Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1742.225125112701e-179
KLLA0E09207g2572373783e-44
YGL146C3112393152e-34
Kwal_23.34542582122738e-29
Scas_669.162771732354e-23
AGR377C2272231694e-14
KLLA0B11319g355119810.027
Scas_477.570355720.42
Scas_562.450552662.2
KLLA0F02794g260157624.6
CAGL0A02629g58876625.6
ACR218W1569100626.7
Kwal_55.2073920131606.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1742.2
         (251 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement        493   e-179
KLLA0E09207g complement(825533..826306) weakly similar to sp|P53...   150   3e-44
YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein...   125   2e-34
Kwal_23.3454                                                          109   8e-29
Scas_669.16                                                            95   4e-23
AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)...    70   4e-14
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    36   0.027
Scas_477.5                                                             32   0.42 
Scas_562.4                                                             30   2.2  
KLLA0F02794g complement(257091..257873) weakly similar to sgd|S0...    28   4.6  
CAGL0A02629g 276945..278711 similar to sp|P38817 Saccharomyces c...    28   5.6  
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    28   6.7  
Kwal_55.20739                                                          28   6.8  

>Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement
          Length = 251

 Score =  493 bits (1270), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/251 (96%), Positives = 241/251 (96%)

Query: 1   MVLCWIILISLIQSCFGEIISFPSNGQKLSLKVPPVKDSRVREGDYGKYTQCITFDSSTE 60
           MVLCWIILISLIQSCFGEIISFPSNGQKLSLKVPPVKDSRVREGDYGKYTQCITFDSSTE
Sbjct: 1   MVLCWIILISLIQSCFGEIISFPSNGQKLSLKVPPVKDSRVREGDYGKYTQCITFDSSTE 60

Query: 61  TEDVTFVISVQESLPYETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVL 120
           TEDVTFVISVQESLPYETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVL
Sbjct: 61  TEDVTFVISVQESLPYETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVL 120

Query: 121 QVNTHGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNE 180
           QVNTHGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNE
Sbjct: 121 QVNTHGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNE 180

Query: 181 VKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVPYVVWX 240
           VKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVPYVVW 
Sbjct: 181 VKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVPYVVWK 240

Query: 241 XXXXXXXXXAT 251
                    AT
Sbjct: 241 SKKPKQAKKAT 251

>KLLA0E09207g complement(825533..826306) weakly similar to sp|P53117
           Saccharomyces cerevisiae YGL146c hypothetical protein
           singleton, hypothetical start
          Length = 257

 Score =  150 bits (378), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 138/237 (58%), Gaps = 3/237 (1%)

Query: 1   MVLCWIILISLIQSCFGEIISFPSNGQKLSLKVPPVKDSRVR-EGDYGKYTQCITFDSST 59
           MV+  I ++ LI S   E +  P N  +L   + P K   V    D   Y  C   +++ 
Sbjct: 1   MVISLIYVLLLICSVVSETLKLPINPNRLEFDLWPYKKWEVDGSSDASSYQTCFEMNTNI 60

Query: 60  ETEDVTFVISVQESLPYETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTRHLPNGDNV 119
           + +D+ F+I ++E   ++ ++DRFGP +S++GKQ + ++I+DE  NL++    L NG+ V
Sbjct: 61  KAKDLQFLIEIEEFTKWKVNVDRFGPTTSSKGKQVVNMDIYDEDQNLVQSRHGLENGETV 120

Query: 120 LQVNTHGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLN 179
           L V+ +    F+ICLIN   D SW +ID  K V I++T  D +      +IT++D +LL+
Sbjct: 121 LYVSVYEHQNFQICLINFSLDSSWNAIDSVKQVAISITSNDLIQKQKWDLITDDDLNLLS 180

Query: 180 EVKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVPY 236
           + ++DLF +V+  + Q L  ++ +HR+LNES+F  L+ ++ +  +   +G C ++ +
Sbjct: 181 QGRDDLFSLVSADSGQELHALDVDHRNLNESTFSYLLAKVTI--LFCIIGVCHLLVF 235

>YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein
           with similarity to Bunyamwera virus RNA-directed RNA
           polymerase [936 bp, 311 aa]
          Length = 311

 Score =  125 bits (315), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 127/239 (53%), Gaps = 24/239 (10%)

Query: 20  ISFPSNGQKLSLKVPPVKDSRV------REGDYGKYTQ------CITFDSSTE--TEDVT 65
           +  P    KLS KVPP+K S +       + +Y           C  F++     + +V 
Sbjct: 61  VYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVV 120

Query: 66  FVISVQESLPYETDIDRFGPISSARGKQFLQLEIFDEYD-NLLRGTRHLPNGDNVLQVNT 124
           F I V + L  ETD  RFG  S  RG+Q L   +F+  + +LLR  ++L +G +V++VN 
Sbjct: 121 FEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNP 180

Query: 125 HGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKI-----ITEEDCDLLN 179
              ++F IC INLVYDGSW SID EK VTI +T  DK L+P + +     +T +    LN
Sbjct: 181 GNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDK-LDPDMLLHLVNQMTPQVVKALN 239

Query: 180 EVKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVPYVV 238
            V + LF +V   +  TL  +E + RD+NE+++  L+   + + V   + N ++  Y++
Sbjct: 240 TVSDGLFQIV---SDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLI 295

>Kwal_23.3454
          Length = 258

 Score =  109 bits (273), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 106/212 (50%), Gaps = 2/212 (0%)

Query: 28  KLSLKVPPVKDSRVREGDYGKYTQCITFDSSTETEDVTFVISVQESLPYETDIDRFGPIS 87
           +LS   PP+K S+V    +     C  F+    +   T  I V +++ Y+ D  RF   S
Sbjct: 37  QLSFVCPPIKVSQV-GALWQDNATCFGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNS 95

Query: 88  SARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVLQVNTHGSS-QFRICLINLVYDGSWKSI 146
             RGKQ L L I D  DNLLR   +L  G   ++V    S     +C IN VYD SWKSI
Sbjct: 96  CERGKQSLDLTITDCSDNLLRARNNLRTGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSI 155

Query: 147 DVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNEVKEDLFHMVNVKTTQTLTDIEREHRD 206
           D++K +T+T+   D      LK  TE+  + L+    +L  ++  K  Q L  +E   RD
Sbjct: 156 DMDKTITVTLIDFDSRQTKELKEQTEKAANELSTNAGELLPLLLPKEKQELFKLESNRRD 215

Query: 207 LNESSFELLMYQLIMVGVLSFLGNCVMVPYVV 238
            NE +F  L+Y  I+   + F+ N ++V YV 
Sbjct: 216 FNEETFSQLLYAQILYITVLFIFNALIVAYVA 247

>Scas_669.16
          Length = 277

 Score = 95.1 bits (235), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 90/173 (52%), Gaps = 9/173 (5%)

Query: 52  CITFDSS--TETEDVTFVISVQESLPYETDIDRFGPISSARGKQFLQLEIFD-EYDNLLR 108
           CI  ++    +++++ F I+VQE LPY+ D  RFG  SS +GKQ L L +F     NLL+
Sbjct: 69  CIILNTELHKQSQELVFGITVQEVLPYKIDFTRFGGTSSEKGKQKLYLTVFGLRSGNLLQ 128

Query: 109 GTRHLPNGDNVLQVNTHGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLK 168
            TR L  G  + Q+N  G + F  C  NLV+D SW SI+  K + +  +  D +LNP L 
Sbjct: 129 STRDLLTGTTLFQLNPDGENDFEFCFQNLVFDRSWNSINAIKLIKLFTSAND-ILNPELN 187

Query: 169 I-----ITEEDCDLLNEVKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLM 216
                  T      L++    L ++ N    + L  +E  HRD+NE  F  ++
Sbjct: 188 KYLETQYTSRAAKRLHKADFTLSNIQNNTLIKELLPLESSHRDINEDIFSRML 240

>AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)
           [684 bp, 227 aa]
          Length = 227

 Score = 69.7 bits (169), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 101/223 (45%), Gaps = 16/223 (7%)

Query: 13  QSCFGEIISFPSNGQKLSLKVPPVKDSRVREGDYGKYTQCITFDSSTETEDVTFVISVQE 72
           Q   G   +  + G+ +  +V P K  R       +  +C+ +++      ++  +   +
Sbjct: 4   QVVLGMAAAAAAAGETMRWEVAPRKVGR-------EVYECVRWEAG-RAGALSVRVRRTD 55

Query: 73  SLPYETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVLQVNTHGSSQFRI 132
            + +  D  RFGP S   G+Q L LE++D   N+L   R +P     ++ + + + Q  +
Sbjct: 56  RVGHAVDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVDV 115

Query: 133 CLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNEVKEDLFHMVNVK 192
           CLIN+  D SW++ID     T+         +     +TE+D  +L  V+ D       +
Sbjct: 116 CLINVSRDASWRAID-----TVAAVEVAVHADAGRVPLTEDDMAVLAAVERDTRAQ---Q 167

Query: 193 TTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVP 235
           T   +   E   RDLNES++  ++ +  M+ ++     C+ VP
Sbjct: 168 TADAVLGSEHVRRDLNESTYTWVVVRPAMLALMLLAAYCMAVP 210

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 34/119 (28%)

Query: 126 GSSQFRICLINLVYD-----GSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNE 180
           G + F+  +   VYD     G WKS+ V   +TI         NPS+   + E      +
Sbjct: 186 GDNSFK-AIAKEVYDEDGITGFWKSLKVSLVLTI---------NPSITYASAE------K 229

Query: 181 VKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLS-FLGNCVMVPYVV 238
           +K+ L+H            +E   +DLN+SS +L   Q  ++GVLS  +  C+  P +V
Sbjct: 230 LKDILYH------------VEWNAKDLNDSSLQLKPGQNFLIGVLSKIISTCLTHPLIV 276

>Scas_477.5
          Length = 703

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 11/55 (20%)

Query: 102 EYDNLLRGTRHLP--------NGDNVLQVNTHGSSQFRICLINLVYDGSWKSIDV 148
           EYD LL+   HLP         GDN+ Q+  + +S   I ++N   DGS K I+V
Sbjct: 89  EYDELLKKFSHLPLLSSSGTTLGDNLAQIGANTTSHRVIFILN---DGSLKKINV 140

>Scas_562.4
          Length = 505

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 147 DVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNEVKEDLFHMVNVKTTQTLT 198
           D +KD+  T++R  + +NP    +T  +  L+N +K DL  +++     +L 
Sbjct: 240 DSDKDLRNTISRHKRKINPKFGQLTNSNQQLMN-IKADLIQLIDQTKANSLA 290

>KLLA0F02794g complement(257091..257873) weakly similar to
           sgd|S0005448 Saccharomyces cerevisiae YOL088c MPD2
           protein disulfide isomerase-related protein,
           hypothetical start
          Length = 260

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 72/157 (45%), Gaps = 13/157 (8%)

Query: 76  YETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTR-HLPNG--DNVLQVNTHGSSQFRI 132
           +E D + FG +   R   F  +EI     + L  TR   P G  D +L   T+       
Sbjct: 89  FEVDCELFGNMLCKRLDGFPAVEIIKPLRSELNVTRLEDPRGWIDRLLDTITNAGYDLTW 148

Query: 133 CLIN---LVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNEVKED---LF 186
            L     + ++G  +++DV +     V   D+  +  L++I  ++C   +E+ ED    F
Sbjct: 149 TLDTDRIVTFNGR-RNLDVFERFVQAVVTSDQW-DRVLQLIVNDNCSDKDELCEDGREYF 206

Query: 187 HMVNVKT--TQTLTDIEREHRDLNESSFELLMYQLIM 221
             +N +T   + + DIE E +DL +   +L++  +I+
Sbjct: 207 LKMNDETNCAEKIADIENEMKDLKDVPKDLMLRYMIL 243

>CAGL0A02629g 276945..278711 similar to sp|P38817 Saccharomyces
           cerevisiae YHR108w GGA2 Arf-binding protein,
           hypothetical start
          Length = 588

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 13/76 (17%)

Query: 158 RRDKLLNPSLKIITEEDCDLLNEVKEDLFHMVNVKTTQTLTDIEREHRD---------LN 208
           R+  LLN   +++++E  DL +E  E+L+  + V   +    IE EH D          N
Sbjct: 245 RKADLLN---EMLSQEQPDLSSETMEELYSALKVAQPKFQKIIEEEHEDDTLVQSLLKFN 301

Query: 209 ESSFELL-MYQLIMVG 223
           ++  +LL  Y L+ +G
Sbjct: 302 DTVNQLLEKYNLLKIG 317

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 111 RHLPNGDNVLQVNTHGSSQFRI--CLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLK 168
           R  PN  N +   T   +Q  +    INL+   +  ++++ K     V R D  +  SLK
Sbjct: 378 RFSPNTKNNIDHVTAWDAQLGVDDPAINLL---TQDTVELVKRKVEMVLRLDNTMRHSLK 434

Query: 169 IITEEDCDLLNEVKEDL-FHMVNVKTTQTLTDIEREHRDL 207
           I  E DC ++N +K+ +  + +N++  +T+ D+ +  + L
Sbjct: 435 IKHEVDCQVVNLIKDKIESNKINLQADETMQDLGQAAQPL 474

>Kwal_55.20739
          Length = 201

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 38  DSRVREGDYGKYTQCITFDSSTETEDVTFVI 68
           D RVR    GK+  C    + T+T+DVTF I
Sbjct: 84  DERVRIPRDGKFEYCFLNQAGTKTKDVTFNI 114

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,883,319
Number of extensions: 340296
Number of successful extensions: 1075
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1067
Number of HSP's successfully gapped: 24
Length of query: 251
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 152
Effective length of database: 13,168,927
Effective search space: 2001676904
Effective search space used: 2001676904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)