EL
Sbjct: 169 RKDGSKRISRDQRGSLP-YMAPEIIYCDGYYA----DMTDIWSIGVLLFVLLTGETPWEL 223

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 93/206 (45%), Gaps = 28/206 (13%)

Query: 78  LKEGDLACLKRVLVTDENGLNE--LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE 135
           L+ G      + + T EN  +E  +  E++  K  K SD IV+YY   A           
Sbjct: 198 LRNGSKIFALKTIATIENDGSEKQIFRELQFNKSCK-SDFIVRYYGMFACEETS-----T 251

Query: 136 VLLLMELCPNKSLLDYMNQRLATK---LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIK 192
           + + ME    +SL D + + L +K   + EK + KI   V + +  +H     +IHRDIK
Sbjct: 252 IFIAMEYMGGRSL-DSVYKHLLSKGGRIGEKVLGKIAESVLRGLFYLH--ERKIIHRDIK 308

Query: 193 IENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCL 252
            +N+L +     KLCDFG +      + T       T   Y      Y APE I   +  
Sbjct: 309 PQNILFNEIGQIKLCDFGVSGEAVNSLAT-----TFTGTSY------YMAPERI---QGQ 354

Query: 253 PIDEKSDIWALGIFLYKLLFYTTPFE 278
           P    SD+W+LG+ L ++    +PF+
Sbjct: 355 PYSVTSDVWSLGLTLLEVAQGHSPFD 380

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VMK  K+ +NIV + DS   R        ++ ++ME     SL D +   +   L+
Sbjct: 742 NEILVMKGSKH-NNIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E ++  +  +  K +  +H     +IHRDIK +N+L+    + KL DFG    C  I   
Sbjct: 791 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG---FCAQINEV 845

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
           +     +        TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 846 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 13/142 (9%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + + ME C   S+ D +     + L E +   I  ++ K ++ +H      IHRDIK  N
Sbjct: 76  MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLH--SQRKIHRDIKAAN 133

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           +L+  E   KL DFG +            ++    + +V  TP + APE++  +     D
Sbjct: 134 ILLTDEGKVKLSDFGVSGKL---------LSSFRRDTFV-GTPYWMAPEIV-AHDSEGYD 182

Query: 256 EKSDIWALGIFLYKLLFYTTPF 277
           E++DIW+LGI + ++L  + P 
Sbjct: 183 ERADIWSLGITVIEMLRGSPPL 204

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VM   K+  NIV Y DS  S       G ++ ++ME      L D +   +   L+
Sbjct: 611 NEIMVMSSSKH-QNIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E ++  +  +V + +  +H     ++HRDIK +NVL+    + KL DFG    C  +  T
Sbjct: 660 EGQIGAVCREVLQGLEFLH--SKGVLHRDIKSDNVLLSMNGDIKLTDFG---FCAQVNDT 714

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
                 +     +  TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 715 ------VIKRTTMVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 90/195 (46%), Gaps = 20/195 (10%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
            L+E  P+   L  + +     L+E         +  AV  +H +   +IHRDIK EN+L
Sbjct: 201 FLLEYAPHGDFLGLIKKY--GSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPENIL 256

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHT-----TPQYRAPEMI-DLYRC 251
           +D     KL DFG T+   P   ++        ++Y  +     T +Y +PE++ D Y  
Sbjct: 257 LDKNMKVKLTDFG-TAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY-- 313

Query: 252 LPIDEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIPANNYSSKLINLIII 307
              D + DIWA G  LY++L    PF+   ++     ++  +Y   A  +   + +L+  
Sbjct: 314 --TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA-GFPQIVKDLVKK 370

Query: 308 MLAENPNLRPNIYQV 322
           +L  +PN R  I Q+
Sbjct: 371 LLVRDPNDRLTIKQI 385

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 87/190 (45%), Gaps = 38/190 (20%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EV++  ++   +NIVQ YD            ++  ++ME C    L + +   L  K + 
Sbjct: 126 EVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKT- 173

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS--ENNFKLCDFGSTSSCFPIMT 220
           KE+  I+  +  A+  +H     + HRDIK EN+L+ S  +   KL D+G       + T
Sbjct: 174 KEITHILTQILDAIEFVH--NKQIYHRDIKPENILITSLIDWKIKLTDWG-------LAT 224

Query: 221 THQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDE--------KSDIWALGIFLYKLLF 272
           T  D      N+    + +Y  PE+ +    L IDE        K D+W++GI    ++F
Sbjct: 225 T--DEKSYDRNV---GSERYMPPELFE--SNLDIDERKEPYDCSKVDLWSIGIVFLNVVF 277

Query: 273 YTTPFELTGQ 282
           Y  PF +  Q
Sbjct: 278 YKNPFRIADQ 287

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 21/181 (11%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++ L++E+ ++K+L + +NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 510 IDALQHEMNLLKELHH-ENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNNY- 560

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
                E  +      +   +A +H     +IHRDIK  NVL+D +   K+ DFG +    
Sbjct: 561 -GPFEEPLIKNFTRQILIGLAYLH--RKNIIHRDIKGANVLIDIKGCVKITDFGISKKLS 617

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
           P+       A L  ++Y      + APE++   + +   EK+DIW++G  + ++     P
Sbjct: 618 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 277 F 277
           F
Sbjct: 669 F 669

>Scas_675.2
          Length = 527

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 90/189 (47%), Gaps = 22/189 (11%)

Query: 94  ENGLNE--LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDY 151
           +NGL E  +  EV +  +   + N+++  D N ++         + ++ME+     L D 
Sbjct: 54  KNGLTEKDISREVLLHSRCSKNPNVLRLIDCNIAKDY-------MWMIMEMADGGDLFDK 106

Query: 152 MNQRLATKLSEKEVLKIMYD-VTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG 210
           +   +     + EV +  +  + +A++ +H     + HRDIK EN+L+D   N KL DFG
Sbjct: 107 IEPDVGV---DSEVAQFYFQQLVRAISYLH-EECGVAHRDIKPENILLDKNGNLKLADFG 162

Query: 211 STSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKL 270
            +S         +    L  +     +P Y APE+  L+        +DIW++GI L+ L
Sbjct: 163 LSSQ------YRRKDGTLRISTDQRGSPPYMAPEI--LHSRGYYAHSTDIWSIGILLFVL 214

Query: 271 LFYTTPFEL 279
           L   TP+EL
Sbjct: 215 LTGETPWEL 223

>Scas_616.10
          Length = 1461

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 21/146 (14%)

Query: 135 EVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
           E+ L++E      L DY+  +   KLSEKE +     + + V+  H     + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPE 265

Query: 195 NVLVDSEN-NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRC 251
           N+L+D +N + K+ DFG  +   P                   +P Y +PE++    Y  
Sbjct: 266 NLLLDKKNKSIKIADFGMAALELPNKLLQTSCG----------SPHYASPEIVMGKSYHG 315

Query: 252 LPIDEKSDIWALGIFLYKLLFYTTPF 277
            P    SD+W+ GI L+ LL    PF
Sbjct: 316 GP----SDVWSCGIILFALLTGHLPF 337

>Scas_477.5
          Length = 703

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 88/181 (48%), Gaps = 22/181 (12%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++ L++E+ ++K+L + +NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 485 VDALQHEMNLLKELHH-ENIVTYYGSSQE-------GPNLNIFLEYVPGGSVSSMLNNY- 535

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
                E  ++  +  V   VA +H     +IHRDIK  N+L+D++   K+ DFG +    
Sbjct: 536 -GPFEESLIVNFIRQVLIGVAYLH--NKNIIHRDIKGANILIDTKGCVKITDFGISKKLS 592

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
           P ++     A L  ++Y      + APE++   +     EK+DIW+ G  + ++     P
Sbjct: 593 P-LSKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKHP 642

Query: 277 F 277
           F
Sbjct: 643 F 643

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + L ME C        +  R +  ++E++      +V  A+  +H L    I+RD+K EN
Sbjct: 397 LYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 454

Query: 196 VLVDSENNFKLCDFG----STSSCFPIM--TTHQDIALLTNNIYVHT---TPQYRAPEMI 246
           +L+    +  L DF     +T S  P M  +T+ D  + ++    ++   T +Y APE+I
Sbjct: 455 ILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI 514

Query: 247 DLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
              R        D W LGI +Y++LF  TPF+
Sbjct: 515 ---RGNGHTAAVDWWTLGILIYEMLFGCTPFK 543

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 85/183 (46%), Gaps = 20/183 (10%)

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
           N++  EV +  +     NI++  D N S+         + + ME+     L D +   + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISKDY-------LWIAMEMADGGDLFDKIEPDIG 56

Query: 158 TKLSEKEVLKIMYD-VTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
               + EV +  +  + +A+  +H +   + HRDIK EN+L+D   N KL DFG  S  F
Sbjct: 57  V---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLASQ-F 111

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
                 + +A          +P Y APE+I  Y      + +DIW+ GI ++ LL   TP
Sbjct: 112 RRKDGTKRLARDQRG-----SPPYMAPEII--YSSEYYADTTDIWSCGILVFVLLTGETP 164

Query: 277 FEL 279
           +EL
Sbjct: 165 WEL 167

>Scas_493.2
          Length = 1117

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 88/183 (48%), Gaps = 32/183 (17%)

Query: 100 LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK 159
           +  E+ +MK L+++ N++  YD   +          + +++E      L + + ++    
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWET-------NSNLYMILEYAEKGELFNLLVEK--GP 130

Query: 160 LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIM 219
           L EKE ++    +   ++  H L   ++HRD+K EN+L+D + N K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA------- 181

Query: 220 TTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFYTT 275
                 AL T +  + T   +P Y APE++     +P    +SD+W+ G+ L+ LL    
Sbjct: 182 ------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 276 PFE 278
           PF+
Sbjct: 233 PFD 235

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 106/235 (45%), Gaps = 47/235 (20%)

Query: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYY-----DSNASRRRDGSPGYEVLLLMELC 143
            L TD     ++  E++  K  K S+ IV+YY     D N+S          + + ME  
Sbjct: 231 TLNTDAETQKQIFRELQFNKNCK-SEYIVRYYGMFNDDRNSS----------IYIAMEYM 279

Query: 144 PNKSL-LDYMNQ-RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSE 201
             KSL   Y N  R   ++SEK + KI   V + ++ +H     +IHRDIK +N+L++  
Sbjct: 280 GGKSLDAIYKNLLRRGGRISEKVLGKIAESVLRGLSYLH--ERRIIHRDIKPQNILLNEI 337

Query: 202 NNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIW 261
              KLCDFG +      + T       T   Y      Y APE I   +  P    SD+W
Sbjct: 338 GQVKLCDFGVSGEAVNSLATT-----FTGTSY------YMAPERI---QGQPYSVTSDVW 383

Query: 262 ALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLR 316
           +LG+ L ++     PF  + + AI     ++P        I L++++L   P L+
Sbjct: 384 SLGLTLLEVAQGHFPFN-SDKMAI-----NMPP-------IELLMLILTLTPELK 425

>Kwal_26.8709
          Length = 829

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 109/243 (44%), Gaps = 38/243 (15%)

Query: 39  IVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLN 98
           IVGS        L EG F  + +      ++ ++ P    K+  +  ++R  +  +N   
Sbjct: 41  IVGS-------TLGEGEFGKVKLGWSKTSNSSMDVP----KQVAIKLIRRDTI-PKNSEK 88

Query: 99  ELR--NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           E++   E+  +K L N  NIV+  +   + +  G       +++E         Y+ ++ 
Sbjct: 89  EIKIYREINALKHL-NHPNIVRLEEVLQNSKYIG-------IVLEYASGGEFYKYIQKK- 139

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
             +L E    ++   +   V  MH     L+HRD+K+EN+L+D   N  + DFG  +   
Sbjct: 140 -RRLKEGPACRLFAQLISGVYYMHS--KGLVHRDLKLENLLLDKNENLLITDFGFVNEFL 196

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID-EKSDIWALGIFLYKLLFYTT 275
           P      +  L+  +     +P Y APE++   R  P +  K+D+W+ G+ LY +L    
Sbjct: 197 P------ENELMKTSC---GSPCYAAPELVVTAR--PYEARKADVWSCGVILYAMLAGYL 245

Query: 276 PFE 278
           P++
Sbjct: 246 PWD 248

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 76/170 (44%), Gaps = 23/170 (13%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRR--DGSPGYEVLLLMELCPNKSLLDYMNQRL---A 157
           E++ M   K   NI+   D +    +  DG   Y+            L+DY   R+   +
Sbjct: 171 ELKFMNYFKGHKNIINLLDLDIVSEKPYDGLYCYQ-----------ELIDYDLARVIHSS 219

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
            +LSE  +   +Y +   +  +H     +IHRD+K  N+L     N K+CDFG      P
Sbjct: 220 VQLSEFHIKSFLYQILCGLKYIH--SADVIHRDLKPGNILCTIHGNLKICDFGLARGVSP 277

Query: 218 IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFL 267
                + ++ +TN +    T  YRAPE+I  ++     +  D+WA+G  L
Sbjct: 278 QFFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVGCIL 322

>Scas_548.6
          Length = 1382

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 82/177 (46%), Gaps = 24/177 (13%)

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS--SC 215
            T ++E E   I   +   +  +H     ++HRDIK ENV+VDS+   K+ DFGS +    
Sbjct: 1226 TNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAYVKS 1283

Query: 216  FPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFY 273
             P             +++V T   Y APE++  + Y   P     DIWA+GI LY ++F 
Sbjct: 1284 GPF------------DVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVFK 1326

Query: 274  TTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIM 330
              PF    +      K++  +N+ S   I LI  +L  +   RP I ++      I+
Sbjct: 1327 ENPFYNIDEILEGELKFN-NSNDISEDCIELIKKILIRSVPKRPLIEEIFNDKWLIL 1382

>Scas_640.16
          Length = 505

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 100/237 (42%), Gaps = 51/237 (21%)

Query: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYY----DSNASRRRDGSPGYEVLLLMELCP 144
            L TD     ++  E++  K  K SD IV+YY    D N+S          + + ME   
Sbjct: 243 TLNTDPEFQKQIFRELQFNKSFK-SDYIVRYYGMFNDVNSS---------SIYIAMEYMG 292

Query: 145 NKSLLDYMNQRL--ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN 202
            KSL       L    ++SEK + KI   V + ++ +H     +IHRDIK +N+L + + 
Sbjct: 293 GKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLH--EQKVIHRDIKPQNILFNEKG 350

Query: 203 NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWA 262
             KLCDFG +      + T               T  Y APE I   +  P     DIW+
Sbjct: 351 QVKLCDFGVSGEAVNSLATT-----------FTGTSFYMAPERI---QGQPYSVTCDIWS 396

Query: 263 LGIFLYKLLFYTTPF---ELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLR 316
           LG+ + ++     PF   ++T   A                 I L++++L  NP L+
Sbjct: 397 LGLTILEVAQGRFPFGSDKITATIAP----------------IELLVLILTFNPELK 437

>Kwal_56.24584
          Length = 435

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 94/200 (47%), Gaps = 42/200 (21%)

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
           ++L  E+ +M+ +K  DNIV ++ +  +     S   E+++LME     SL   M+   A
Sbjct: 142 SQLIRELSIMQNVKPHDNIVGFFGAFYT----ASTSNEIVILMEYMDCSSLDKIMSTYKA 197

Query: 158 -----------TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
                      T   E  + KI Y V   ++ + +    +IHRDIK  NVL++S+   K+
Sbjct: 198 FVARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKI 256

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNI---YVHTTPQYRAPEMI--DLYRCLPIDEKSDIW 261
           CDFG +               L N+I   +V T+  Y +PE I   +Y       K D+W
Sbjct: 257 CDFGVSKK-------------LINSIADTFVGTS-TYMSPERIQGSVY-----STKGDVW 297

Query: 262 ALGIFLYKLLFYTTPFELTG 281
           +LG+ + +L+  T  F L G
Sbjct: 298 SLGLMIIELV--TGEFPLGG 315

>Scas_713.21
          Length = 641

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 136/324 (41%), Gaps = 64/324 (19%)

Query: 40  VGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV--TDENGL 97
           +   ++ IV+ L +GG + +Y V+               + G    LK++L+   DEN  
Sbjct: 316 ITDEELSIVELLGKGGSSKVYKVQD--------------RTGKYYALKQILLEELDENLK 361

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
            +L  E+E++K+L   + +V+  +     R        V +LME C N  L   +++R+ 
Sbjct: 362 TDLEREIELLKRLAREERVVKLIEYKIDDRM-------VQVLME-CGNFDLSHVLHERVN 413

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
                  V  +  ++ + +  +H   + ++H D+K  N +   +   KL DFG  +    
Sbjct: 414 RPFDINFVRLMSKEMIECIKAVH--DSDIVHSDLKPANFIF-VKGTLKLIDFGIANK--- 467

Query: 218 IMTTHQDIALLTNNIYVHT---TPQYRAPEMI--------DLYRCLPIDEKSDIWALGIF 266
                  IA  T N+Y +T   TP Y APE +        +      I + SDIW+ G  
Sbjct: 468 -------IADNTLNVYRNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWSYGCI 520

Query: 267 LYKLLFYTTPF-ELTGQ---FAILHSKYDIPANNYS-------SKLINLIIIMLAENPNL 315
           LY++ +   P+    G     AI++    I   N S         L+ LI   L  +P L
Sbjct: 521 LYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQL 580

Query: 316 RPNIYQVIYQVCAI---MKVDVPF 336
           R    ++  Q C+    M +  PF
Sbjct: 581 RATTDEI--QHCSFFNPMIISKPF 602

>Kwal_26.7355
          Length = 1446

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 119/281 (42%), Gaps = 51/281 (18%)

Query: 81   GDLACLKRVLV-----TDENGLN---ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSP 132
            G++  +K+V V      DE  L+    LR+EV  +K L ++ NIVQY           + 
Sbjct: 1169 GEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHT-NIVQYLGFE-------NK 1220

Query: 133  GYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIK 192
             Y   L +E     S+   +  RL  K  E  +  +   V + ++ +H     ++HRD+K
Sbjct: 1221 NYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLH--SKKILHRDMK 1276

Query: 193  IENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIY------VHTTPQYRAPEMI 246
             +N+L+D +   K+ DFG              I+  +NNIY      +  T  + APEM+
Sbjct: 1277 ADNLLLDVDGICKISDFG--------------ISKKSNNIYSNSDMTMRGTVFWMAPEMV 1322

Query: 247  DLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYDIPANNYSSKLI 302
            D  +      K DIW+LG  + ++     P+     +   F I   K   P    + K+I
Sbjct: 1323 DTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKII 1380

Query: 303  N-----LIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFED 338
            +      +      NP  RP   +++     I+  +  F++
Sbjct: 1381 SAEGKEFLDACFEINPEKRPTADELLSHPFCIVDKEFVFKE 1421

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 112/266 (42%), Gaps = 69/266 (25%)

Query: 51   LAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV-----TDENGLN---ELRN 102
            + +G F  +Y+   V               G++  +K+V V      DE+ ++    L++
Sbjct: 1044 IGKGSFGAVYLALNV-------------TTGEMLAVKQVTVPEFSSQDESAISMVEALKS 1090

Query: 103  EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE-----VLLLMELCPNKSLLDYMNQRLA 157
            EV  +K L N  NIVQY             G+E       L +E     S+   +  R+ 
Sbjct: 1091 EVSTLKDL-NHVNIVQYL------------GFEEKNGIYSLFLEYVAGGSVGSLI--RMY 1135

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
             +  ++ +  +   V + +A +H     ++HRD+K +N+L+D++   K+ DFG       
Sbjct: 1136 GRFDDQLIRHLTKQVLEGLAYLH--SKGILHRDMKADNLLLDNDGVCKISDFG------- 1186

Query: 218  IMTTHQDIALLTNNIYVHT------TPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLL 271
                   I+  +NNIY ++      T  + APEM+D         K DIW+LG  + ++ 
Sbjct: 1187 -------ISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMF 1237

Query: 272  FYTTPFE----LTGQFAILHSKYDIP 293
                P+     +   F I  SK   P
Sbjct: 1238 AGKRPWSNFEVVAAMFQIGKSKTAPP 1263

>Kwal_27.10004
          Length = 735

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 20/152 (13%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
            +ME C    L   +++    K   KE  +    V + +  +H     ++HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIH--SQGVVHRDIKPENVL 418

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTT----PQYRAPEMIDL----- 248
           +  E   K+ DFG +         ++D   LT+ + +  T    P Y APE++       
Sbjct: 419 ISKEGIAKMTDFGISD------WGNEDPDDLTSPVRLFDTYVGSPPYSAPEVVAFKDEDS 472

Query: 249 -YRCL-PIDE-KSDIWALGIFLYKLLFYTTPF 277
            Y+   P D  K D WALG+ L+ L++  TPF
Sbjct: 473 TYQDRKPYDAYKMDCWALGVLLFTLVYQCTPF 504

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 120/295 (40%), Gaps = 62/295 (21%)

Query: 51   LAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNE--------LRN 102
            + +G F  +Y+   V               G++  +K+V V   +  NE        LR+
Sbjct: 1181 IGKGSFGAVYLCLNVT-------------TGEMMAVKQVEVPKYSSQNEAILSTVEALRS 1227

Query: 103  EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE-----VLLLMELCPNKSLLDYMNQRLA 157
            EV  +K L +  NIVQY             G+E       L +E     S+   +  R+ 
Sbjct: 1228 EVSTLKDLDHL-NIVQYL------------GFENKNNIYSLFLEYVAGGSVGSLI--RMY 1272

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
             +  E  +  +   V K +A +H     ++HRD+K +N+L+D +   K+ DFG       
Sbjct: 1273 GRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG------- 1323

Query: 218  IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
            I    +DI    +++ +  T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1324 ISRKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1380

Query: 278  E----LTGQFAILHSKYDIPANNYSSKLI-----NLIIIMLAENPNLRPNIYQVI 323
                 +   F I  SK   P    +  LI     N +      NP  RP   +++
Sbjct: 1381 SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Kwal_55.20326
          Length = 750

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 95/201 (47%), Gaps = 24/201 (11%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++ L++E+ ++K+L++ +NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 531 VDALQHEMGLLKELQH-ENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNS-- 580

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
                E  +      +   ++ +H     +IHRDIK  N+L+D +   K+ DFG +    
Sbjct: 581 YGPFEEPLIRNFTRQILIGLSYLH--RKDIIHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
           P+       A L  ++Y      + APE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 277 FELTGQFAILHSKYDIPANNY 297
           F     F+ + + + I  N +
Sbjct: 690 FP---DFSQMQAIFKIGTNTF 707

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 108/239 (45%), Gaps = 51/239 (21%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR- 155
           L++L  E +++ QL N  NI++ + ++  +  +      + +  EL P   L  Y+ +  
Sbjct: 199 LSKLDKEAKILMQL-NHPNIIKVFKTHTDKSNN------LYIFQELIPGGDLFSYLAKGD 251

Query: 156 LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK---LCDFGST 212
               +S+ E L  +Y +  A+  +H     ++HRD+K++N+L+ +   F    L DFG  
Sbjct: 252 CLMPISQTEALVFVYQILHALKYLH--TKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA 309

Query: 213 SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI---------DLYRCLPI-----DEKS 258
            +    +TT +     +    V  TP+Y APE+            +R   +     D K 
Sbjct: 310 RT----VTTMK-----SRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKC 360

Query: 259 DIWALGIFLYKLLFYTTPFELTG---------QFAILH------SKYDIPANNYSSKLI 302
           D+W+LG+  + +L   +PF   G         +  IL+      S  DI A N+ SKL+
Sbjct: 361 DLWSLGVITHIMLTGISPFYGDGTEQSIVENAKAGILNFNVSQWSTIDIMAQNFVSKLL 419

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 111/226 (49%), Gaps = 29/226 (12%)

Query: 48  VKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVM 107
           V  + +G F+ +Y V F + + +      ++K      LKR+L+ +   LNE+ N++ + 
Sbjct: 447 VHSIGKGQFSTVYQVTFAQTNKKYAI--KAIKPNKYNSLKRILL-EIKILNEVTNQITMD 503

Query: 108 KQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK---LSEKE 164
           ++ K  + I+ Y  S   +           ++ ELC N +L  ++ +++  K   L +  
Sbjct: 504 QEGK--EYIIDYISSWKFQN-------SYYIMTELCENGNLDGFLQEQVIAKKKRLEDWR 554

Query: 165 VLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQD 224
           + KI+ +++ A+  +H     ++H D+K  NV++  E N KL DFG        M TH  
Sbjct: 555 IWKIIVELSLALRFIHD-SCHIVHLDLKPANVMITFEGNLKLGDFG--------MATH-- 603

Query: 225 IALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKL 270
           + L   +       +Y APE+I    C   D K+DI++LG+ + ++
Sbjct: 604 LPLEDKSFENEGDREYIAPEIIS--DCT-YDYKADIFSLGLMIVEI 646

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 86/191 (45%), Gaps = 32/191 (16%)

Query: 160 LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIM 219
           L E+E +     +   ++  H L   ++HRD+K EN+L+DS  N K+ DFG       + 
Sbjct: 124 LPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFG-------MA 174

Query: 220 TTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFYTTPF- 277
               D  LL  +     +P Y APE++     LP +   SD+W+ G+ L+ LL    PF 
Sbjct: 175 ALQTDADLLETSC---GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPFD 228

Query: 278 ELTGQ-----FAILHSKYDIPANNYSSK-LINLIIIMLAENPNLRPNIYQVIYQVCAIMK 331
           E  G        +   ++++P +   S+   +LI  +L  +P  R  I  ++        
Sbjct: 229 EENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH------ 282

Query: 332 VDVPFEDKYQT 342
              P   KYQT
Sbjct: 283 ---PLLKKYQT 290

>Kwal_47.17263
          Length = 1127

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 133/321 (41%), Gaps = 59/321 (18%)

Query: 95  NGLNELRNEVEVMKQLKNSD--NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM 152
           NG ++++ E+ +MK+  +     +V+  D + SR+        + L++E C    +    
Sbjct: 153 NGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRK--------IYLVLEYCSKGEVKWCP 204

Query: 153 NQRLATK------LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
             +L T+      L+ +   +I   V   +  +H+    +IHRDIK  N+L+      K+
Sbjct: 205 GDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHY--QGIIHRDIKPANLLISESGTVKI 262

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHT--TPQYRAPEMIDLY----RCLP------- 253
            DFG +   F    +      L       T  TP + APE+   +    R  P       
Sbjct: 263 SDFGVS---FAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDH 319

Query: 254 ---IDEKSDIWALGIFLYKLLFYTTPF----------ELTGQFAILHSKYDIPANNYSSK 300
              I    DIWA+G+ L+ LLF   PF          ++  Q  +L + Y+  A+N  SK
Sbjct: 320 GSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKT-YEEMASNGISK 378

Query: 301 LIN---------LIIIMLAENPNLRPNIYQVIYQ--VCAIMKVDVPFEDKYQTGPYDFDK 349
           + N         L+  +L +NP  R  I ++     VC   + DV  ++       +  +
Sbjct: 379 ISNQEEYEAAKDLLGRLLTKNPFKRIKIAEIKKHPFVCWDFEHDVTSDNNSGCSAGNSSE 438

Query: 350 YSKYQEKLQAFQYQLYISYHQ 370
             K+Q   +    Q+ I+ H+
Sbjct: 439 KLKFQRSHEENYKQISITTHE 459

>Kwal_23.6458
          Length = 868

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 117/291 (40%), Gaps = 45/291 (15%)

Query: 38  IIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGL 97
           +IVG    E +K L +G    +Y+VK  + +N L           L    +  +     +
Sbjct: 457 VIVGPQSFEKIKLLGQGDVGKVYLVKEKK-TNRLYA---------LKIFSKEEMIKRKKI 506

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA 157
             +  E E++    N   IV  Y S  S          + L ME C        +  R  
Sbjct: 507 KRILAEQEIL-ATSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFFRALQTRKT 558

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG----STS 213
             + E +      +V  A+  +H +    I+RD+K EN+L+    +  L DF     +  
Sbjct: 559 KCIDEDDARFYSSEVVAAIEYLHLMG--FIYRDLKPENILLHKSGHIMLSDFDLSVQAKD 616

Query: 214 SCFPIMTTHQDIALLTNNI---------YVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264
           +  P++      +LL   I         +V T  +Y APE+I   R        D W LG
Sbjct: 617 TKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAVDWWTLG 672

Query: 265 IFLYKLLFYTTPFE---LTGQFA-ILHSKYDIPANNYSSK----LINLIII 307
           I +Y++LF  TP++       F+ +L ++   P NN  S+    LI  ++I
Sbjct: 673 ILIYEMLFGFTPYKGDNTNKTFSNVLKNEVSFPNNNEVSRNCKDLIRKLLI 723

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 85/191 (44%), Gaps = 41/191 (21%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EV++  ++    NI + YD            ++  ++ME C    L + +      + + 
Sbjct: 107 EVDIQSKIGKHKNITELYDY-----------FDSYIIMEYCSGGDLYEAIKADTIPRKT- 154

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLV-DSENNFKLCDFGSTSSCFPIMTT 221
           +++  I+  +  AV  +H     + HRDIK EN+L+ DS    KL D+G       + TT
Sbjct: 155 RQLTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWG-------LATT 205

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDL----------YRCLPIDEKSDIWALGIFLYKLL 271
            Q    +  N+    + +Y APE+ +           Y C     K DIWA+GI L  ++
Sbjct: 206 DQ--TSMDRNV---GSERYMAPELFESNLDYDERNEPYEC----SKVDIWAIGIVLLNIV 256

Query: 272 FYTTPFELTGQ 282
           F+  PF +  Q
Sbjct: 257 FHKNPFSVANQ 267

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 104/255 (40%), Gaps = 42/255 (16%)

Query: 135 EVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
           E+ L++E      L DY+  +   KLSE E +     + + V+  H     + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 195 NVLVDSENN-FKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRC 251
           N+L+D +N   K+ DFG  +   P                   +P Y +PE++    Y  
Sbjct: 256 NLLLDKKNKVIKIADFGMAALELPNKLLETSCG----------SPHYASPEIVMGKPYHG 305

Query: 252 LPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYDIPANNYSSKLINLIII 307
            P    SD+W+ GI L+ LL    PF       +L      ++ +P    ++   +LI  
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPP-YLTNDAKDLITR 360

Query: 308 MLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYS-----KYQEKLQAFQY 362
           +L  NP  R  I +++           P   KY+  P    K +     K    L   +Y
Sbjct: 361 ILVTNPEKRLTINEILNH---------PLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEY 411

Query: 363 QL--YISYHQKQDVD 375
                +  + ++D+D
Sbjct: 412 NTPATVCLNSEEDID 426

>Kwal_26.7154
          Length = 1213

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query: 156  LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS-- 213
            + T ++E E + I   +   +  +H     ++HRDIK ENV+VD     K+ DFGS +  
Sbjct: 1055 MKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYV 1112

Query: 214  SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLL 271
               P             +++V T   Y APE++  + Y   P     DIWA+G+ LY ++
Sbjct: 1113 KSGPF------------DVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTII 1155

Query: 272  FYTTPF 277
            +   PF
Sbjct: 1156 YKENPF 1161

>Scas_700.34
          Length = 864

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 108/237 (45%), Gaps = 31/237 (13%)

Query: 47  IVKYLAEGGFAHIYVVKFVEFSNELETPSSSL---KEGDLACLKRVLVT-DENGLNELRN 102
           I   L EG F     VK     N L + SS +   K+  +  ++R  ++ D +   ++  
Sbjct: 50  IGSTLGEGEFGK---VKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYR 106

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           E+  +K L +  NIV+  +   + +  G       +++E         Y+ ++   +L E
Sbjct: 107 EINALKHLTHP-NIVKLEEVLQNSKYIG-------IVLEYASGGEFYKYIQRK--KRLKE 156

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTH 222
               ++   +   V  +H     L+HRD+K+EN+L+D   N  + DFG  S  +    +H
Sbjct: 157 GPACRLFAQLINGVHYIHS--KGLVHRDLKLENLLLDKHENLIITDFGFVSEFY----SH 210

Query: 223 QDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID-EKSDIWALGIFLYKLLFYTTPFE 278
            ++   +       +P Y APE++      P + +K+DIW+ G+ LY +L    P++
Sbjct: 211 GELMKTSCG-----SPCYAAPELV--VSTKPYEAKKADIWSCGVILYAMLAGYLPWD 260

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 41/188 (21%)

Query: 100 LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE----VLLLMELCPNKSLLDYMNQR 155
           + NE  ++++L    NI Q  D            YE     + ++E C    L D++   
Sbjct: 55  VHNEYAILRRLGTHRNICQLLDF-----------YEDADTYVFVLEYCAYGDLYDFIK-- 101

Query: 156 LATKLSEKEVLKI-----MYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG 210
               + E+  ++I     ++ +  A++  H     + HRDIK ENVL+D     KL DFG
Sbjct: 102 ---AIRERPTMRINFHSFLFQLCSAISYCH--SKDVSHRDIKPENVLMDDRGQVKLTDFG 156

Query: 211 STSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKL 270
            +     I +  +D        Y   T +Y APE     R       +D W+LGI ++ L
Sbjct: 157 LSQ----IGSVSKD--------YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCL 202

Query: 271 LFYTTPFE 278
           +F + PFE
Sbjct: 203 MFGSCPFE 210

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 84/198 (42%), Gaps = 29/198 (14%)

Query: 85  CLKRVLVTDE----NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLM 140
           C  +V+  +E    N   + R EVE+   L N  N+ + Y      +R       V LLM
Sbjct: 130 CALKVMEKEEIIKYNLQKQFRREVEIQTSL-NHPNLTKSYGYFHDEKR-------VYLLM 181

Query: 141 ELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS 200
           E   N  +  Y   RL    ++      +Y +  A+  MH     +IHRDIK EN+L+  
Sbjct: 182 EYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPENILIGF 237

Query: 201 ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDI 260
            N  KL DFG  S   P     + +           T  Y +PEM++       D   D 
Sbjct: 238 NNVIKLTDFG-WSIINPPENRRKTVC---------GTIDYLSPEMVE---SREYDHTIDA 284

Query: 261 WALGIFLYKLLFYTTPFE 278
           WALG+  ++LL    PFE
Sbjct: 285 WALGVLAFELLTGAPPFE 302

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 76/170 (44%), Gaps = 32/170 (18%)

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS--SC 215
            T ++E E   +   V   V  +H     ++HRDIK EN++VDS+   K+ DFGS +    
Sbjct: 1180 TNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKS 1237

Query: 216  FPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK-SDIWALGIFLYKLLFYT 274
             P             +++V T   Y APE++      P + K  DIWA+GI LY ++F  
Sbjct: 1238 GPF------------DVFVGTI-DYAAPEVLG---GSPYEGKPQDIWAIGILLYTIVFKE 1281

Query: 275  TPFE-----LTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNI 319
             PF      L G+     S+        S +   LI  +L  N   RP I
Sbjct: 1282 NPFYNIDEILEGELKFNSSEL------VSEQCTTLIAKILNRNVQKRPTI 1325

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 91/203 (44%), Gaps = 33/203 (16%)

Query: 98  NELRNEVEVMKQL--KNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLL----DY 151
           ++++ E+ +MK+   K+   +++  D   SR+        + L++E C    +     D 
Sbjct: 187 DKIKREIAIMKKCHHKHVVQLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 238

Query: 152 M--NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
           M  + +  + LS +E  +I+  V   +  +H+    +IHRDIK  N+L+  +   K+ DF
Sbjct: 239 MESDAKGPSLLSFQETREILRGVVLGLEYLHY--QGIIHRDIKPANLLISGDGTVKISDF 296

Query: 210 G-STSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--------------DLYRCLPI 254
           G S ++     +   +            TP + APEM               +L+R   I
Sbjct: 297 GVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCI 356

Query: 255 DEKSDIWALGIFLYKLLFYTTPF 277
               DIWA+G+ LY LLF   PF
Sbjct: 357 SFMIDIWAVGVTLYCLLFGMLPF 379

>Scas_544.6
          Length = 489

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 108/233 (46%), Gaps = 53/233 (22%)

Query: 71  LETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDG 130
           L  PSS +    +  L++    +E  +N+L  E+ +MK +K   NI+ +Y +  +  ++ 
Sbjct: 175 LHVPSSKIIAQKIIPLEK---NNEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHHQNN 231

Query: 131 SPGYEVLLLMELCPNKSL------------LDYMNQRLATKLSEKEVL-KIMYDVTKAVA 177
               E+++LME     SL               ++ R     ++  +L +I Y V   + 
Sbjct: 232 ----EIVILMEYMDCGSLDRIFSTYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLN 287

Query: 178 QMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNI---YV 234
            + +    +IHRDIK  NVL++S+   KLCDFG +               L N+I   +V
Sbjct: 288 YL-YENYKIIHRDIKPSNVLINSKGLVKLCDFGVSKK-------------LINSIADTFV 333

Query: 235 HTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFAI 285
            T+  Y +PE I  ++Y       K D+W+LG+ + +L        +TGQF +
Sbjct: 334 GTS-TYMSPERIQGNVY-----STKGDVWSLGLMIIEL--------VTGQFPL 372

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 115/244 (47%), Gaps = 32/244 (13%)

Query: 84  ACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELC 143
             +K V   D++ L ++ +E++++K L N  NIV+Y+     +       + + +++E C
Sbjct: 48  VAIKEVNYQDDDELVDIMSEIDLLKNL-NHINIVKYHGFIQKQ-------HNLYIILEYC 99

Query: 144 PNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENN 203
              SL + +++     +SE E    +      +  +H     +IHRDIK  N+L+DSEN 
Sbjct: 100 AKGSLKNLISRN--RPMSEHEAKPYVRQTLNGLNYLH--EQGVIHRDIKAANILLDSENV 155

Query: 204 FKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWAL 263
            KL DFG ++    +  T   +A          +  + APE+I       +   SDIW+L
Sbjct: 156 VKLADFGVSTK---VNNTAMTLA---------GSLNWMAPEIIGNRGASTL---SDIWSL 200

Query: 264 GIFLYKLLFYTTPF----ELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNI 319
           G  + +LL    PF    ++   +AI +  Y  P ++ SS   + +    A+N   RP  
Sbjct: 201 GATVVELLTGNPPFHNLIDMNIYYAIENDSY-FPPSSLSSGAKDFLQQCFAKNMYKRPTA 259

Query: 320 YQVI 323
            Q++
Sbjct: 260 VQLL 263

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 109/260 (41%), Gaps = 57/260 (21%)

Query: 51   LAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNEL-RNEVEVMKQ 109
            + +G F  +Y+             S ++  G++  +K+V V      NEL ++ VE +K 
Sbjct: 1157 IGKGSFGAVYL-------------SLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKS 1203

Query: 110  ----LKNSD--NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEK 163
                LK+ D  NIVQY  S          G    L +E     S+   +  RL  +  EK
Sbjct: 1204 EVATLKDLDHLNIVQYLGSEIR-------GNIYSLFLEYVAGGSVGSLI--RLYGRFDEK 1254

Query: 164  EVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQ 223
             +  +   V   +  +H     ++HRD+K +N+L+D +   K+ DFG             
Sbjct: 1255 LIRHLNTQVLSGLKYLH--SKGILHRDMKADNLLLDEDGICKISDFG------------- 1299

Query: 224  DIALLTNNIYVHT------TPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
             I+  + NIY ++      T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1300 -ISKKSKNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW 1356

Query: 278  E----LTGQFAILHSKYDIP 293
                 +   F I  SK   P
Sbjct: 1357 SNLEVVAAMFQIGKSKSAPP 1376

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 61/122 (50%), Gaps = 19/122 (15%)

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
            T ++E E   I   V   +  +H     ++HRDIK ENV+VDS+   K+ DFGS +    
Sbjct: 1200 TNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY--- 1254

Query: 218  IMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFYTT 275
                   +     +++V T   Y APE++  + Y   P     DIWA+GI LY ++F   
Sbjct: 1255 -------VKSGPFDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFKEN 1302

Query: 276  PF 277
            PF
Sbjct: 1303 PF 1304

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 81/168 (48%), Gaps = 13/168 (7%)

Query: 167 KIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF-KLCDFGS---TSSCFPIMTTH 222
           KI+ D+TK +  +H      IHRDIK  N+L+D E    KL DFGS   T    P    +
Sbjct: 238 KILEDMTKGLEYLH--SQGCIHRDIKPSNILLDEEEKVAKLSDFGSCIFTPQSLPFSDAN 295

Query: 223 QDIALLTNNIYVHTTPQYRAPEMIDL---YRCLPIDE-KSDIWALGIFLYKLLFYTTPFE 278
            +         +  TP + APE+  L    R    D  K DIW+LG+ LY LL+   PF 
Sbjct: 296 FEDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFF 355

Query: 279 LTGQFAILHSKYDIP-ANNYSSKLINLIII--MLAENPNLRPNIYQVI 323
              +F   H   ++  ++  +   +N ++I  +L ++  LR +I  ++
Sbjct: 356 GENEFETYHKIIEVSLSSKINGNTLNDLVIKRLLEKDVTLRISIQDLV 403

>Scas_720.94
          Length = 1683

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 111/261 (42%), Gaps = 50/261 (19%)

Query: 50   YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNEL----RNEVE 105
            ++  G F  +Y              + +L  G++  +K + + D   + ++    + E+ 
Sbjct: 1366 FIGGGTFGTVY-------------SAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMT 1412

Query: 106  VMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEV 165
            V++ L N  NIVQYY     R +       V + ME C   S    M   L     E E+
Sbjct: 1413 VLEML-NHPNIVQYYGVEVHRDK-------VNIFMEYCEGGS----MASLLEHGRIEDEM 1460

Query: 166  LKIMY--DVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQ 223
            +  +Y  ++ + +A +H     ++HRDIK EN+L+D     K  DFG+        T   
Sbjct: 1461 VTQVYTLELLEGLAYLH--QAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVT 1518

Query: 224  DIALLT---------------NNIY-VHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFL 267
            +I   +               N+++ +  TP Y APE I  Y+        DIW+ G  +
Sbjct: 1519 NINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVV 1578

Query: 268  YKLLFYTTPF-ELTGQFAILH 287
             +++    P+  L  ++AI++
Sbjct: 1579 LEMITGRRPWANLDNEWAIIY 1599

>Scas_651.18
          Length = 371

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 90/204 (44%), Gaps = 36/204 (17%)

Query: 171 DVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTN 230
           +V  A+  +H +   +I+RD+K EN+L+D   + K+ DFG       I  T         
Sbjct: 165 EVCLALEYLHSMD--IIYRDLKPENILLDKNGHIKITDFGFAKYVPDITYT--------- 213

Query: 231 NIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFA----IL 286
              +  TP Y APE++      P ++  D W+ GI +Y++L   TPF  +        IL
Sbjct: 214 ---LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENIL 267

Query: 287 HSKYDIPANNYSSKLINLIIIMLAENPNLR--------------PNIYQVIYQVCAIMKV 332
           + K   P N +   + +L+  ++ +N   R              P   +VI++      +
Sbjct: 268 NCKLKFP-NFFHDDVKDLLSKLITKNLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNI 326

Query: 333 DVPFEDKYQTGPYDFDKYSKYQEK 356
           + P+E   Q G  D  ++ +Y E+
Sbjct: 327 ETPYEPPIQQGQGDTSQFDRYPEE 350

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 104/237 (43%), Gaps = 53/237 (22%)

Query: 71  LETPSSSLKEGDLACLKRVLVTDENGL---NELRNEVEVMKQLKNSDNIVQYYDSNASRR 127
           L  PSS +        K+ +V ++N      ++  E+ +M+ +    NIV++Y ++    
Sbjct: 122 LHVPSSRV------IAKKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLSS 175

Query: 128 RDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVL-------------------KI 168
              +   +V++LME   N   LD +  R    L  + +L                   +I
Sbjct: 176 DSINGSNDVVILMEYM-NCGSLDTIT-RTYKSLQRRGILAANRSYPVQEWFSKPVIISRI 233

Query: 169 MYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALL 228
            Y V   ++ + +    +IHRDIK  NVL++S+   KLCDFG +               L
Sbjct: 234 AYSVLNGLSYL-YENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRK-------------L 279

Query: 229 TNNI---YVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQ 282
            N+I   +V T+  Y +PE I   +      K D+W+LG+ L +LL  T  F L G 
Sbjct: 280 NNSIADTFVGTST-YMSPERIQGNK---YTTKGDVWSLGLMLIELL--TGEFPLGGH 330

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 21/123 (17%)

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS--SC 215
            + ++E E   I   +   +  +H     ++HRDIK ENV+VDS+   KL DFGS +    
Sbjct: 1050 SNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKS 1107

Query: 216  FPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKS-DIWALGIFLYKLLFYT 274
             P             +++V T   Y APE++      P + KS DIWA+GI LY L++  
Sbjct: 1108 GPF------------DVFVGTI-DYAAPEVLGGN---PYEGKSQDIWAIGILLYTLIYKE 1151

Query: 275  TPF 277
             PF
Sbjct: 1152 NPF 1154

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 19/182 (10%)

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
           ++  EV +  +     N+++  D N S+         + +++E+     L D +   +  
Sbjct: 61  DITKEVVLQSKCSKHPNVLRLIDCNVSKEY-------MWIILEMADGGDLFDKIEPDVGV 113

Query: 159 KLSEKEVLKIMYD-VTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
              + +V +  +  +  A+  +H +   + HRDIK EN+L+D   N KL DFG  S    
Sbjct: 114 ---DSDVAQFYFQQLVSAINYLH-VECGVAHRDIKPENILLDKNGNLKLADFGLASQ--- 166

Query: 218 IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
                +    L  ++    +P Y APE++        D ++DIW++GI L+ LL   TP+
Sbjct: 167 ---FRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGYYAD-RTDIWSIGILLFVLLTGQTPW 222

Query: 278 EL 279
           EL
Sbjct: 223 EL 224

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 89/192 (46%), Gaps = 28/192 (14%)

Query: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145
           +K++   DE+ LNE   E++++K L++  NIV+Y       R      +E+ +++E C  
Sbjct: 38  IKQIEFEDESELNEHMLEIDLLKNLRH-QNIVEY-------RGFIQKAHELYIILEYCAR 89

Query: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205
            SL D +       L E + +  +      +  +H     +IHRDIK  N+L+  E   K
Sbjct: 90  GSLRDILKH---GPLLEDDTVNYVTQTLYGLQYLH--EQGVIHRDIKAANLLLTEEGIVK 144

Query: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           L DFG ++    +  T+              +P + APE++       +   SDIW+LG 
Sbjct: 145 LADFGVSTRINRMAMTYAG------------SPNWMAPEVMTGQGASTV---SDIWSLGA 189

Query: 266 FLYKLLFYTTPF 277
            + +LL    PF
Sbjct: 190 TVVELLTGNPPF 201

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 88/175 (50%), Gaps = 24/175 (13%)

Query: 103 EVEVMKQLKNSDNI-VQYYDSNASRRRDGSPGYEVLLLMELCPN---KSLLDYMNQRLAT 158
           E+E+MK L + + I ++Y+       RD      + L++E  P    + L  +++QR  T
Sbjct: 80  ELEIMKMLSHINIIDLKYF----FYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQR--T 133

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN-NFKLCDFGSTSSCFP 217
            +S  E+   M+ + K++  +H     + HRDIK +N+LVD E  + KLCDFGS     P
Sbjct: 134 PMSRLEIKYYMFQLFKSLNYLHHFAN-VCHRDIKPQNLLVDPETWSLKLCDFGSAKQLKP 192

Query: 218 IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 272
              T  +++ + +         YRAPE+I  +       + DIW+ G  + +LL 
Sbjct: 193 ---TEPNVSYICSR-------YYRAPELI--FGATNYTNQIDIWSSGCVMAELLL 235

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 103/237 (43%), Gaps = 39/237 (16%)

Query: 51  LAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQL 110
           L EG F  + +     FSN   +     K+  +  +KR  ++     N+ R EV++ +++
Sbjct: 47  LGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSIS-----NDYRKEVKIYREI 101

Query: 111 K-----NSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEV 165
                 +  NIV+  +   + R  G       +++E         Y+ ++   +L E   
Sbjct: 102 NALKHLSHPNIVKLEEVLQNSRYIG-------IVLEYACGGEFYKYIQKK--RRLKEMNA 152

Query: 166 LKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDI 225
            ++   +   V  +H     L+HRD+K+EN+L+D   N  + DFG  +            
Sbjct: 153 CRLFSQLISGVHYIH--SKGLVHRDLKLENLLLDKNENLVITDFGFVNE----------- 199

Query: 226 ALLTNNIYVHT---TPQYRAPEMIDLYRCLPID-EKSDIWALGIFLYKLLFYTTPFE 278
              + N  + T   +P Y APE++      P +  K+DIW+ G+ LY +L    P++
Sbjct: 200 -FCSRNELMKTSCGSPCYAAPELV--ISAEPYEARKADIWSCGVILYAILAGYLPWD 253

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 109/257 (42%), Gaps = 50/257 (19%)

Query: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCP 144
            LKR L  +E  L  L +E+ ++++L +  NIV++ D   SR +         ++ +L  
Sbjct: 87  LLKRALKGNE--LQMLYDELSILQKL-DHPNIVKFKDWFESREK-------FYIVTQLAT 136

Query: 145 NKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLV---DSE 201
              L D + ++   K +E + +KI+  +  AV  MH     ++HRD+K ENVL      E
Sbjct: 137 GGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMH--SQNVVHRDLKPENVLYLDPSDE 192

Query: 202 NNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQ---YRAPEMIDLYRCLPIDEKS 258
           +   + DFG                L + +  +H       Y APE++         +  
Sbjct: 193 SQLVISDFGIAKQ------------LSSESQLIHRAAGSMGYVAPEVLTTSGH---GKPC 237

Query: 259 DIWALGIFLYKLLFYTTPF--ELTGQF----------AILHSKYDIPANNYSSKLINLII 306
           DIW+LG+  Y LL   +PF  E T  F             HS Y    NN S +    I+
Sbjct: 238 DIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY---WNNISKEAKQFIL 294

Query: 307 IMLAENPNLRPNIYQVI 323
             L   P  RP   +++
Sbjct: 295 RALTLTPARRPTAAELL 311

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 86/201 (42%), Gaps = 32/201 (15%)

Query: 186 LIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEM 245
           +I+RD+K EN+L+D   + KL DFG       +  T            +  TP Y APE+
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYT------------LCGTPDYIAPEV 311

Query: 246 IDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFA----ILHSKYDIP------AN 295
           +      P ++  D W+ G+ +Y++L   TPF  +        IL++    P      A 
Sbjct: 312 VS---TKPYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQ 368

Query: 296 NYSSKLINLIIIML-------AENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFD 348
           +  SKLI   +          +E+    P   +V+++      ++ P+E   Q G  D  
Sbjct: 369 DLISKLITRDLSQRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTS 428

Query: 349 KYSKYQEKLQAFQYQLYISYH 369
           +Y +Y E+   +  Q    YH
Sbjct: 429 QYDRYPEEEVNYGIQGEDPYH 449

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VMK  K+  NIV + DS   +        ++ ++ME     SL D +   +   L+
Sbjct: 664 NEILVMKGSKHP-NIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E ++  +  +    +  +H     ++HRDIK +N+L+  E + KL DFG     F     
Sbjct: 713 EGQIGAVCRETLSGLEFLHS--KGVLHRDIKSDNILLSMEGDIKLTDFG-----FCAQIN 765

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
             ++   T    +  TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 766 ELNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 84/177 (47%), Gaps = 34/177 (19%)

Query: 156  LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS-- 213
            L T ++E E   +   V   +  +H     ++HRDIK ENV+VD++   KL DFGS +  
Sbjct: 1071 LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYV 1128

Query: 214  SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLL 271
               P             +++V T   Y APE++  + Y   P     DIWA+G+ LY ++
Sbjct: 1129 KSGPF------------DVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTII 1171

Query: 272  FYTTPFE-----LTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVI 323
            +   PF      L G   I  S +++     S++ + LI  +L  + + RP I  ++
Sbjct: 1172 YKENPFYNIDEILDGDLRI-QSTHEV-----SAECVALIRKILNRSVSKRPTIDDIM 1222

>Scas_640.14*
          Length = 728

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 20/146 (13%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + +++E         Y+ ++   +L E    ++   +   V+ MH     ++HRD+K+EN
Sbjct: 121 IGIVLEYASGGEFYKYVQRK--RRLKEATACRLFAQLISGVSYMH--SKGIVHRDLKLEN 176

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI---DLYRCL 252
           +L+D   N  + DFG  +  +       D  L+  +     +P Y APE++   + Y+  
Sbjct: 177 LLLDKHENLIITDFGFVNEFYA------DNELMKTSC---GSPCYAAPELVITTEPYKA- 226

Query: 253 PIDEKSDIWALGIFLYKLLFYTTPFE 278
               K+DIW+ GI LY +L    P++
Sbjct: 227 ---RKADIWSCGIILYGMLAGYLPWD 249

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 92/192 (47%), Gaps = 17/192 (8%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + ++ME C   S  + +      K++E++   I+ +V   +  +H      IHRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLH--SQRKIHRDIKSAN 148

Query: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255
           +L+    + KL DFG +     +M T +       + +V  TP + APE+ID  +    +
Sbjct: 149 ILLTDNGHVKLGDFGVSGQ---MMVTRK------RDTFV-GTPFWMAPEVIDRNK-QGYN 197

Query: 256 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHS--KYDIPA--NNYSSKLINLIIIMLAE 311
           E +DIW+LGI + +LL    P +       L +  K D P     +SS   + +   L +
Sbjct: 198 EMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIK 257

Query: 312 NPNLRPNIYQVI 323
           +P+ RP   +++
Sbjct: 258 DPSQRPTAAELL 269

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 79/165 (47%), Gaps = 20/165 (12%)

Query: 160  LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIM 219
            + E E   +   V  ++  +H     ++HRDIK ENV+VDS    KL DFGS +      
Sbjct: 947  MVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAY----- 999

Query: 220  TTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
                 I     +++V T   Y APE++    Y+  P     DIWALG+ LY +++   P+
Sbjct: 1000 -----IKSGPFDVFVGTM-DYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY 1049

Query: 278  ELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQV 322
                +      ++D  + + S + I+LI  +L    + RP I ++
Sbjct: 1050 YNIDEILEGELRFD-KSEHVSEECISLIKRILTREVDKRPTIDEI 1093

>Scas_643.20
          Length = 1082

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 80/171 (46%), Gaps = 24/171 (14%)

Query: 156  LATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST--S 213
            L   ++E E   I   V   +  +H     ++HRDIK ENV+VDS+ + KL D+GS   +
Sbjct: 924  LKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLIDYGSAAYT 981

Query: 214  SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI--DLYRCLPIDEKSDIWALGIFLYKLL 271
               P             +++V T   Y APE++   +Y   P     DIWA+GI LY ++
Sbjct: 982  KSGPF------------DVFVGTI-DYAAPEVLGGSVYDGKP----QDIWAIGILLYTII 1024

Query: 272  FYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQV 322
            F   PF    +      +++  A N S   I LI  +L  +   RP + ++
Sbjct: 1025 FKENPFYNIDEIMDGELRFN-DAGNTSEACIKLIKKILNRSIVDRPCVDEI 1074

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 131/317 (41%), Gaps = 67/317 (21%)

Query: 37  LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGD-LACLKRVLVT--D 93
           +I V   + E ++ L  GG + +Y VK                 G+ +  LKRV     D
Sbjct: 432 IITVNDSQYEKIELLGRGGSSRVYKVK---------------GSGNRVYALKRVSFDAFD 476

Query: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153
           ++ ++  + E+E++++LK+   ++Q  D       DG     +L L+  C +  L   +N
Sbjct: 477 DSSIDGFKGEIELLEKLKDQKRVIQLLDYEMG---DG-----LLYLIMECGDHDLSQILN 528

Query: 154 QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN-VLVDSENNFKLCDFGST 212
           QR    L    V     ++   +  +H     ++H D+K  N VLV  +   K+ DFG  
Sbjct: 529 QRSGMPLDFNFVRFYTKEMLLCIKVVH--DAGIVHSDLKPANFVLV--KGILKIIDFG-I 583

Query: 213 SSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRC------------LPIDEK 257
           ++  P  T          NIY  T   TP Y APE +                   +   
Sbjct: 584 ANAVPEHTV---------NIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRP 634

Query: 258 SDIWALGIFLYKLLFYTTPF-ELTGQ---FAILHSKYDIPANNYSSK-------LINLII 306
           SD+W+ G  +Y++++   P+    GQ    AI++    IP   ++S         I L+ 
Sbjct: 635 SDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMK 694

Query: 307 IMLAENPNLRPNIYQVI 323
             L  NP+ R  + +V+
Sbjct: 695 ACLYRNPDKRWTVDKVL 711

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 99/218 (45%), Gaps = 36/218 (16%)

Query: 84  ACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELC 143
           A +K++    ++G      ++ ++K+L + +NIV YY S+         G  + + +E  
Sbjct: 468 AVVKKLTDPPQDGGRASSTKMNLLKELHH-ENIVTYYGSSQE-------GGNLNIFLEYV 519

Query: 144 PNKSLLDYMN------QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           P  S+   +N      + L    + + ++ + Y   K +          IHRDIK  N+L
Sbjct: 520 PGGSVSSMLNSYGPFEEPLVKNFTRQTLVGLTYLHRKNI----------IHRDIKGANLL 569

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEK 257
           +D + + K+ DFG +    P+       A L  ++Y      + APE++   + +   EK
Sbjct: 570 IDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVY------WMAPEVV---KQVVTTEK 620

Query: 258 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPAN 295
           +DIW++G  + ++     PF     F+ + + + I  N
Sbjct: 621 ADIWSVGCVVVEMFTGKHPFP---DFSQMQAIFKIGTN 655

>Scas_700.35
          Length = 439

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 88/193 (45%), Gaps = 26/193 (13%)

Query: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL 148
            L TD     +L  E+E  K  K S+ IV YY    +   +GS    + + ME    +SL
Sbjct: 183 TLNTDPEFQKQLFRELEFNKSFK-SNYIVTYYGM-FNDTLNGS----IYIAMEYMGGQSL 236

Query: 149 LDYMNQRL---ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205
            D + + L     ++ EK + KI   V + ++ +H     +IHRDIK +N+L++ E   K
Sbjct: 237 -DTIYKSLLSRGGRIGEKILGKIAESVLRGLSYLH--ERKIIHRDIKPQNILLNEEGEVK 293

Query: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265
           LCDFG +      + T               T  Y APE I  +   P     D+W+LG+
Sbjct: 294 LCDFGVSGEAVNSLATT-----------FTGTSFYMAPERIQGH---PYSVTCDVWSLGL 339

Query: 266 FLYKLLFYTTPFE 278
            + ++     PF+
Sbjct: 340 TILEVAQGRFPFD 352

>Scas_602.11
          Length = 1186

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 132/331 (39%), Gaps = 98/331 (29%)

Query: 98  NELRNEVEVMKQL--KNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR 155
           + ++ E+ +MK+L  K+   +++  D   SR+        + L++E C    +       
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSRK--------IYLVLEYCAQGEIKWCPKDC 277

Query: 156 LATK------LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
           L T+      LS +   +I+  V   +  +H+    +IHRDIK  N+LVD E   K+ DF
Sbjct: 278 LETEAKGPPLLSFQSAREIIRGVILGLEYLHY--QGIIHRDIKPANLLVDEEGTVKISDF 335

Query: 210 G----------STSSCFPIM---------TTHQDIALLTNN----------IYVHTTPQY 240
           G          ST++   ++         ++ + +    NN               TP +
Sbjct: 336 GVSLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAF 395

Query: 241 RAPEMI--------------DLYRCLPIDEKSDIWALGIFLYKLLFYTTPF--------- 277
            APE+               ++++   I    DIWALGI  Y LLF   PF         
Sbjct: 396 FAPEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELF 455

Query: 278 -ELTGQFAILHSKYDIPANNYSS--------KLINLIIIMLAENPNLRPNIYQVIYQ--V 326
            ++ G+     S  ++ AN  S+           N++  +L +NP+ R +I ++ Y   +
Sbjct: 456 EKIVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKYHPFI 515

Query: 327 CAIMKVDVPFEDKYQTGPYDFDKYSKYQEKL 357
           C                 +DFD +++  E L
Sbjct: 516 C-----------------WDFDHFAELNEDL 529

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 104/244 (42%), Gaps = 42/244 (17%)

Query: 133 GYEVLLLMELCPNKSLLDYM--NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRD 190
            ++V ++M+      L   +  +QR    +++       Y     +A  +     +I+RD
Sbjct: 146 AHQVFMIMDYIEGGELFSLLRKSQRFPNPVAK------FYAAEVCLALEYLHSKDIIYRD 199

Query: 191 IKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYR 250
           +K EN+L+D   + KL DFG       +  T            +  TP Y APE++    
Sbjct: 200 LKPENILLDKNGHIKLTDFGFAKYVPDVTYT------------LCGTPDYIAPEVVS--- 244

Query: 251 CLPIDEKSDIWALGIFLYKLLFYTTPF---ELTGQFA-ILHSKYDIPANNYSSKLINLII 306
             P ++  D W+ GI +Y++L   TPF      G +  IL+++   P   +++K+ +L+ 
Sbjct: 245 TKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPP-FFNAKVRDLLS 303

Query: 307 IMLAENPNLR--------------PNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSK 352
            ++  + + R              P   +VI+       ++ P+E     G  D  +Y +
Sbjct: 304 QLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDR 363

Query: 353 YQEK 356
           Y E+
Sbjct: 364 YPEE 367

>KLLA0C16577g complement(1451181..1452695) some similarities with
           sp|P06784 Saccharomyces cerevisiae YDL159w STE7
           ser/thr/tyr protein kinase of MAP kinase kinase family,
           hypothetical start
          Length = 504

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 89/186 (47%), Gaps = 32/186 (17%)

Query: 98  NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM----- 152
           N+L  E+ +MK +   DNIV +Y +      + S   E+++LME     SL   +     
Sbjct: 207 NQLVRELTIMKNVSAHDNIVGFYGAFY----NPSTTNEIVILMEYMDCGSLDKILSVYRS 262

Query: 153 -----NQRLATKLS---EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF 204
                N  ++ K S   E  + +I + V   +  ++     +IHRDIK  N+L++S+ + 
Sbjct: 263 DCHRKNVSISCKTSWFNEMPLSRISFCVLNGLIYLYDC-YKIIHRDIKPSNILINSKGDV 321

Query: 205 KLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264
           K+CDFG +++    +           + +V T+  Y +PE I   R      K D+W+LG
Sbjct: 322 KICDFGVSTTLINSLA----------DTFVGTS-TYMSPERIQGGR---YTTKGDVWSLG 367

Query: 265 IFLYKL 270
           + + +L
Sbjct: 368 LMIIEL 373

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 95/205 (46%), Gaps = 31/205 (15%)

Query: 79  KEGDLACLKRVLVT-DENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVL 137
           K+  +  +KR  +T D +   ++  E+  +K L +  NIV+  +   + +  G       
Sbjct: 92  KQVAIKLIKRDFITKDPSKETKIYREINALKHLSHP-NIVKLEEVLQNSKYIG------- 143

Query: 138 LLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL 197
           +++E         ++ ++   +L E    ++   +  AV  +H     L+HRD+K+EN+L
Sbjct: 144 IVLEYAAGGEFYKFIQRK--RRLKENHACRLFSQLISAVHYIH--SKGLVHRDLKLENLL 199

Query: 198 VDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMIDLYRCLPI 254
           +D+E N  + DFG  +              L  N  + T   +P Y APE++   R  P 
Sbjct: 200 LDNEENLIITDFGFVNE------------FLRQNGMMKTSCGSPCYAAPELVVSNR--PY 245

Query: 255 D-EKSDIWALGIFLYKLLFYTTPFE 278
           D  K+D W+ GI L+ +L    P++
Sbjct: 246 DARKADTWSCGIILFAMLAGYLPWD 270

>Kwal_26.8703
          Length = 444

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 114/269 (42%), Gaps = 48/269 (17%)

Query: 78  LKEGDLACLKRVLVTDENGLNELRNEVEVMKQLK-----NSDNIVQYYDSNASRRRDGSP 132
           LK G +    + + T  +   +   + +V+++L+     +S+ IV+YY   A        
Sbjct: 176 LKGGSMVFALKTITTANS---DPETQKQVLRELQFNRSCSSEYIVRYYGMFAEESTS--- 229

Query: 133 GYEVLLLMELCPNKSLLDYMNQRL---ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHR 189
              + + ME    KSL D + + L     ++ EK + KI   V K ++ +      +IHR
Sbjct: 230 --SIYIAMEYMGGKSL-DAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQ--ERKIIHR 284

Query: 190 DIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLY 249
           DIK +N+L++     KLCDFG +            +A+ +       T  Y APE I   
Sbjct: 285 DIKPQNILLNEAGQVKLCDFGVSG-----------VAVNSLATTFTGTSFYMAPERI--- 330

Query: 250 RCLPIDEKSDIWALGIFLYKLLFYTTPFE-------------LTGQFAILHSKYDIPANN 296
           +  P    SD+W+LG+ L ++     PF              L        +  DIP +N
Sbjct: 331 QGQPYSVTSDVWSLGLTLLEVAQGQFPFGSDNMAANMPPIELLMLILTFTPALKDIPESN 390

Query: 297 --YSSKLINLIIIMLAENPNLRPNIYQVI 323
             +S    + I   L + P  RP+  Q++
Sbjct: 391 VTWSKSFKSFIQYCLNKEPRDRPSPRQML 419

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 85/191 (44%), Gaps = 24/191 (12%)

Query: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL 148
           +L  D     +L  E++  K  K S+ IV+Y+      +        + + ME    KSL
Sbjct: 213 ILNGDPEFQKQLLRELQFNKSFK-SEYIVRYFGMFTDEQNS-----SIYIAMEYMGGKSL 266

Query: 149 LDYMNQRL--ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206
                + L    ++SEK + KI   V + ++ +H     +IHRDIK +N+L++ +   KL
Sbjct: 267 EAIYKELLSRGGRISEKVLGKISEAVLRGLSYLH--EKKVIHRDIKPQNILLNEDGQVKL 324

Query: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266
           CDFG +      + T       T   Y      Y APE I   +  P     D+W+LG+ 
Sbjct: 325 CDFGVSGEAVNSLATT-----FTGTSY------YMAPERI---QGQPYSVTCDVWSLGLT 370

Query: 267 LYKLLFYTTPF 277
           + ++     PF
Sbjct: 371 ILEVAQGHFPF 381

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 123/268 (45%), Gaps = 38/268 (14%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNE-----LETPSSSLKEGDLACLKRVLVTDENGLNEL 100
           ++V+   +G    +Y+ K ++   E     L++    +  G+   +K++ ++++     +
Sbjct: 361 QLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVV-GERVAIKQIRLSEQPKKQLI 419

Query: 101 RNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ------ 154
            NE+ VM   +  +NIV + ++            E+ ++ME      L D ++       
Sbjct: 420 MNELLVMNDSR-QENIVNFLEAYIIDDE------ELWVIMEYMEGGCLTDILDAVARSNT 472

Query: 155 -RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS 213
              ++ L+E ++  I+ +  + +  +H     +IHRDIK +N+L++S+   K+ DFG   
Sbjct: 473 GEHSSPLNENQMAYIVKETCQGLKFLH--NKKIIHRDIKSDNILLNSQGLVKITDFG--- 527

Query: 214 SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 273
            C  +       A +        TP + APE+++       DEK D+W+LGI L +++  
Sbjct: 528 FCVELTEKRSKRATMVG------TPYWMAPEIVNQK---GYDEKVDVWSLGIMLIEMIEG 578

Query: 274 TTPFELTGQFAILHSKYDIPANNYSSKL 301
             P+        L+    + ANN S KL
Sbjct: 579 EPPYLNEDPLKALY----LIANNGSPKL 602

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 108/265 (40%), Gaps = 67/265 (25%)

Query: 51   LAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV-----TDENGLNELRNEVE 105
            + +G F  +Y+               ++  G++  +K+V V      DE  +N     + 
Sbjct: 1130 IGKGSFGAVYL-------------GLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALIS 1176

Query: 106  VMKQLKNSD--NIVQYYDSNASRRRDGSPGYE-----VLLLMELCPNKSLLDYMNQRLAT 158
             +  LK+ D  NIVQY             G+E       L +E     S+   +  RL  
Sbjct: 1177 EVSTLKDLDHLNIVQYL------------GFENKNCIYSLFLEYVAGGSVGSLI--RLYG 1222

Query: 159  KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
               E+ +  +   V + +A +H     ++HRD+K +N+L+D++   K+ DFG        
Sbjct: 1223 HFDEQLIRFLTTQVLEGLAYLHL--RGILHRDMKADNLLLDNDGVCKISDFG-------- 1272

Query: 219  MTTHQDIALLTNNIY------VHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 272
                  I+  +NNIY      +  T  + APEM+D  +      K DIW+LG  + ++  
Sbjct: 1273 ------ISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEMFA 1324

Query: 273  YTTPFE----LTGQFAILHSKYDIP 293
               P+     +   F I  SK   P
Sbjct: 1325 GKRPWSNLEVVAAMFQIGKSKSAPP 1349

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 100/233 (42%), Gaps = 42/233 (18%)

Query: 46  EIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRV--LVTDENGLNELRNE 103
           EI+++L +G +  +  VKF     +  +P++ +       +K++  +   E  L     E
Sbjct: 39  EIIQFLGKGAYGTVCSVKF-----KGRSPAARIA------VKKISNIFNKEILLKRAIRE 87

Query: 104 VEVMKQLKNSDNIVQYYDSN--ASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL---AT 158
           ++ M   K   NIV   D     S   DG   Y+            L+DY   ++   + 
Sbjct: 88  LKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQ-----------ELIDYDLAKVIHSSV 136

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST----SS 214
           +LSE  +   +Y +   +  +H     +IHRD+K  N+L       K+CDFG      + 
Sbjct: 137 QLSEFHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAG 194

Query: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFL 267
            F   +T Q    +TN +    T  YRAPE+  L    P  +  DIWA+G  L
Sbjct: 195 FFKCHSTVQ--PHITNYV---ATRWYRAPEL--LLSNQPYSKSVDIWAVGCIL 240

>Scas_720.103
          Length = 804

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 86/204 (42%), Gaps = 28/204 (13%)

Query: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + L ME C        +  R +  + E +      +V  A+  +H L    I+RD+K EN
Sbjct: 478 LYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLG--FIYRDLKPEN 535

Query: 196 VLVDSENNFKLCDFG----STSSCFPIMTTHQDIALLTNNIYVHT--------------T 237
           +L+    +  L DF     +  S  PI      +    +N+ V T              T
Sbjct: 536 ILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGT 595

Query: 238 PQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYDIP 293
            +Y APE+I   R        D W LGI ++++LF  TPF+       FA IL   ++ P
Sbjct: 596 EEYIAPEVI---RGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFP 652

Query: 294 -ANNYSSKLINLIIIMLAENPNLR 316
            +N+ +    NLI  +L +N   R
Sbjct: 653 NSNDITRNCKNLIKKLLTKNETKR 676

>Scas_668.22
          Length = 893

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 84/176 (47%), Gaps = 25/176 (14%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           NE+ VMK  ++  NIV + DS      DG    ++ ++ME     SL D +   +   L+
Sbjct: 655 NEILVMKGSRHP-NIVNFIDSYL---LDG----DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           E ++  +  +    +  +H     ++HRDIK +N+L+    + KL DFG    C  I   
Sbjct: 704 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSISGDIKLTDFG---FCAQI--- 755

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
             +I L    +    TP + APE++      P   K DIW+LGI + +++    P+
Sbjct: 756 -NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>Scas_584.11
          Length = 1074

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 83/191 (43%), Gaps = 41/191 (21%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EV+++ ++    NIV   D            ++  ++ME C    L + +   L  K + 
Sbjct: 108 EVDILTKVGKHKNIVSLVDY-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKT- 155

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS-ENNFKLCDFGSTSSCFPIMTT 221
           K +  I   +  A+  +H     + HRDIK EN+L+   +   KL D+G       + TT
Sbjct: 156 KTITHIFSQIMDAIEFVH--GKSIYHRDIKPENILITGIDWTIKLTDWG-------LATT 206

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMID----------LYRCLPIDEKSDIWALGIFLYKLL 271
           H+     T+      + +Y APE+ +           Y+C    +K D+WA+GI    ++
Sbjct: 207 HE-----TSFDRSVGSERYMAPELFESNLDIEERKEAYKC----DKVDLWAMGIVFLNIV 257

Query: 272 FYTTPFELTGQ 282
           F   PF +  Q
Sbjct: 258 FQKNPFSVANQ 268

>Kwal_27.9763
          Length = 868

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 95/201 (47%), Gaps = 33/201 (16%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           E++++K LK+ +NIV+Y+             +++ +L+E C   SL D + +     + E
Sbjct: 68  EIDLLKNLKH-ENIVKYHGFIQK-------SHQLFILLEYCSQGSLRDLIKR---GPVEE 116

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTH 222
           ++    +      +  +H     +IHRDIK  N+L+D++N  KL DFG ++    +  T+
Sbjct: 117 QQCKTYIRQTLHGLKYLH--DQGVIHRDIKAANLLLDAQNVVKLADFGVSTRVNNLAMTY 174

Query: 223 QDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE---- 278
                         +P + APE++       +   SDIW+LG  + ++L    PF     
Sbjct: 175 AG------------SPNWMAPEVMMGQGASTV---SDIWSLGATVVEILTGNPPFHNLVN 219

Query: 279 LTGQFAILHSKYDIPANNYSS 299
               +AI+H  Y IP +  SS
Sbjct: 220 EAACYAIVHDVY-IPPSTLSS 239

>Kwal_0.96
          Length = 427

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 132/296 (44%), Gaps = 59/296 (19%)

Query: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145
           LK+ L   +  L  L +E+ ++++L +  NIV++ D   S+ +         ++ +L   
Sbjct: 78  LKKALKGKDVELQMLYDELSILQKLDHP-NIVKFKDWFESKDK-------FYIVTQLATG 129

Query: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSE---N 202
             L D + ++   K +E++ ++I+Y + KAV  +H     ++HRD+K EN+L  +E   +
Sbjct: 130 GELFDRILKQ--GKFTEEDAVRIVYQILKAVEYLH--SRNIVHRDLKPENLLYLTEAADS 185

Query: 203 NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQ---YRAPEMIDLYRCLPIDEKSD 259
              L DFG                L  ++  +H       Y APE++         +  D
Sbjct: 186 QLVLGDFGIAKE------------LKNDDELIHKAAGSMGYVAPEVV---TTSGHGKPCD 230

Query: 260 IWALGIFLYKLLFYTTPF----------ELT-GQFAI-LHSKYDIPANNYSSKLINLIII 307
           IW+LG+  Y LL   +PF          E T G+  +  H  Y    +N S++  + I+ 
Sbjct: 231 IWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPY---WSNISNEAKDFILR 287

Query: 308 MLAENPNLRPNIYQVIYQVCAIMKVD-----VPFEDKYQTGPYDFDKYSKYQEKLQ 358
            L  NP+ RP   +++     I K       +P   K      +FD  SK++E ++
Sbjct: 288 ALTVNPHDRPTATELLQDAWIISKTTKTANLLPGIRK------EFDARSKFREAVE 337

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 99/241 (41%), Gaps = 32/241 (13%)

Query: 91  VTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLD 150
           +TDE+    L  EV +  +     ++V+  D N SR         + + MEL     L D
Sbjct: 57  MTDED----LTREVVLQTRCAGHRHVVRVLDCNVSRE-------YLWIAMELADGGDLFD 105

Query: 151 YMNQRLATKLSEKEVLKIMYD-VTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
            +   +     + EV +  Y  + +A+  +H     + HRDIK EN+L+D   N K+ DF
Sbjct: 106 KIEPDVGV---DSEVARFYYQQLVRALTHLH-EACGVAHRDIKPENMLLDRAGNLKVADF 161

Query: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269
           G  +             L  +      T  Y APE++   R    D  +DIW+ G+ ++ 
Sbjct: 162 GLATR---FRRRDGTRRLARDR---RGTLPYLAPEVVG-ERAYHAD-TADIWSAGVLVFV 213

Query: 270 LLFYTTPFEL----TGQFAILHSK----YDIPANNYSSKLINLIIIMLAENPNLRPNIYQ 321
           LL   TP+       G F    +      D P        +NL+  ML + P  R  + Q
Sbjct: 214 LLTGETPWSEPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQ 273

Query: 322 V 322
           +
Sbjct: 274 L 274

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 102/237 (43%), Gaps = 41/237 (17%)

Query: 43  HKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRN 102
           H  +I++ L  G F  +++V+ V   N        LK+  +  +K++         E  N
Sbjct: 60  HDFQIMRTLGTGSFGRVHLVRSVH--NGRYYAIKVLKKHQIIRMKQI---------EHTN 108

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM--NQRLATKL 160
           +   M +L     +++ + +    R        + ++M+      L   +  +QR    +
Sbjct: 109 DERRMLKLVEHPFLIRMWGTFQDSR-------NLFMVMDYIEGGELFSLLRKSQRFPNPV 161

Query: 161 SEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMT 220
           ++        +VT A+  +H     +I+RD+K EN+L+D   + K+ DFG       +  
Sbjct: 162 AKFYAA----EVTLALEYLH--SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVITVTW 215

Query: 221 THQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
           T            +  TP Y APE+I      P ++  D W+LGI ++++L   TPF
Sbjct: 216 T------------LCGTPDYIAPEVI---TTKPYNKSVDWWSLGILIFEMLAGYTPF 257

>ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH]
           (1263082..1265541) [2460 bp, 819 aa]
          Length = 819

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 131/318 (41%), Gaps = 66/318 (20%)

Query: 37  LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT--DE 94
           +I V   + E V+ L  GG + +Y V+    SN +              LKRV     D+
Sbjct: 484 VITVNGSEYEKVELLGRGGSSKVYKVR--NSSNRI------------YALKRVSFDEFDD 529

Query: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154
              +  + E+E++K+L+N   +V+  D   +        + VL ++  C +  L   + Q
Sbjct: 530 ASADGFKGEIELLKKLENQTRVVKLIDHEMN--------HGVLYVVMECGDHDLSQVLAQ 581

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214
           R +  L  + V     ++ K V  +H     ++H D+K  N  V  +   K+ DFG  ++
Sbjct: 582 RSSMPLDIEFVRYHAQEMLKCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFG-IAN 637

Query: 215 CFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMIDL---------------YRCLPIDE 256
             P  T          NIY  T   TP Y APE +                 +    + +
Sbjct: 638 AVPDHTV---------NIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVGK 688

Query: 257 KSDIWALGIFLYKLLFYTTPF-ELTGQ---FAILHSKYDI------PANNYSSKL-INLI 305
            SDIW+ G  +Y++++   P+    GQ    AI++ +  I      P  ++  +  ++ I
Sbjct: 689 PSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDTI 748

Query: 306 IIMLAENPNLRPNIYQVI 323
              L  NP  R  + +++
Sbjct: 749 KACLERNPERRWTVDELL 766

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 113/270 (41%), Gaps = 55/270 (20%)

Query: 37  LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT--DE 94
           ++ V   + E V+ L  GG +++Y V+ ++                +  LK+V     DE
Sbjct: 439 VVSVNGTEYERVELLGRGGSSNVYKVRGLK--------------NRVYALKKVSFDEFDE 484

Query: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154
           + +   + E+ ++KQL+N + +VQ YD           G  VL L+  C +  L   ++Q
Sbjct: 485 SSVEGFKGEISLLKQLQNQNRVVQLYDFEM--------GSGVLYLLMECGDYDLSQVLHQ 536

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214
           R       + +     ++   V  +H     ++H D+K  N  V  +   K+ DFG  ++
Sbjct: 537 RANQPFDMEFIRYHAREMVTCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFG-IAN 592

Query: 215 CFPIMTTHQDIALLTNNIYVHT---TPQYRAPEMI--DLYRC------------LPIDEK 257
             P  T          NIY      TP Y APE +  + Y                I + 
Sbjct: 593 AVPDHTV---------NIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKP 643

Query: 258 SDIWALGIFLYKLLFYTTPF-ELTGQFAIL 286
           +DIW+ G  +Y++++   P+ +  GQ  +L
Sbjct: 644 ADIWSCGCIIYQMIYGKPPYAKYQGQERLL 673

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 99/237 (41%), Gaps = 41/237 (17%)

Query: 43  HKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRN 102
           H  +I++ L  G F  +++V+ V   N        LK+  +  +K+V         E  N
Sbjct: 68  HDFQIMRTLGTGSFGRVHLVRSVH--NGRYYAIKVLKKQQVVKMKQV---------EHTN 116

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM--NQRLATKL 160
           +   M +L     +++ + +    R        + ++M+      L   +  +QR    +
Sbjct: 117 DERRMLKLVEHPFLIRMWGTFQDAR-------NIFMVMDYIEGGELFSLLRKSQRFPNPV 169

Query: 161 SEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMT 220
           ++       Y     +A  +     +I+RD+K EN+L+D   + K+ DFG       +  
Sbjct: 170 AK------FYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTW 223

Query: 221 THQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
           T            +  TP Y APE+I      P ++  D W+LG+ +Y++L   TPF
Sbjct: 224 T------------LCGTPDYIAPEVIT---TKPYNKSVDWWSLGVLIYEMLAGYTPF 265

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 113/250 (45%), Gaps = 48/250 (19%)

Query: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145
           LK+ L  ++  L  L +E+ ++++L N  NIV++ D   S+ +         ++ +L   
Sbjct: 78  LKKALKGNDVQLQMLYDELMILQKL-NHPNIVKFKDWFESKEK-------FYIVTQLATG 129

Query: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVL-VDSENNF 204
             L D + Q+   K +E + +KI+  + KAV  +H     ++HRD+K EN+L +D  +N 
Sbjct: 130 GELFDRILQK--GKFTEVDAVKIVVQILKAVEYLH--SRNIVHRDLKPENLLYLDKSDNS 185

Query: 205 KLC--DFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQ---YRAPEMIDLYRCLPIDEKSD 259
           +L   DFG                L  +   +H       Y APE++         +  D
Sbjct: 186 QLVLGDFGIAKE------------LKNDGDLIHKAAGSMGYVAPEVL---TSNGHGKPCD 230

Query: 260 IWALGIFLYKLLFYTTPF----------ELT-GQFAI-LHSKYDIPANNYSSKLINLIII 307
           IW++G+  Y LL   +PF          E T GQ+ +  H  Y    NN S +    I+ 
Sbjct: 231 IWSIGVITYTLLCGYSPFIAESVDGFLEECTSGQYPVTFHKPY---WNNISKEAKLFILR 287

Query: 308 MLAENPNLRP 317
           +L  +P  RP
Sbjct: 288 VLTISPKKRP 297

>Scas_653.25
          Length = 666

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 75/152 (49%), Gaps = 11/152 (7%)

Query: 131 SPGYEVLLLMELCPNKSLLDYMNQRLATK--LSEKEVLKIMYDVTKAVAQMHFLPTPLIH 188
           +P  ++  +ME CP+    D+ N  ++    L+ +E       +   V  +H L   + H
Sbjct: 340 NPSGQISEIMEWCPH----DFFNIVMSRTHLLTRRETFCYFKQLCNGVRYLHTLG--IAH 393

Query: 189 RDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDL 248
           RD+K++N ++      KL DFGS +      +T +   L+ +   V + P Y APE++ L
Sbjct: 394 RDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIPSRGIVGSDP-YLAPEVL-L 451

Query: 249 YRCLPIDEK-SDIWALGIFLYKLLFYTTPFEL 279
            + +P D   +D+W+LGI    ++    P+ +
Sbjct: 452 SKEIPYDASLADVWSLGIIFCAIMLKRFPWRI 483

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 83/190 (43%), Gaps = 36/190 (18%)

Query: 186 LIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEM 245
           +I+RD+K EN+L+D   + K+ DFG       +  T            +  TP Y APE+
Sbjct: 271 IIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT------------LCGTPDYIAPEV 318

Query: 246 IDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYDIPA------- 294
           +      P ++  D W+ GI +Y++L   TPF     +     IL+S+   P+       
Sbjct: 319 VS---TKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQ 375

Query: 295 --------NNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYD 346
                    + S +L NL     +E+    P   +V+++      ++ P+E   Q G  D
Sbjct: 376 DLLSKLITRDLSKRLGNL--QNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGD 433

Query: 347 FDKYSKYQEK 356
             ++ +Y E+
Sbjct: 434 TSQFDRYPEE 443

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 84/182 (46%), Gaps = 38/182 (20%)

Query: 103 EVEVMKQLKNSDNI-VQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLS 161
           E+E+MK L++ + I ++YY      R D        + + L     +LDYM Q L  +L 
Sbjct: 78  ELEIMKMLQHRNIIDLKYYFYEIDERED--------VFLNL-----ILDYMPQSLYQRLR 124

Query: 162 ----------EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN-NFKLCDFG 210
                       E+   MY + KA+  +H     + HRDIK +N+LVD  +   +LCDFG
Sbjct: 125 HFVHQRTPMPRLEIKIYMYQLFKALNYLHHTAN-VCHRDIKPQNLLVDPNSWCLRLCDFG 183

Query: 211 STSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKL 270
           S     P   T  +++ + +         YRAPE+I  +       + DIW+ G  + +L
Sbjct: 184 SAKQLKP---TEPNVSYICSR-------YYRAPELI--FGATNYTNQIDIWSSGCVMAEL 231

Query: 271 LF 272
           L 
Sbjct: 232 LL 233

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 79/166 (47%), Gaps = 26/166 (15%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK-L 160
            E+ ++K+LK+ DNIV+ YD   S   D    Y V   +EL     L  YM      + L
Sbjct: 54  REISLLKELKD-DNIVRLYDIVHS---DAHKLYLVFEFLEL----DLKRYMESVPKDQPL 105

Query: 161 SEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG-STSSCFPIM 219
            +K + K M  + K +A  H     +IHRD+K +N+L++   N KL DFG + +   P+ 
Sbjct: 106 GDKIIKKFMMQLCKGIAYCH--AHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLR 163

Query: 220 T-THQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264
             TH+ + L            YRAPE+  L          D+W++G
Sbjct: 164 AYTHEIVTL-----------WYRAPEV--LLGGKQYSTGVDVWSIG 196

>Kwal_33.14167
          Length = 838

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 126/312 (40%), Gaps = 60/312 (19%)

Query: 37  LIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT--DE 94
           ++ V   + E ++ L  GG + +Y VK             +     +  LKRV     D+
Sbjct: 507 VVYVNGTEYEKLELLGRGGTSKVYKVK-------------NANNNKVYALKRVSFDEFDD 553

Query: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154
           + ++  + E+E++K+L+    +V+  D            + VL ++  C +  L   +  
Sbjct: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMD--------HGVLYVVMECGDHDLSQTLAH 605

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214
           R    L  + V     ++ K V  +H     ++H D+K  N  V  +   K+ DFG  ++
Sbjct: 606 RSGMPLDVEFVRYHAQEMLKCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFG-IAN 661

Query: 215 CFPIMTTHQDIALLTNNIYVHT---TPQYRAPE----MIDLYRCLP------IDEKSDIW 261
             P  T          NIY  T   TP Y APE    M   +   P      + + SDIW
Sbjct: 662 AVPEHTV---------NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIW 712

Query: 262 ALGIFLYKLLFYTTPF-ELTGQ---FAILHSKYDI-------PANNYSSKLINLIIIMLA 310
           + G  +Y++++   P+    GQ    AI++ +  I         +      I+ +   L 
Sbjct: 713 SCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLE 772

Query: 311 ENPNLRPNIYQV 322
            NPN R  + +V
Sbjct: 773 RNPNKRWTVEEV 784

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 92/211 (43%), Gaps = 44/211 (20%)

Query: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSE---- 201
           K LL++   R+   L+ ++++ I  D+   + Q+H L   +IHRD+K  N L+  E    
Sbjct: 199 KKLLNHKKSRIG--LTTRQIVSIANDIATGLKQLHSLR--IIHRDLKPSNCLLLEEFDRS 254

Query: 202 --NNFKLC---DFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDE 256
             + F  C   DFG +          Q    L +      T ++ APE   L +      
Sbjct: 255 DTDKFPKCVIGDFGES----------QLYGQLRDATGSTGTVEFVAPE---LTKGAQFSF 301

Query: 257 KSDIWALGIFLYKLLFYTTPFELTGQFAI----------------LHSKYDIPANNYSSK 300
           KSDI+A G+ LY ++    PF      AI                LH   D+   + S  
Sbjct: 302 KSDIYAFGMILYFVIMGQLPFNSKDMSAIKHEINELSFSPEAMSKLHDSLDLAPIDPS-- 359

Query: 301 LINLIIIMLAENPNLRPNIYQVIYQVCAIMK 331
           L NL+  ML   P+LRP+  Q+ YQ+  IMK
Sbjct: 360 LYNLVCEMLNHTPSLRPDSSQIEYQLNIIMK 390

>Scas_711.25
          Length = 1515

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 108/260 (41%), Gaps = 57/260 (21%)

Query: 51   LAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNE--------LRN 102
            + +G F  +Y+   V               G++  +K+V V   +  +E        LR+
Sbjct: 1220 IGKGSFGAVYLCLNVT-------------TGEMMAVKQVEVPKYSSQDEAIISTVEALRS 1266

Query: 103  EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE-----VLLLMELCPNKSLLDYMNQRLA 157
            EV  +K L +  NIVQY             G+E       L +E     S+   +  R+ 
Sbjct: 1267 EVSTLKDLDHL-NIVQYL------------GFENKDNIYSLFLEYVAGGSVGSLI--RMY 1311

Query: 158  TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
             +  E  +  +   V + +A +H     ++HRD+K +N+L+D +   K+ DFG       
Sbjct: 1312 GRFDEPLIRHLNTQVLRGLAYLH--SRGILHRDMKADNLLLDQDGVCKISDFG------- 1362

Query: 218  IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF 277
            I    +DI    +++ +  T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1363 ISRKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1419

Query: 278  E----LTGQFAILHSKYDIP 293
                 +   F I  SK   P
Sbjct: 1420 SNYEVVAAMFKIGKSKSAPP 1439

>Kwal_55.20189
          Length = 812

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 85/187 (45%), Gaps = 33/187 (17%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSE 162
           EV++  ++    NI + YD            ++  ++ME C    L + +   L  K + 
Sbjct: 107 EVDIHTKVGKHKNITELYDF-----------FDSFIVMEYCSGGDLYEAIKADLIPKRT- 154

Query: 163 KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVD-SENNFKLCDFGSTSSCFPIMTT 221
           K +  I   + +A+  +H     + HRD+K EN+L++ S+   KL D+G  ++      T
Sbjct: 155 KVITHIASQIMEAIEFVH--QKGIYHRDLKPENILIEGSDWTIKLTDWGLATT----EPT 208

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLY-----RCLPID-EKSDIWALGIFLYKLLFYTT 275
             D ++         + +Y APE+ +       R  P D  K D+WA+GI L  ++F   
Sbjct: 209 SLDRSV--------GSERYMAPELFEENLDRDERSEPYDCSKVDLWAIGIVLLNIVFQKN 260

Query: 276 PFELTGQ 282
           PF +  Q
Sbjct: 261 PFSVANQ 267

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 72/170 (42%), Gaps = 23/170 (13%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRR--DGSPGYEVLLLMELCPNKSLLDYMNQRLA--- 157
           E++ M   K   NIV   +      +  DG   Y+            L+DY   R+    
Sbjct: 123 ELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQ-----------ELIDYDLARVIHSN 171

Query: 158 TKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFP 217
            + SE  +    Y +   V  +H     +IHRD+K  N+L       K+CDFG      P
Sbjct: 172 VQFSEFHIKHFTYQILCGVKYIH--SADVIHRDLKPGNILCSISGQLKICDFGLARGISP 229

Query: 218 IMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFL 267
           + T  +    +TN +    T  YRAPE+I  ++    ++  D+WA+G  L
Sbjct: 230 LFTNTKTSNHITNYV---ATRWYRAPELILSHK--RYNKSIDMWAIGCIL 274

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 108/234 (46%), Gaps = 45/234 (19%)

Query: 48  VKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVM 107
           V  + +G F+ +Y V F         P + LK      +K V  T  N  N +  E+ ++
Sbjct: 399 VSIMGKGQFSTVYQVTF---------PETGLK----YAIKSVRPTKHNFTNRILQEINML 445

Query: 108 KQLKNS--------DNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK 159
             +++S        + IV++  S + +   GS      ++ E C N +L  ++ + +  K
Sbjct: 446 STIQDSVTNDTEGKEYIVEFISSWSHK---GS----FYIMTEFCENGNLDAFIQEHVIAK 498

Query: 160 ---LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
              L +  + KI+ ++  A+  +H     ++H D+K  NVL+  E N KL DFG  ++  
Sbjct: 499 QQRLEDWRIWKIIVEICLALRFIHD-SCSIVHLDLKPANVLITFEGNLKLADFG-MATKL 556

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKL 270
           PI    +D +            +Y APE+I   R    D ++DI++LG+ + ++
Sbjct: 557 PI----EDKSFENEG-----DREYIAPEII---RDGIYDFRADIFSLGLMMIEI 598

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 96/255 (37%), Gaps = 41/255 (16%)

Query: 39  IVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLN 98
           +VG    E ++ L +G    +Y+V+        E  S  L    L    +  +     + 
Sbjct: 455 VVGPQSFEKIRLLGQGDVGKVYLVR--------EKKSDRLYA--LKIFGKAEMIKRKKIK 504

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
            +  E E++    N   IV  Y S  +          + L ME C        +  R   
Sbjct: 505 RILAEQEILA-TSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRALQTRKTK 556

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF--------- 209
            +SE +      +VT A+  +H +    I+RD+K EN+L+    +  L DF         
Sbjct: 557 CISEDDARFYASEVTAALEYLHLMG--FIYRDLKPENILLHQSGHVMLSDFDLSVQAKGT 614

Query: 210 ------GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWAL 263
                 G+  S         D    TN+     T +Y APE+I   R        D W L
Sbjct: 615 RNPQVKGNAQSSLVDTKVCSD-GFRTNSFV--GTEEYIAPEVI---RGNGHTASVDWWTL 668

Query: 264 GIFLYKLLFYTTPFE 278
           GI  Y++LF  TPF+
Sbjct: 669 GILTYEMLFGFTPFK 683

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 63/145 (43%), Gaps = 20/145 (13%)

Query: 138 LLMELCP---NKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
           L ME  P      +L Y    L   L  K V    Y + + +  +H L   + HRDIK  
Sbjct: 105 LAMECLPEMLQNEILRYKKNNLELPL--KHVKLYAYQIARGMLYLHALG--ICHRDIKPS 160

Query: 195 NVLVDSENN-FKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLP 253
           NVLVD +    K+CDFGS      + +    I+ + +         YRAPE+I    C  
Sbjct: 161 NVLVDPQTGILKICDFGSAKK---LESNQPSISYICSRY-------YRAPELI--VGCTQ 208

Query: 254 IDEKSDIWALGIFLYKLLFYTTPFE 278
              K DIW LG  L ++L     F+
Sbjct: 209 YTTKIDIWGLGCVLGEMLLGKAVFQ 233

>Scas_619.5*
          Length = 510

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 77/166 (46%), Gaps = 34/166 (20%)

Query: 138 LLMELCPNKSLLDYMNQ-RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENV 196
           +  +L P   L  Y+ +    T +SE E L I+Y + KA+  +H     ++HRD+K++N+
Sbjct: 246 IFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILKALHYIH--GRGIVHRDLKLDNI 303

Query: 197 LVDSE---NNFKLCDFGSTSSCFPIMTTHQDIALLTNNI-YVHTTPQYRAPE-------- 244
           L+ S        L DFG            +D++L    +  +  TP+Y APE        
Sbjct: 304 LLCSPEPCTRIVLADFG----------IAKDLSLKNTRMNTIVGTPEYCAPEVGFKATRS 353

Query: 245 MID--LYRCLPIDE-------KSDIWALGIFLYKLLFYTTPFELTG 281
           +ID    R   ID+       K DIW+LG+  + +L   +PF   G
Sbjct: 354 IIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDG 399

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 103/238 (43%), Gaps = 53/238 (22%)

Query: 44  KVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGD-LACLKRV--LVTDENGLNEL 100
           ++E +  L EG    +   K              LK G  +  LK +  L TD     ++
Sbjct: 220 RIETLGILGEGAGGSVSKCK--------------LKNGSKIFALKVINTLNTDPEYQKQI 265

Query: 101 RNEVEVMKQLKNSDNIVQYY-----DSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR 155
             E++  +  + S+ IV+YY     D N+S          + + ME    +SL D + + 
Sbjct: 266 FRELQFNRSFQ-SEYIVRYYGMFTDDENSS----------IYIAMEYMGGRSL-DAIYKN 313

Query: 156 L---ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST 212
           L     ++SEK + KI   V + ++ +H     +IHRDIK +N+L++     KLCDFG +
Sbjct: 314 LLERGGRISEKVLGKIAEAVLRGLSYLH--EKKVIHRDIKPQNILLNENGQVKLCDFGVS 371

Query: 213 SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKL 270
                 + T               T  Y APE I   +  P    SD+W+LG+ + ++
Sbjct: 372 GEAVNSLATT-----------FTGTSFYMAPERI---QGQPYSVTSDVWSLGLTILEV 415

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++ L++E+ ++K+L + +NIV YY ++         G  + + +E  P  S+   +N   
Sbjct: 498 VDALQHEMNLLKELHH-ENIVTYYGAS-------QEGGNLNIFLEYVPGGSVSSMLNN-- 547

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
                E  +      +   VA +H     +IHRDIK  N+L+D +   K+ DFG +    
Sbjct: 548 YGPFEESLITNFTRQILIGVAYLH--KKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 605

Query: 217 PIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 276
           P+       A L  +++      + +PE++   +      K+DIW+ G  + ++     P
Sbjct: 606 PLNKKQNKRASLQGSVF------WMSPEVV---KQTATTAKADIWSTGCVVIEMFTGKHP 656

Query: 277 F 277
           F
Sbjct: 657 F 657

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 75/152 (49%), Gaps = 32/152 (21%)

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM-----NQRL 156
            E+ ++K+LK+ DNIV+ YD   S   D    Y VL  ++L     L  YM     +Q L
Sbjct: 57  REISLLKELKD-DNIVRLYDIVHS---DAHKLYLVLEFLDL----DLKRYMESIPKDQPL 108

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG-STSSC 215
              +    + K M  + K +A  H     ++HRD+K +N+L+D E N KL DFG + +  
Sbjct: 109 GVNI----IKKFMVQLCKGIAYCH--AHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFG 162

Query: 216 FPIMT-THQDIALLTNNIYVHTTPQYRAPEMI 246
            P+   TH+ + L            YRAPE++
Sbjct: 163 VPLRAYTHEIVTL-----------WYRAPEVL 183

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 19/143 (13%)

Query: 136  VLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            +   ME      L+ ++ NQRL+ + ++       Y     +A   F    +I+RD+K+E
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKFFHDNGVIYRDLKLE 946

Query: 195  NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
            N+L+  E + K+ D+G    C   M      +          TP++ APE++   R    
Sbjct: 947  NILLTPEGHIKIADYG---LCKDGMWYGNKTSTFCG------TPEFMAPELL---REQDY 994

Query: 255  DEKSDIWALGIFLYKLLFYTTPF 277
             +  D WA G+ LY++L   +PF
Sbjct: 995  TKAVDWWAFGVLLYQMLLCQSPF 1017

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 67/144 (46%), Gaps = 21/144 (14%)

Query: 136  VLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            +   ME      L+ ++ NQRL+ + ++       Y     +A  +F    +I+RD+K+E
Sbjct: 898  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGIIYRDLKLE 951

Query: 195  NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHT-TPQYRAPEMIDLYRCLP 253
            N+L+  E + K+ D+G            +D     N       TP++ APE++   R   
Sbjct: 952  NILLTLEGHIKIADYGLC----------KDEMWFGNRTSTFCGTPEFMAPEIL---REQA 998

Query: 254  IDEKSDIWALGIFLYKLLFYTTPF 277
              +  D WA G+ LY++L   +PF
Sbjct: 999  YTKAVDWWAFGVLLYQMLLCQSPF 1022

>Kwal_47.17868
          Length = 365

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 32/199 (16%)

Query: 81  GDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNI-VQYYDSNASRRRDGSPGYEVLL- 138
           GD   +K+VL  D    N    E+E+MKQL++   + ++YY        +  P  EV L 
Sbjct: 59  GDRVAIKKVL-QDRRFKN---RELEIMKQLQHPQVVDLKYYFY------ETDPQGEVYLN 108

Query: 139 -LMELCPN---KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            ++E  P    + L  +++QR  + +   E+   MY + K++  +H     + HRDIK +
Sbjct: 109 LILEYMPQSLYQRLRHFVSQR--SNMPRIEIKLYMYQLAKSLNYLH-TNARVCHRDIKPQ 165

Query: 195 NVLVDSEN-NFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLP 253
           N+LVD +    KLCDFGS     P   +  +++ + +         YRAPE+I  +    
Sbjct: 166 NLLVDPQTFALKLCDFGSAKQLKP---SEPNVSYICSRY-------YRAPELI--FGASN 213

Query: 254 IDEKSDIWALGIFLYKLLF 272
              + DIW+ G  + +L+ 
Sbjct: 214 YTVQIDIWSSGCVMAELIL 232

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 72/156 (46%), Gaps = 22/156 (14%)

Query: 134 YEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKI 193
           ++  ++ME C    L + +      K + K +  I+  +  A+  +H     + HRDIK 
Sbjct: 154 FDSYIIMEYCSGGDLYEAIKADAVPKKT-KSITHIITQIMDAIEYVH--NKGIYHRDIKP 210

Query: 194 ENVLVDS-ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLY--- 249
           EN+L+   +   KL D+G       + TT  D   +  N+    + +Y +PE+ D     
Sbjct: 211 ENILISGIDWTIKLTDWG-------LATT--DKTSMDRNV---GSERYMSPELFDSNLDI 258

Query: 250 --RCLPID-EKSDIWALGIFLYKLLFYTTPFELTGQ 282
             R  P D  K D+WA+GI    ++F+  PF +  Q
Sbjct: 259 KERKEPYDCAKVDLWAMGIVFLNIVFHKNPFSIANQ 294

>Kwal_14.1416
          Length = 365

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 80/170 (47%), Gaps = 12/170 (7%)

Query: 103 EVEVMKQLKNSDNIVQYYDSNASRRRDGSPG-YEVLLLMELCPNKSLLDYMNQRLATKLS 161
           E++++K   + +NI+   D       D     Y V  LME   +K +           LS
Sbjct: 59  ELKLLKLFHSHENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVI-----SSGGASLS 113

Query: 162 EKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT 221
           +  +    Y + +A+  +H     +IHRDIK  N+L++S  + K+CDFG  + C  I +T
Sbjct: 114 DDHIQYFTYQILRALKAIH--SAQVIHRDIKPSNLLLNSNCDLKVCDFG-LARCL-ISST 169

Query: 222 HQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLL 271
           H    L+        T  YRAPE++  ++   +    DIW+ G  L +++
Sbjct: 170 HSRQNLVGFMTEYVATRWYRAPEIMLTFQQYTV--AMDIWSCGCILAEMI 217

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 87/182 (47%), Gaps = 22/182 (12%)

Query: 97  LNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++ L++E+ ++K+L++ +NIV YY S+         G  + + +E  P  S+   ++   
Sbjct: 456 IDALQHEMSLLKELQH-ENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLSN-- 505

Query: 157 ATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCF 216
                E  ++     +   VA +H     +IHRDIK  N+L+D +   K+ DFG +    
Sbjct: 506 YGPFEEPLIVNFTRQILIGVAYLH--RKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 563

Query: 217 PIMTTHQDIAL-LTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTT 275
           P+   +QD    L  ++Y      + +PE++   +      K+DIW+ G  + ++     
Sbjct: 564 PLNQENQDKRTSLQGSVY------WMSPEVV---KQTATTSKADIWSTGCVVIEMFTGKH 614

Query: 276 PF 277
           P+
Sbjct: 615 PY 616

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 36/190 (18%)

Query: 186 LIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEM 245
           +I+RD+K EN+L+D   + K+ DFG       +  T            +  TP Y APE+
Sbjct: 206 IIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT------------LCGTPDYIAPEV 253

Query: 246 IDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYDIP-------- 293
           +      P ++  D W+ GI +Y++L   TPF  +        IL+++   P        
Sbjct: 254 VS---TKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVK 310

Query: 294 -------ANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYD 346
                    + S +L NL      E+    P   +V+++      ++ P+E   Q G  D
Sbjct: 311 DLLSRLITRDLSQRLGNL--QNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGD 368

Query: 347 FDKYSKYQEK 356
             ++ KY E+
Sbjct: 369 TSQFDKYPEE 378

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 91/220 (41%), Gaps = 55/220 (25%)

Query: 99  ELRNEVEVMKQLKNSD--NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRL 156
           ++R E+ +MK+  +     +++  D   SR+        + L++E C    +      +L
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSRK--------IYLVLEYCSKGEVKWCPGDQL 212

Query: 157 ATK------LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFG 210
                    L+ +   +I+  V   +  +H+    +IHRDIK  N+L+   +  K+ DFG
Sbjct: 213 EAAARGPPLLTFQRTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSEHDIVKISDFG 270

Query: 211 ----STSSCFPIMTTHQ--------------DIALLTNNIYVHTTPQYRAPEMI---DLY 249
               S++S  P   +                D+ L         TP + APE+    D Y
Sbjct: 271 VSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAK----TAGTPAFFAPEICLGSDAY 326

Query: 250 RCLPIDEKS------------DIWALGIFLYKLLFYTTPF 277
             L ID +S            DIWALG+ LY LLF   PF
Sbjct: 327 EKLNIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPF 366

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 110/250 (44%), Gaps = 38/250 (15%)

Query: 83  LACLKRV-LVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLME 141
           +  +K V L  DE+   ++  E+EV+   + S  IV +Y    +   +G+    V + ME
Sbjct: 443 IMAMKEVRLELDESKFRQILMELEVLHNCQ-SPYIVDFY---GAFFIEGA----VYMCME 494

Query: 142 LCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVD-S 200
                SL    +      + E ++ +I   V + + ++  +   +IHRD+K  N+L   S
Sbjct: 495 YMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVHN-IIHRDVKPTNILCSAS 553

Query: 201 ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDE---- 256
           +   KLCDFG + +           +L   NI   +   Y APE I   + L  D+    
Sbjct: 554 QGTIKLCDFGVSGNLV--------ASLAKTNIGCQS---YMAPERI---KSLNPDKSTYS 599

Query: 257 -KSDIWALGIFLYKLLFYTTPF---ELTGQFAILHSKYD-----IPANNYSSKLINLIII 307
            +SDIW+LG+ + ++     P+        F+ L +  D     +P   +S+   N + +
Sbjct: 600 VQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSM 659

Query: 308 MLAENPNLRP 317
            L + P  RP
Sbjct: 660 CLQKIPERRP 669

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 90/214 (42%), Gaps = 37/214 (17%)

Query: 98  NELRNEVEVMKQLKNSD--NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR 155
           ++++ E+ +MK+  +     +++  D   SR+        + L++E C    +      +
Sbjct: 168 DKIKREIAIMKKCHHEHVVKLIEVLDDFKSRK--------IYLVLEYCSKGEIKWCPGDQ 219

Query: 156 LATK------LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209
           L TK      L+ +   +++  V   +  +H+    +IHRDIK  N+LV      K+ DF
Sbjct: 220 LETKARGPPLLTFQRAREVLRGVVLGLEYLHY--QGIIHRDIKPANLLVSETGTVKISDF 277

Query: 210 GSTSSCFPIMTTHQDIALLTNNIYVHT--TPQYRAPEMI---DLYRCLPIDEKS------ 258
           G +       TT      +       T  TP + APE+    D       D+K+      
Sbjct: 278 GVS---LAASTTEDGNGFIDELELAKTAGTPAFFAPEICLGHDALEKFNPDKKATKKGLC 334

Query: 259 -----DIWALGIFLYKLLFYTTPFELTGQFAILH 287
                DIWALG+ L+ LLF   PF    +  + H
Sbjct: 335 ISFMIDIWALGVTLHCLLFGQLPFISEFELELFH 368

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 97/232 (41%), Gaps = 49/232 (21%)

Query: 66  EFSNELETPSSSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSD--NIVQYYDSN 123
           +FSN  +TP S +++                  +++ E+ +MK+  +     +++  D  
Sbjct: 157 KFSNRFKTPQSGIED-----------------EKIKREIAIMKKCHHEHVVKLIEVLDDA 199

Query: 124 ASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK------LSEKEVLKIMYDVTKAVA 177
            SR+        + L++E C    +       + TK      LS +   +I   V   + 
Sbjct: 200 KSRK--------IYLVLEYCSKGEIKWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLE 251

Query: 178 QMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTT 237
            +HF    +IHRDIK  N+L+  +   K+ DFG  S  F   ++   +  L        T
Sbjct: 252 YLHF--QGIIHRDIKPANLLLSEDGIVKISDFG-VSLAFSSDSSTDSLNEL-ELAKTAGT 307

Query: 238 PQYRAPEMI---DLYRCLPIDEKS---------DIWALGIFLYKLLFYTTPF 277
           P + APE+    D  +   +D  S         DIWA+GI L+ LLF   PF
Sbjct: 308 PAFFAPEICLVEDTIKKFDLDPNSKEPIISFPTDIWAMGITLHCLLFGMLPF 359

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 131/328 (39%), Gaps = 69/328 (21%)

Query: 50   YLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDENGLNEL----RNEVE 105
            ++  G F  +Y              +  L  G++  +K + + D   + ++    + E+ 
Sbjct: 1271 FIGGGTFGRVY-------------SAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMS 1317

Query: 106  VMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATKLSEKEV 165
            V++ L N  NIV YY     R +       V + ME C   SL   +         E E+
Sbjct: 1318 VLEIL-NHPNIVSYYGVEVHRDK-------VNIFMEYCEGGSLAALLEHGRI----EDEM 1365

Query: 166  LKIMY--DVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTT-- 221
            +  +Y   + + +A +H   + ++HRD+K EN+L+D     K  DFG+        T   
Sbjct: 1366 VTQVYTLQLLEGLAYLH--ESGIVHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLA 1423

Query: 222  -----------HQDIALLTNNIYVHT----------TPQYRAPEMIDLYRCLPIDEKSDI 260
                       H+D+  ++++  V            TP Y APE I            D+
Sbjct: 1424 SMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDV 1483

Query: 261  WALGIFLYKLLFYTTPF-ELTGQFAILHSKYDIPANN---------YSSKLINLIIIMLA 310
            W+LG  + +++    P+  L  ++AI+   Y + A +          SS  +  +   L 
Sbjct: 1484 WSLGCVVLEMITGRRPWANLDNEWAIM---YHVAAGHTPQFPTKDEVSSAGMKFLERCLI 1540

Query: 311  ENPNLRPNIYQVIYQVCAIMKVDVPFED 338
            +NP+ R +  +++     +   ++ F D
Sbjct: 1541 QNPSKRASAVELLMDPWIVQIREIAFGD 1568

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 92/206 (44%), Gaps = 29/206 (14%)

Query: 133 GYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIK 192
           G   L++ME CP     D+ N  ++ ++++ EV      + + V  +H     L HRD+K
Sbjct: 335 GELFLVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLH--SQGLAHRDLK 388

Query: 193 IENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCL 252
           ++N +V ++   KL DFGS      I   + +  L      V + P Y APE++      
Sbjct: 389 LDNCVVTADGILKLIDFGSAI----IFRYNFNSKLEPAKGIVGSDP-YLAPELLTQLYYD 443

Query: 253 PIDEKSDIWALGIFLYKLLF----YTTPFELTGQFAILHSKYDIPANNYSS------KLI 302
           P    +D+W++ +  Y +      +  P E    F +   K D   N++S       KL+
Sbjct: 444 P--SAADVWSIAVMFYCMSLRRFPWKKPSEDVPSFKLFCQKPD-DENDHSKGPYRLLKLL 500

Query: 303 N-----LIIIMLAENPNLRPNIYQVI 323
                 LI  ML  +P  R +I ++I
Sbjct: 501 PRATRLLISRMLELDPKKRASITEII 526

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 82/201 (40%), Gaps = 47/201 (23%)

Query: 100 LRNEVEVMKQLKNSD-NIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLAT 158
           +RNE  V+K+L N   NI    D      +        + ++E C N  L DYM +   +
Sbjct: 51  VRNEYRVLKKLGNRHPNICAMLDFYQDHEK-------FVFVLEYCHNGDLYDYMKRIKES 103

Query: 159 KLSEK------------------EVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS 200
             ++K                      +M+ +  A+   H L   + HRD K EN+LV +
Sbjct: 104 GGTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCHTLG--IAHRDFKPENILVTN 161

Query: 201 ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMI---DLYRCLPIDEK 257
               KL DFG   S F  + +   I           T +Y APE     D Y        
Sbjct: 162 TGKIKLTDFG--LSYFGEVASDHGIG----------TEKYLAPETFSHNDTYNTY----S 205

Query: 258 SDIWALGIFLYKLLFYTTPFE 278
           +D+W+LGI +  ++F + PF+
Sbjct: 206 ADLWSLGISVLYIVFGSCPFK 226

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
            complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 95/203 (46%), Gaps = 17/203 (8%)

Query: 132  PGYEVLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRD 190
            P   + + ME C N++L D + N+ L+ +    E  ++   + +A++ +H     +IHRD
Sbjct: 819  PKSTLFIQMEYCENRTLYDLIHNENLSQQ--RDEYWRLFRQILEALSYIH--SQGIIHRD 874

Query: 191  IKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVH------TTPQYRAPE 244
            +K  N+ +D   N K+ DFG   +        +      +N+          T  Y A E
Sbjct: 875  LKPMNIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGSNVSADDLTSAIGTALYVASE 934

Query: 245  MIDLYRCLPIDEKSDIWALGIFLYKLLF-YTTPFELTGQFAILHSK-YDIPANNYSSKL- 301
            +  L      +EK D+++LGI  +++++ + T  E       L S   ++PAN  SSK  
Sbjct: 935  V--LTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATDLRKLRSSAVELPANFDSSKRN 992

Query: 302  -INLIIIMLAENPNLRPNIYQVI 323
               +I ++L  +P  RP   +++
Sbjct: 993  EKKIIRLLLDHDPAKRPTAAKLL 1015

>Scas_649.30
          Length = 648

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 106/259 (40%), Gaps = 50/259 (19%)

Query: 96  GLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQR 155
            + + R E+ V  QL+N D +V+  +       D      + ++ E C     L  +  R
Sbjct: 149 NVEKCRWEIFVWNQLQNCDYVVKLVEC-----LDSPSSKNIWIINEYCS----LGELRWR 199

Query: 156 LATK---LSEKEVLKIMYDV--------TKAVAQMHFL-PTPLIHRDIKIENVLVDS-EN 202
             +K   LS+ E +    DV           +  + FL     IHRDIK  N+L ++ + 
Sbjct: 200 RNSKDEVLSQWEKMIPGCDVQDFTEWVFVDMIKALRFLEANGCIHRDIKPANILCNARDG 259

Query: 203 NFKLCDFGSTSSCFPIMTTHQD------IALLTNNIYVHTTPQYRAPEMIDLYRC----L 252
           +F++ DFG  S   P     +D        +  N I    TP + APE+          +
Sbjct: 260 HFQISDFG-CSILLPRYVPFKDPKLEHCFQMELNKII--GTPAFIAPELCHFNESKRNNI 316

Query: 253 PIDEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKY---------DIPANNYSSKLIN 303
               K DIW+LGI LY LL    PF    +F   H            D+P NN       
Sbjct: 317 RDGFKLDIWSLGITLYCLLHNKLPFSGENEFDTYHKVVSESLDSDLDDVPLNNL------ 370

Query: 304 LIIIMLAENPNLRPNIYQV 322
           +I  +L +NP  R +I+++
Sbjct: 371 VIEKLLKKNPRERVSIHEL 389

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 96/200 (48%), Gaps = 33/200 (16%)

Query: 81  GDLACLKRVLVTDENGL--NELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLL 138
           G    LK V +  E G     +R E+ +MK+LK+ DNIV+ +D   +  +       + L
Sbjct: 30  GVYVALKEVKLDSEEGTPSTAIR-EISLMKELKH-DNIVRLFDVIHTENK-------LTL 80

Query: 139 LMELCPN--KSLLDYMNQRLATKLSEKEVLK-IMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           + E   N  K  +D  N+  + K  E +++K   + + + VA  H     ++HRD+K +N
Sbjct: 81  VFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAFCH--ENRILHRDLKPQN 138

Query: 196 VLVDSENNFKLCDFG-STSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYR--CL 252
           +L+++    KL DFG + +   P+ T   ++           T  YRAP+++   R  C 
Sbjct: 139 LLINNRGQLKLGDFGLARAFGIPVNTFSSEVV----------TLWYRAPDVLMGSRNYCT 188

Query: 253 PIDEKSDIWALGIFLYKLLF 272
            I    DIW+ G  L +++ 
Sbjct: 189 SI----DIWSCGCILAEMIM 204

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 126/282 (44%), Gaps = 49/282 (17%)

Query: 83  LACLKRV-LVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLME 141
           L  +K V L  DE+   ++  E+EV+ +  NS  IV +Y    +   +G+    V + ME
Sbjct: 394 LMAMKEVRLELDESKFRQILMELEVLHKC-NSPFIVDFY---GAFFIEGA----VYMCME 445

Query: 142 LCPNKSLLD-YMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDS 200
                SL   Y        + E ++  I   V + + ++  +   +IHRD+K  N+L  +
Sbjct: 446 YMDGGSLDKIYDENPEMGGIDEPQLAFITNAVIQGLRELKEVHN-VIHRDVKPTNILCSA 504

Query: 201 -ENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDE--- 256
            +   KLCDFG + +           +L   NI   +   Y APE I   + L  D    
Sbjct: 505 KQGTVKLCDFGVSGNLV--------ASLAKTNIGCQS---YMAPERI---KSLNPDRGTY 550

Query: 257 --KSDIWALGIFLYKLLFYTTPF---ELTGQFAILHSKYD-----IPANNYSSKLINLII 306
             +SDIW+LG+ + ++     P+        F+ L +  D     +PA+ +S +  + + 
Sbjct: 551 TVQSDIWSLGLSILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVS 610

Query: 307 IMLAENPNLRPNIYQVIYQVCAIMK---VDVPFEDKYQTGPY 345
           + L + P+ RPN Y  +Y+   + K   +DV      Q GPY
Sbjct: 611 LCLQKIPDRRPN-YSNLYEHPWLAKYRSIDV------QMGPY 645

>YOR267C (HRK1) [5054] chr15 complement(822585..824864)
           Serine/threonine protein kinase involved in regulation
           of plasma membrane ATPase (Pma1p) activity, has
           similarity to members of the NPR1 subfamily [2280 bp,
           759 aa]
          Length = 759

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 74/151 (49%), Gaps = 27/151 (17%)

Query: 134 YEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKI 193
           YEV   ME CP    +D+    +  K+S  E+   +  +T+ V  +H +   L HRD+K+
Sbjct: 293 YEV---MEYCP----IDFFAVVMTGKMSRGEINCCLKQLTEGVKYLHSMG--LAHRDLKL 343

Query: 194 ENVLVDSENNFKLCDFGSTSSC-FPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYR-- 250
           +N ++ S+   KL DFGS     +P     +D   + + I V + P Y APE+I   +  
Sbjct: 344 DNCVMTSQGILKLIDFGSAVVFRYPF----EDGVTMAHGI-VGSDP-YLAPEVITSTKSY 397

Query: 251 ---CLPIDEKSDIWALGIFLYKLLFYTTPFE 278
              C+      DIW++GI    ++    P++
Sbjct: 398 DPQCV------DIWSIGIIYCCMVLKRFPWK 422

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 120/286 (41%), Gaps = 70/286 (24%)

Query: 99  ELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLD----YMNQ 154
           +L +E  ++ QLK+ DNIV+++  +   + +      + L ME C    L      Y +Q
Sbjct: 53  QLISECAILSQLKH-DNIVEFFHWDHDAKSN-----TLFLYMEYCSKGDLSQMIRYYKHQ 106

Query: 155 RLATKLSEKEVLKIMYDVTKAVAQMHF-------------LPTPL-------IHRDIKIE 194
           R    + E+ V +IM  +  A+ + H+             +  PL       IHRD+K  
Sbjct: 107 R--KYVPEEYVWRIMVQILMALFKCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRDLKPG 164

Query: 195 NVLV---DSENN------------FKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQ 239
           N+ +   D E N             KL DFG   S          I   T  +    TP 
Sbjct: 165 NIFLTGYDDEFNQNASDVDYSKVIIKLGDFGLAKS------LQASIEFATTYV---GTPY 215

Query: 240 YRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPF------ELTGQFAILHSKYDIP 293
           Y +PE++   R  P    SDIW+LG  LY+L     PF      EL G+   + + Y  P
Sbjct: 216 YMSPEVL---RDQPYSPLSDIWSLGCILYELCSLHVPFQAKTYTELQGK---VKAGYFEP 269

Query: 294 ANNYSSK-LINLIIIMLAENPNLRPNIYQVIYQV-CAIMKVDVPFE 337
             ++ SK L ++I   +  +   RP+ + ++  + C I +  +  E
Sbjct: 270 LPHFYSKNLQDIITRCIQVDFTKRPSTWSLLNDIQCRICRKALDLE 315

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 85/198 (42%), Gaps = 38/198 (19%)

Query: 186 LIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEM 245
           +I+RD+K EN+L+D   + K+ DFG       +  T            +  TP Y APE+
Sbjct: 207 IIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT------------LCGTPDYIAPEV 254

Query: 246 IDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFA----ILHSKYDIP-------- 293
           +      P ++  D W+ G+ +Y++L   TPF  +        IL+++   P        
Sbjct: 255 VS---TKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQ 311

Query: 294 -------ANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVDVPFEDKYQTGPYD 346
                    + S +L NL     +E+    P   +VI++      ++ P+E   Q G  D
Sbjct: 312 DLLKKLITRDLSERLGNL--QNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGD 369

Query: 347 FDKYSKYQEKLQAFQYQL 364
             ++ +Y E  + F Y +
Sbjct: 370 TSQFDRYPE--EEFNYGI 385

>Kwal_27.10581
          Length = 1154

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 19/143 (13%)

Query: 136  VLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            +   ME      L+ ++ NQRL+ + ++       Y     +A  +F    +I+RD+K+E
Sbjct: 903  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 956

Query: 195  NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
            N+L+  E + K+ D+G    C   M      +          TP++ APE++   +    
Sbjct: 957  NILLTPEGHIKIADYG---LCKDEMWYGNKTSTFCG------TPEFMAPEIL---KEQEY 1004

Query: 255  DEKSDIWALGIFLYKLLFYTTPF 277
             +  D WA G+ LY++L   +PF
Sbjct: 1005 TKAVDWWAFGVLLYQMLLCQSPF 1027

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 92/193 (47%), Gaps = 29/193 (15%)

Query: 78  LKEGD-LACLKRVLVT--DENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGY 134
           L+ G+ +  LK++ +   DE   +    E+ ++K+L++ DNIV+ YD   S   D    Y
Sbjct: 27  LRHGNRIVALKKIRLESEDEGVPSTAIREISLLKELRD-DNIVRLYDIVHS---DAHKLY 82

Query: 135 EVLLLMELCPNKSLLDYMNQRLATK-LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKI 193
            V   ++L     L  YM      + L  K + K M  + K +A  H     ++HRD+K 
Sbjct: 83  LVFEFLDL----DLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYCH--AHRILHRDLKP 136

Query: 194 ENVLVDSENNFKLCDFG-STSSCFPIMT-THQDIALLTNNIYVHTTPQYRAPEMIDLYRC 251
           +N+L++ + N KL DFG + +   P+   TH+ + L            YRAPE+  L   
Sbjct: 137 QNLLINRDGNLKLGDFGLARAFGVPLRAYTHEIVTL-----------WYRAPEV--LLGG 183

Query: 252 LPIDEKSDIWALG 264
                  DIW++G
Sbjct: 184 KQYSTGVDIWSIG 196

>Kwal_33.14192
          Length = 577

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 133 GYEVLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIK 192
           G   L++ME CP     D+ N  ++  +S+ E+      +   V  +H +   L HRD+K
Sbjct: 292 GTNFLVVMEYCP----YDFFNLVMSDLMSKNEISCYFKQICNGVDYLHRMG--LAHRDLK 345

Query: 193 IENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMID--LYR 250
           ++N +V  +   KL DFGS      +     +  +L     V + P Y APE++    Y 
Sbjct: 346 LDNCVVTKQGILKLIDFGSAV----VFQYPYEKEILRAKGIVGSDP-YLAPELLSHPSYD 400

Query: 251 CLPIDEKSDIWALGIFLYKLLFYTTPFE 278
             P+    D+W++ I  Y +     P++
Sbjct: 401 PRPV----DVWSIAIMFYCITLKRFPWK 424

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 67/143 (46%), Gaps = 19/143 (13%)

Query: 136  VLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            +   ME      L+ ++ NQRL+ + ++       Y     +A  +F    +++RD+K+E
Sbjct: 924  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVVYRDLKLE 977

Query: 195  NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
            N+L+  E + K+ D+G    C   M      +          TP++ APE++   +    
Sbjct: 978  NILLTPEGHIKIADYG---LCKDEMWYGNKTSTFCG------TPEFMAPEIL---KEQEY 1025

Query: 255  DEKSDIWALGIFLYKLLFYTTPF 277
             +  D WA G+ LY++L   +PF
Sbjct: 1026 TKSVDWWAFGVLLYQMLLCQSPF 1048

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 19/143 (13%)

Query: 136  VLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            +   ME      L+ ++ NQRL+ + ++       Y     +A  +F    +I+RD+K+E
Sbjct: 900  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 953

Query: 195  NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
            N+L+  E + K+ D+G    C   M      +          TP++ APE++   +    
Sbjct: 954  NILLTPEGHIKIADYG---LCKDEMWYGNRTSTFCG------TPEFMAPEIL---KEQEY 1001

Query: 255  DEKSDIWALGIFLYKLLFYTTPF 277
             +  D WA G+ LY++L   +PF
Sbjct: 1002 TKAVDWWAFGVLLYQMLLCQSPF 1024

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 96/229 (41%), Gaps = 30/229 (13%)

Query: 44  KVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRV--LVTDENGLNELR 101
           + EI++ L +G +    VV  V+  N    P+    E  LA +K+V  + T E  L    
Sbjct: 72  RYEILQVLGKGSYGT--VVSAVDKGN----PT---HEVQLA-IKKVTSIFTREILLKRAI 121

Query: 102 NEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLA---T 158
            E++ M   K   NIV   D         S  Y        C  + L+DY   R+     
Sbjct: 122 RELKFMSYFKGHRNIVSLIDLEIVNEEPYSGLY--------C-YQELVDYDLARVIHSNV 172

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
             SE  +   +Y +   +  +H     +IHRD+K  N+L       K+CDFG      P 
Sbjct: 173 LFSEFHIKHFLYQILCGMKYIH--SADVIHRDLKPGNILCSITGEIKICDFGLARGISPS 230

Query: 219 MTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFL 267
            T    I+    N YV  T  YRAPE+I  ++     +  D+WA+G  L
Sbjct: 231 FTVAGGISNHITN-YV-ATRWYRAPELILSHK--RYSKSVDMWAVGCIL 275

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 83/174 (47%), Gaps = 25/174 (14%)

Query: 100 LRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQRLATK 159
           LRNE +++  L+ S  +V  YD + S+R          + ME  P  SL   ++  L+  
Sbjct: 90  LRNEYDILVTLRKSKYVVNVYDLDISKRT---------IKMEFLPF-SLSRVLSMDLSPS 139

Query: 160 LSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSEN-NFKLCDFGSTSSCFPI 218
           L EK+       + +AV  +H     ++HRD+K+EN+++ ++    KL DFG       +
Sbjct: 140 LQEKKCY--FLQICEAVQYLH--SRGIVHRDLKLENIMLCADACQIKLIDFG-------V 188

Query: 219 MTTHQDIALLTNNIY-VHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLL 271
               QD   LT     +  T    APE++       + E +D W++GI ++++ 
Sbjct: 189 AVNRQDPQSLTTACKGMCGTEALMAPEVLGSIS--YVGEYADCWSVGIIMFQIF 240

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 13/120 (10%)

Query: 159 KLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSSCFPI 218
           +L E    ++   +   V  +H+    L HRD+K+EN+L+D   N  + DFG       +
Sbjct: 144 RLKEPPACRLFAQLISGVHYIHY--KGLAHRDLKLENLLLDEHENLIITDFGF------V 195

Query: 219 MTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE 278
              H++  + T+      +P Y APE++   +     +K+D+W+ G+ LY +L    P++
Sbjct: 196 NEFHKNDLMRTSC----GSPCYAAPELVVSSKPYSA-QKADVWSCGVILYAMLAGYLPWD 250

>YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of the
           GSK3 subfamily of protein kinases, positive regulator of
           meiosis and spore formation [1128 bp, 375 aa]
          Length = 375

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 66/144 (45%), Gaps = 18/144 (12%)

Query: 138 LLMELCPNKSLLDYMNQRLATKLSE--KEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195
           L ME  P ++L   +N+ +  KL    K +    Y + + +  +H L   + HRDIK  N
Sbjct: 113 LAMECLP-ETLQIEINRYVTNKLEMPLKHIRLYTYQIARGMLYLHGLG--VCHRDIKPSN 169

Query: 196 VLVDSENN-FKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
           VLVD E    K+CDFGS      +      I+ + +         YRAPE+I    C   
Sbjct: 170 VLVDPETGVLKICDFGSAKK---LEHNQPSISYICSRF-------YRAPELI--IGCTQY 217

Query: 255 DEKSDIWALGIFLYKLLFYTTPFE 278
             + DIW LG  + ++L     F+
Sbjct: 218 TTQIDIWGLGCVMGEMLIGKAIFQ 241

>Scas_715.34
          Length = 1150

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 67/143 (46%), Gaps = 19/143 (13%)

Query: 136  VLLLMELCPNKSLLDYM-NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIE 194
            +   ME      L+ ++ NQRL+ + ++       Y     +A  +F    +I+RD+K+E
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 952

Query: 195  NVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPI 254
            N+L+  + + K+ D+G    C   M  +   +          TP++ APE++   +    
Sbjct: 953  NILLTPQGHIKIADYG---LCKDEMWYNNKTSTFCG------TPEFMAPEIL---KEQGY 1000

Query: 255  DEKSDIWALGIFLYKLLFYTTPF 277
                D WA G+ LY++L   +PF
Sbjct: 1001 TRAVDWWAFGVLLYQMLLCQSPF 1023

>Kwal_33.13846
          Length = 375

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 83/188 (44%), Gaps = 32/188 (17%)

Query: 186 LIHRDIKIENVLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEM 245
           +I+RD+K ENVL+D   + K+ DFG       +  T            +  TP Y APE+
Sbjct: 184 IIYRDLKPENVLLDKNGHVKITDFGFAKFVPDVTYT------------LCGTPDYIAPEV 231

Query: 246 IDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFELTGQFA----ILHSKYDIPANNYSSK- 300
           +      P ++  D W+ GI ++++L   TPF  +        IL+++   P   +S   
Sbjct: 232 VS---TKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQ 288

Query: 301 --LINLIIIMLAEN-PNLRPN---------IYQVIYQVCAIMKVDVPFEDKYQTGPYDFD 348
             L  LI   L++   NL+             +V+++      ++ P+E   Q G  D  
Sbjct: 289 DLLSQLITRDLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTS 348

Query: 349 KYSKYQEK 356
           +Y +Y E+
Sbjct: 349 QYDRYPEE 356

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,070,266
Number of extensions: 1068297
Number of successful extensions: 4456
Number of sequences better than 10.0: 620
Number of HSP's gapped: 4110
Number of HSP's successfully gapped: 642
Length of query: 858
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 748
Effective length of database: 12,788,129
Effective search space: 9565520492
Effective search space used: 9565520492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)