Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1720.251851827620.0
Kwal_23.336652652023100.0
KLLA0A04081g52752321570.0
Scas_687.55605126236e-74
YJR152W (DAL5)5435276042e-71
KLLA0D11330g5215185954e-70
YLR004C5235295867e-69
Kwal_47.171695764855862e-68
Scas_590.105344695798e-68
KLLA0D02970g5504755801e-67
Kwal_33.152765525365773e-67
CAGL0G04081g5135255552e-64
KLLA0E09548g5114625193e-59
Kwal_26.66585455155092e-57
Kwal_47.165965045394623e-51
Scas_630.155505284346e-47
Kwal_23.64865475194162e-44
YLL055W5315194143e-44
KLLA0C18678g5505253907e-41
KLLA0F00286g5394563741e-38
KLLA0C19019g5114163386e-34
ADR330W4934933351e-33
KLLA0A09449g5104613314e-33
Kwal_14.7824914143298e-33
Kwal_47.165865024753253e-32
ABR113C4794713182e-31
CAGL0F08371g5294743192e-31
Kwal_27.128325083363077e-30
YGR260W (TNA1)5345073061e-29
Scas_645.75464992785e-26
AFR229C5355082742e-25
KLLA0F09405g5434662723e-25
YIL166C5425312671e-24
ACL203C5375002653e-24
KLLA0D07370g5995012636e-24
AGL026W5454382619e-24
CAGL0F00209g5403542475e-22
Kwal_33.132675505432458e-22
AER444W5475412413e-21
Sklu_1875.15724032227e-19
AFL158C5643182066e-17
CAGL0L08052g4842452056e-17
YAL067C (SEO1)5934412012e-16
Kwal_56.243535824011961e-15
AGR235W5625301923e-15
Kwal_33.137135002151913e-15
YGR065C (VHT1)5933171923e-15
YCR028C (FEN2)5122661905e-15
Scas_689.115082181897e-15
KLLA0B07953g5982051881e-14
KLLA0A06193g4382041861e-14
Sklu_2010.55171931862e-14
CAGL0K04609g6092631772e-13
Scas_630.255822111737e-13
KLLA0D12716g5954321622e-11
Kwal_26.92646144301603e-11
AEL143W5192481479e-10
AFR578C6252201415e-09
CAGL0K04565g6201851326e-08
Scas_683.236011851254e-07
Sklu_2043.22421301092e-05
Sklu_2244.62302271055e-05
Scas_21.1140129972e-04
YOL163W169168900.003
YOL162W215211880.005
Sklu_2358.216786790.055
Scas_530.11549111770.28
CAGL0M01672g547153664.9
Kwal_14.1625506164665.3
YLR386W (VAC14)88080657.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1720.2
         (518 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1720.2 , Contig c1720 2063-3619 reverse complement              1068   0.0  
Kwal_23.3366                                                          894   0.0  
KLLA0A04081g 366969..368552 similar to ca|CA5240|IPF3032 Candida...   835   0.0  
Scas_687.5                                                            244   6e-74
YJR152W (DAL5) [3043] chr10 (719581..721212) Allantoate and urei...   237   2e-71
KLLA0D11330g 970243..971808 similar to ca|CA2478|CaDAL52 Candida...   233   4e-70
YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member...   230   7e-69
Kwal_47.17169                                                         230   2e-68
Scas_590.10                                                           227   8e-68
KLLA0D02970g 252052..253704 similar to sp|P15365 Saccharomyces c...   228   1e-67
Kwal_33.15276                                                         226   3e-67
CAGL0G04081g 388383..389924 highly similar to tr|Q07904 Saccharo...   218   2e-64
KLLA0E09548g complement(846600..848135) similar to sgd|S0003994 ...   204   3e-59
Kwal_26.6658                                                          200   2e-57
Kwal_47.16596                                                         182   3e-51
Scas_630.15                                                           171   6e-47
Kwal_23.6486                                                          164   2e-44
YLL055W (YLL055W) [3368] chr12 (30109..31704) Member of the alla...   164   3e-44
KLLA0C18678g complement(1655735..1657387) similar to sgd|S000397...   154   7e-41
KLLA0F00286g 14519..16138 some similarities with sp|Q9C0U9 Schiz...   148   1e-38
KLLA0C19019g 1689555..1691090 weakly similar to sp|P53322 Saccha...   134   6e-34
ADR330W [2071] [Homologous to ScYGR260W (TNA1) - SH] complement(...   133   1e-33
KLLA0A09449g 825574..827106 similar to sp|P53322 Saccharomyces c...   132   4e-33
Kwal_14.782                                                           131   8e-33
Kwal_47.16586                                                         129   3e-32
ABR113C [705] [Homologous to ScYLL055W - NSH] (601035..602474) [...   127   2e-31
CAGL0F08371g 835733..837322 highly similar to sp|P53322 Saccharo...   127   2e-31
Kwal_27.12832                                                         122   7e-30
YGR260W (TNA1) [2206] chr7 (1012490..1014094) Nicotinic acid per...   122   1e-29
Scas_645.7                                                            111   5e-26
AFR229C [3421] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH] ...   110   2e-25
KLLA0F09405g 867882..869513 similar to sp|P40445 Saccharomyces c...   109   3e-25
YIL166C (YIL166C) [2512] chr9 complement(30938..32566) Member of...   107   1e-24
ACL203C [846] [Homologous to ScYIL166C - NSH; ScYOL162W - NSH] (...   106   3e-24
KLLA0D07370g complement(630095..631894) similar to ca|CA4956|IPF...   105   6e-24
AGL026W [4285] [Homologous to ScYGR260W - NSH] complement(664335...   105   9e-24
CAGL0F00209g complement(22109..23731) weakly similar to sp|P5332...   100   5e-22
Kwal_33.13267                                                          99   8e-22
AER444W [2944] [Homologous to ScYIL166C - NSH] complement(148785...    97   3e-21
Sklu_1875.1 YAL067C, Contig c1875 643-2361 reverse complement          90   7e-19
AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH] (137788..1...    84   6e-17
CAGL0L08052g complement(878996..880450) similar to sp|P25621 Sac...    84   6e-17
YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the all...    82   2e-16
Kwal_56.24353                                                          80   1e-15
AGR235W [4546] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH] ...    79   3e-15
Kwal_33.13713                                                          78   3e-15
YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin ...    79   3e-15
YCR028C (FEN2) [562] chr3 complement(170881..172419) High affini...    78   5e-15
Scas_689.11                                                            77   7e-15
KLLA0B07953g 703782..705578 similar to sp|P53241 Saccharomyces c...    77   1e-14
KLLA0A06193g 566780..568096 similar to sp|P25621 Saccharomyces c...    76   1e-14
Sklu_2010.5 YCR028C, Contig c2010 7036-8589                            76   2e-14
CAGL0K04609g complement(437799..439628) highly similar to sp|P53...    73   2e-13
Scas_630.25                                                            71   7e-13
KLLA0D12716g complement(1084062..1085849) similar to sp|P39709 S...    67   2e-11
Kwal_26.9264                                                           66   3e-11
AEL143W [2363] [Homologous to ScYCR028C (FEN2) - SH] complement(...    61   9e-10
AFR578C [3770] [Homologous to ScYGR065C (VHT1) - SH] (1474397..1...    59   5e-09
CAGL0K04565g complement(431909..433771) similar to sp|P53241 Sac...    55   6e-08
Scas_683.23                                                            53   4e-07
Sklu_2043.2 , Contig c2043 4428-5156 reverse complement                47   2e-05
Sklu_2244.6 YOL162W, Contig c2244 14189-14881 reverse complement       45   5e-05
Scas_21.1                                                              42   2e-04
YOL163W (YOL163W) [4662] chr15 (9596..10105) Protein of unknown ...    39   0.003
YOL162W (YOL162W) [4663] chr15 (10118..10765) Protein of unknown...    39   0.005
Sklu_2358.2 YIL166C, Contig c2358 1699-2198                            35   0.055
Scas_530.1                                                             34   0.28 
CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces c...    30   4.9  
Kwal_14.1625                                                           30   5.3  
YLR386W (VAC14) [3765] chr12 (893628..896270) Protein involved i...    30   7.5  

>Sklu_1720.2 , Contig c1720 2063-3619 reverse complement
          Length = 518

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MASKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPI 60
           MASKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPI
Sbjct: 1   MASKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPI 60

Query: 61  RRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGS 120
           RRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGS
Sbjct: 61  RRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGS 120

Query: 121 IPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMM 180
           IPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMM
Sbjct: 121 IPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMM 180

Query: 181 CSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVW 240
           CSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVW
Sbjct: 181 CSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVW 240

Query: 241 AGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILA 300
           AGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILA
Sbjct: 241 AGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILA 300

Query: 301 LIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNV 360
           LIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNV
Sbjct: 301 LIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNV 360

Query: 361 RTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGSSK 420
           RTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGSSK
Sbjct: 361 RTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGSSK 420

Query: 421 ISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRN 480
           ISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRN
Sbjct: 421 ISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRN 480

Query: 481 RTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           RTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY
Sbjct: 481 RTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518

>Kwal_23.3366
          Length = 526

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/520 (81%), Positives = 470/520 (90%), Gaps = 7/520 (1%)

Query: 3   SKEQYEVNVNDAEQQSVTSGSSSPD----QIPIADKHAVGVELFQELLDAELDTDDKEYA 58
           +KE ++V   +  +     GS+SP     Q+ +A KH VG ELFQELL+ E +T DKEYA
Sbjct: 10  TKEPFQVESGEILE---IKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESETSDKEYA 66

Query: 59  PIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLV 118
           PIRRKIDRWLLPVLC+TYMLQFLDKLSLNYASAYS+ +DL  KGNDY +IAAI N GYLV
Sbjct: 67  PIRRKIDRWLLPVLCVTYMLQFLDKLSLNYASAYSLSKDLNFKGNDYSNIAAIFNVGYLV 126

Query: 119 GSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNM 178
           GSIPANWVIQK PVAKYTGCAL+ WA+LL+AHIGA N   MMALRFLLG+MEASISPSNM
Sbjct: 127 GSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNM 186

Query: 179 MMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNF 238
           MMC+MFYNKQEQPFRMCTFLSMNGVATMVG+LLAYGLGHSTS+SLKPWKLIFLVIGL+NF
Sbjct: 187 MMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINF 246

Query: 239 VWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWI 298
           VWA +FLYMAPDSPANARFLTHEEKLKV++RVSKNQMGIKDT+LKPKQA EA KDLN  I
Sbjct: 247 VWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVII 306

Query: 299 LALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKK 358
           LALIGLGCG++NGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVF AG++ALFTKK
Sbjct: 307 LALIGLGCGIINGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKK 366

Query: 359 NVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGS 418
           N+R ILLF+LCIPTLAGL+GIHLIPLEHKWALVGCCWLLYIIGGPVIMCW+L+NVT+AGS
Sbjct: 367 NIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTVAGS 426

Query: 419 SKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHY 478
           SKIS+ KIMWFL+YTAGNIIGSKIFYAKEAP+YITGMKGLI+SYA MMFL I+YY +M Y
Sbjct: 427 SKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFY 486

Query: 479 RNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           RN+TRDRKYGK TPE E+EG+INGFKDYTDFENKYFRY Y
Sbjct: 487 RNKTRDRKYGKPTPEEEKEGVINGFKDYTDFENKYFRYHY 526

>KLLA0A04081g 366969..368552 similar to ca|CA5240|IPF3032 Candida
           albicans allantoate permease (by homology), start by
           similarity
          Length = 527

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/523 (76%), Positives = 450/523 (86%), Gaps = 5/523 (0%)

Query: 1   MASKEQYEVNV-NDAEQQSVTSGSSSPDQIPIAD----KHAVGVELFQELLDAELDTDDK 55
           +  KEQ+E+ V  D E  S+         +        +HAVG++LFQE+LD++L  DDK
Sbjct: 5   IKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDK 64

Query: 56  EYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAG 115
           EY+ IRRKID WLLPVLCITYMLQFLDKLSLNYASAYSMKEDL L GN+YG+IAAI N G
Sbjct: 65  EYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVG 124

Query: 116 YLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISP 175
           YL+GSIPAN+VIQK PVAKYTG AL  WAILLI HIGATNYSSMMALRFLLG+MEASISP
Sbjct: 125 YLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISP 184

Query: 176 SNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGL 235
           SNMMMC+MFYNK+EQPFRMCTFLSMNGVATMVGALLAYGLGH+T+TSL+PWKLIFLV G+
Sbjct: 185 SNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGI 244

Query: 236 LNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLN 295
           +N VW+ +FLY+APDSPANA+FLTHEEKLKVID VSKNQMGIKDT++KP Q  EA  DLN
Sbjct: 245 MNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLN 304

Query: 296 SWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALF 355
           SWILA IGLGCGV+NG TSNFISSLIKGFGFSGLNATLLQLPTGAIELV VF AGMVALF
Sbjct: 305 SWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALF 364

Query: 356 TKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTI 415
           T KNVR ILLFL CIPTL  LIGI LIPL  KW+LVGCCWLLYIIGGPVIMCW+LINVT+
Sbjct: 365 TNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTV 424

Query: 416 AGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCM 475
           AGSSKIS+VKI+WF+ YTAGNI GSKI YA EAP+Y +GMKGLI  Y+GMMFL IVYY +
Sbjct: 425 AGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFL 484

Query: 476 MHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           M+YRN+ RD +YG+LTPE E+EG+INGFKD TDF+N++FRY Y
Sbjct: 485 MYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQNQFFRYVY 527

>Scas_687.5
          Length = 560

 Score =  244 bits (623), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 163/512 (31%), Positives = 278/512 (54%), Gaps = 28/512 (5%)

Query: 25  SPDQIPIADKHA---VGVELFQELLDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFL 81
           SP+  P+        + ++L QE +D  L    +E   +R KID  + P++C+ Y +QF+
Sbjct: 57  SPNGQPVVISSVNVDMAMKLAQESMD--LQITKEEDTRLRWKIDFCMFPLMCLLYAVQFM 114

Query: 82  DKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSI-PANWVIQKF-PVAKYTGCA 139
           DK+S   A+   ++ DLK+ G+ Y  + +    GYL  ++ P  ++ Q+   +AK     
Sbjct: 115 DKISTGSAAVMGLRTDLKMHGDQYSWVGSAFYFGYLFMNMGPVQFIFQRSDKMAKMLALF 174

Query: 140 LVTWAILLIAH-IGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFL 198
           ++ W +LL  H + + NY+S +ALR LLG  E+ ++P   ++ + ++  +EQ  R+C + 
Sbjct: 175 VIIWGVLLSLHSVPSVNYASFIALRVLLGCAESVVTPCFTIITAQYWKTEEQFTRVCIWF 234

Query: 199 SMNGVATMVGALLAYGLG-HSTSTSLKPWKLIFLVIGLLNFVWAGIFLYM-APDSPANAR 256
            MNG+ +++ + +AYG+  H  S S+K W+L+F++ G++  ++ G  +Y   PD P+ AR
Sbjct: 235 GMNGLRSIILSAIAYGVYIHEDSYSIKAWRLLFIITGVIT-IFVGFLIYFWIPDDPSKAR 293

Query: 257 FLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNF 316
           FL+  EKL V++R+  NQ G  + ++K  Q  EA KD+ +W+  L  +   + NGG SNF
Sbjct: 294 FLSKREKLMVVERIRSNQQGFGNQQIKKYQIIEALKDVRTWLYFLFTVSSNIPNGGISNF 353

Query: 317 ISSLIKG-FGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLC---IPT 372
           +S L+   FGFS  +  LL +PTGA+ELV     G++AL+       I  + L       
Sbjct: 354 LSILLNSDFGFSTKDTFLLSIPTGAVELVGCPLFGILALYAANKKVPIWKYKLSWAIFSA 413

Query: 373 LAGLIGIHLIPLEH--KWALVGCCWLLYIIGGPVIMCWILINVTI--AGSSKISSVKIMW 428
           +  LI   ++   +  K A +   +L YI   PV    ++ N++   +G +K  +V  + 
Sbjct: 414 VLALIASCMLGFANGSKKARLAGAYLWYI--SPVSYICVISNISANSSGYTKKWTVSSIT 471

Query: 429 FLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRNRTRDRKYG 488
            + Y A N+ G + F AK+APKY      ++  Y+ M+ + +V   +    N+ RD    
Sbjct: 472 LVAYAASNLAGPQTFIAKQAPKYHGAKVSMVVCYSCMIVILLVLLLINIRENKRRD---- 527

Query: 489 KLTPESE-REGIING--FKDYTDFENKYFRYS 517
           K+  E E ++GI     F D TDFEN  FRY+
Sbjct: 528 KMALEREGKDGIFENLEFSDITDFENPNFRYT 559

>YJR152W (DAL5) [3043] chr10 (719581..721212) Allantoate and
           ureidosuccinate permease, member of the allantoate
           family of the major facilitator superfamily (MFS) [1632
           bp, 543 aa]
          Length = 543

 Score =  237 bits (604), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 161/527 (30%), Positives = 273/527 (51%), Gaps = 22/527 (4%)

Query: 6   QYEVNVNDAEQQSVTSGSSSPDQ--IPIADKHAVGVELFQELLDAELDTDDKEYAPIRRK 63
           + E+   D   + V S   SP+   + I+DK    ++L +E    E++   +E   +R K
Sbjct: 23  EAEIKNEDVTAEPVLSTVLSPNGKIVYISDKVDEAMKLAEE--AKEIEVTPEEDRKLRWK 80

Query: 64  IDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSI-P 122
           ID  + P++CI Y +QF+DK+S + A+   ++ DLK+ G+ Y  + +    GYL  ++ P
Sbjct: 81  IDYCMFPLMCILYAVQFMDKISTSSAAVMGLRTDLKMHGDQYSWVTSAFYFGYLFMNLGP 140

Query: 123 ANWVIQKFP-VAKYTGCALVTWAILLIAHIGAT-NYSSMMALRFLLGIMEASISPSNMMM 180
             ++ Q+   ++K     +V W +LL  H   T  Y S + LR LLG  E+ ++P   ++
Sbjct: 141 VQFIFQRTSHMSKMLAVFIVIWGMLLALHAAPTVKYPSFIVLRVLLGCAESVVTPCFTII 200

Query: 181 CSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLG-HSTSTSLKPWKLIFLVIGLLN-F 238
            + ++  +EQ  R+  +  MNG+ +++   +AYG+  H  S ++K W+ +F++ G++  F
Sbjct: 201 TAQYWKTEEQFTRVSIWFGMNGLGSILINAIAYGVYIHQDSYAIKGWRTLFVITGVITIF 260

Query: 239 VWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWI 298
           +   IFL++ PD P+ ARFL+  EKL V+ R+  NQ G  +  +K  Q  EA KD+ +W+
Sbjct: 261 IGILIFLWI-PDDPSKARFLSKREKLMVVQRIRSNQQGFGNHEIKKYQIIEALKDVRTWL 319

Query: 299 LALIGLGCGVVNGGTSNFISSLIKG-FGFSGLNATLLQLPTGAIELVCVFTAGMVALFTK 357
             L  +   + NGG S+F+S L+   FG+S     L+ LPTGA+ELV     G++A++  
Sbjct: 320 YFLFTVSSNIPNGGISSFMSILLNSDFGYSSKETLLMGLPTGAVELVGCPLFGILAVYAA 379

Query: 358 KNVRTILLFLLCIPTLAGLIGIHL-----IPLEHKWALVGCCWLLYIIGGPVIMCWILIN 412
                   + L     A ++ +            K A +   +L YI   PV    +L N
Sbjct: 380 NKKIPFWKYKLSWAIFAAVLALIASCMLGFATNSKKARLAGAYLWYI--SPVSFICVLSN 437

Query: 413 VTI--AGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSI 470
           ++   +G SK  +V  +  + Y A N+ G + F AK+APKY      ++  YA M+ L  
Sbjct: 438 ISANSSGYSKKWTVSSINLVAYAAANLAGPQTFIAKQAPKYHGAKVAMVVCYAVMIVLLS 497

Query: 471 VYYCMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYS 517
           +   +    N+ RD+   +     E E +   F D TDFEN  FRY+
Sbjct: 498 ILLIVNLRENKRRDKIAAERGFPEETENL--EFSDLTDFENPNFRYT 542

>KLLA0D11330g 970243..971808 similar to ca|CA2478|CaDAL52 Candida
           albicans allantoate permease (by homology), start by
           similarity
          Length = 521

 Score =  233 bits (595), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 150/518 (28%), Positives = 259/518 (50%), Gaps = 24/518 (4%)

Query: 8   EVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPIRRKIDRW 67
           +    D   Q++ S S     +  A   A+      E ++   + D K    ++RKID  
Sbjct: 19  DATTEDVPLQTILSPSGKVLVLGEAADEAMEFAKHHEHIELSAEEDRK----VKRKIDMI 74

Query: 68  LLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVI 127
           ++P+    YM+QF+DK  +++A+   ++ D K+    Y    +    GYL  S  A   +
Sbjct: 75  VMPLFSFLYMIQFMDKTCISFAAVMGIQTDYKMVDTMYSWTTSCFYLGYLFASPFAAVAL 134

Query: 128 QKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNK 187
           QK P  + +   +V W ++   H+ A +Y++   LR LLG++EA +SP  ++M + +Y K
Sbjct: 135 QKLPSMRTSAICIVIWGVIQCLHVTAKSYATFTLLRTLLGVLEAFVSPIFVIMMNQYYKK 194

Query: 188 QEQPFRMCTFLSMNGVATMVGALLAYGLGHST-STSLKPWKLIFLVIGLLNFVWAGIFLY 246
            E    +      NG+ T++ A ++YGL H+  S +++ +K++F+++G L      + L+
Sbjct: 195 SEHFGYIGVLYGCNGLGTVILACISYGLYHNLGSYTMEAYKVLFIIVGCLTIFNGLLILF 254

Query: 247 MAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGC 306
           + P++PA+ARFL   EKL V++R+  N  G      K  Q  E   D+ +W+  LIG+  
Sbjct: 255 IMPNTPADARFLNDREKLAVLERIRGNNQGFGSKTFKWHQMKECFMDMRTWLYFLIGISV 314

Query: 307 GVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALF-TKKNVRTILL 365
            + NGG S+F S ++KGFG+S   + L++ P GA ELV +    +++ F +K+ +  +  
Sbjct: 315 AIPNGGISSFGSIILKGFGYSTEKSLLMKAPIGACELVGLVILPLISYFISKRMIIAVFY 374

Query: 366 FLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIG-GPVIMCWI--LINVTIAGSSKIS 422
            L+C+ +   L            AL G     YI G  PV +  I   +    AG +K  
Sbjct: 375 LLVCVMSTCLLA----FSKNKNVALAG----YYITGIAPVGIITITSCVASNTAGHTKKL 426

Query: 423 SVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRNRT 482
           +   +  + Y+AGNI+G + F + +AP Y      ++  Y      SI    +M + N  
Sbjct: 427 TANAISLIGYSAGNIVGPQTFRSSDAPNYPKAKAAVVGCYCA----SIALMGLMSFLNVR 482

Query: 483 RDRKYGKLTPESEREGII---NGFKDYTDFENKYFRYS 517
            +R+  K+  E   + ++     F D TDFEN  FRYS
Sbjct: 483 ENRRRDKMQEELGDKYVVVENQEFADLTDFENPAFRYS 520

>YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS), has similarity to Dal5p [1572 bp, 523
           aa]
          Length = 523

 Score =  230 bits (586), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 264/529 (49%), Gaps = 35/529 (6%)

Query: 8   EVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLD--AELDTDD----------- 54
           E    +A+  SV++ S + D   +A +      L Q  LD  +  + DD           
Sbjct: 12  EKKAANADSCSVSTSSINVDDADVALRF-----LKQNGLDESSTANEDDVVAGEEANFYG 66

Query: 55  -KEYAP-IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAIC 112
             E +P + RK+D ++LP LC TY+L FLDK  LNYA++  +K+   LKGN++ ++  I 
Sbjct: 67  SHELSPKVLRKVDLFILPFLCCTYLLMFLDKALLNYAASMGIKD--HLKGNEFSNLGTIF 124

Query: 113 NAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEAS 172
           +A Y+       ++IQKFP++K  G  +  W I+L  H     Y+S+M +R LLG+ E+S
Sbjct: 125 SAAYIFMEPVVTYLIQKFPISKILGTFITVWGIVLACHAACKTYASLMVVRTLLGLFESS 184

Query: 173 ISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLV 232
            +   + +  M+Y K EQ  R+  + +  G   +VG L+++G  H   T+   W+++FLV
Sbjct: 185 SAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYHGTAFTSWQIMFLV 244

Query: 233 IGLLNFVWAGI-FLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEA- 290
           +GL+   +  + FLY+ PD+  NA FL  EEK++V++ +  NQ G++  + K +Q  E  
Sbjct: 245 VGLVTVAFGVLTFLYL-PDNVTNAWFLNKEEKIQVVEHIRANQTGLETKKFKKQQVKELF 303

Query: 291 AKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVCVFTA 349
             D  +W + L+     +  G    F  ++   FGF      LLQLP GAI  ++ + T 
Sbjct: 304 LHDKFTWPMLLLTACSQISTGAIGTFSVTITGTFGFDKYETALLQLPIGAITAMIILITT 363

Query: 350 GMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWI 409
            M++ +    + T  ++   IP + G I +  +PL HK   +   +LLY     +   +I
Sbjct: 364 QMLSRWGHITLITTSMY---IPAIIGCIVLISLPLSHKIGNLFSLYLLYSGSCVITNIYI 420

Query: 410 LINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLS 469
             +   +G +K      +  ++Y    II  ++F A  AP+YI     L+ +    + L 
Sbjct: 421 WNSCNTSGYTKRVFRNAITMIVYNVSCIIAPQMFRAYSAPRYIPAKIALLVTQCVCVPLQ 480

Query: 470 IVYYCMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           +    +    N  RD++      +  +E     F D TD EN+ FRY Y
Sbjct: 481 LYIGYICKKENEKRDKE------QEGQERKKYQFLDLTDIENRNFRYIY 523

>Kwal_47.17169
          Length = 576

 Score =  230 bits (586), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/485 (29%), Positives = 246/485 (50%), Gaps = 15/485 (3%)

Query: 45  LLDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGND 104
           L   +L    +E   + RKID ++ P+LC+ Y +QF+DK+S   A+   ++EDLK+ G+ 
Sbjct: 94  LESQQLKITPEEDRKLVRKIDLYMFPLLCLLYSIQFMDKISNGSAAIMGLREDLKMHGDQ 153

Query: 105 YGDIAAICNAGYLVGSI-PANWVIQKFP-VAKYTGCALVTWAILLIAHIG-ATNYSSMMA 161
           Y  + +    GYL  ++ P  ++ QK   +AK     ++ W + L  H   + NY+S + 
Sbjct: 154 YSWVGSAFYFGYLFFNLGPGQFIFQKTRWLAKTLAVFVMIWGMFLALHAAPSVNYASFIF 213

Query: 162 LRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGL-GHSTS 220
           LR LLG  E+ ++P+  ++ S ++ K+EQ  R+C +   NG+  +    LAYGL    +S
Sbjct: 214 LRVLLGCAESMVTPTFTIITSQYWKKEEQFMRVCMWFGFNGLGGIWANALAYGLYTRQSS 273

Query: 221 TSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDT 280
            S++ W+++F++ GL+      +  +  PD P+ A FLT  EKL V++R+  NQ G  + 
Sbjct: 274 YSIEAWRVLFIITGLITVAVGAMIYFHIPDDPSKAWFLTEREKLMVVERIRSNQQGFGNH 333

Query: 281 RLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKG-FGFSGLNATLLQLPTG 339
            +K  Q  EA  D+ +W+  L  +G  + NGG +NFI+ LIK   G+      L+ +PTG
Sbjct: 334 HIKKYQIKEAFTDVRTWLYFLFSVGNNIPNGGLTNFINILIKNELGYDTKKTLLMTMPTG 393

Query: 340 AIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPL-----EHKWALVGCC 394
           A+EL+     G +++   +     L   L    +A  + +    +     + K   +   
Sbjct: 394 AVELIACPLFGYLSIVCARRQIPFLRHRLAWGIMASTVAVVATCMLAFGGDSKNTKLAGA 453

Query: 395 WLLYIIGGPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITG 454
           +LLYI     I    +I+    G +K  +V  +  + Y + N+ G + F AK+AP Y   
Sbjct: 454 YLLYIAPLSFICILSIISSNTLGYTKKWTVSSINLVSYASSNLAGPQTFIAKQAPGYTGA 513

Query: 455 MKGLIASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGIING--FKDYTDFENK 512
              +I  YA  + +    Y + +  N  RD+      P+   E +I    F D TD EN 
Sbjct: 514 KIAMIVCYASTVVVLSALYILNYRENIRRDKIAAARGPD---EKVIENMEFADLTDKENP 570

Query: 513 YFRYS 517
           +FRY+
Sbjct: 571 HFRYA 575

>Scas_590.10
          Length = 534

 Score =  227 bits (579), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 142/469 (30%), Positives = 238/469 (50%), Gaps = 29/469 (6%)

Query: 60  IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVG 119
           + RK+D ++LP LC  Y+L FLDK  LNYA++  +K+   LKG+++ ++  I +A Y+  
Sbjct: 85  VLRKVDMFILPFLCCIYLLMFLDKALLNYAASMGIKK--HLKGDEFSNLGTIFSAAYIFM 142

Query: 120 SIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMM 179
                ++IQK+P++K     + TW I+L  H    +Y+S+M +R LLG+ EAS +   + 
Sbjct: 143 EPIVTYLIQKYPISKVLSVFITTWGIVLTCHCACKSYASLMIVRTLLGLFEASSAVGCIA 202

Query: 180 MCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFV 239
           +  M+Y K EQ  R+  +    G   +VG L+++G  H   T    W+++FLV+GL+  V
Sbjct: 203 ISGMYYTKSEQSARIGFWAIQAGTGYIVGGLISFGFLHYHGTEFTSWQIMFLVVGLVTIV 262

Query: 240 WAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEA-AKDLNSWI 298
           +  I  +  PD+  NA FLT EEK++V++ +  NQ G+++ + K +Q  E   KD  ++ 
Sbjct: 263 FGIITFFYLPDNVTNAWFLTQEEKIQVVEHIRSNQTGLENKKFKKEQIKELFLKDKLTYP 322

Query: 299 LALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVCVFTAGMVALFTK 357
           + L+     +  G    F +++   FGF      LLQLP GAI  L+ + T  M++ +  
Sbjct: 323 MLLLTACSQISTGAIGTFSTTITATFGFDSYQTALLQLPIGAITALIILITTQMISRWGN 382

Query: 358 KNVRTILLFLLCIPTLAGLIGIHLIPLEHK--------WALVGCCWLLYIIGGPVIMCWI 409
             + T  ++   IP + G I +  +PL HK            G C +  I        +I
Sbjct: 383 ITLVTTSMY---IPAIIGCIVMLALPLSHKVGNLLSLYLLYSGSCVITNI--------YI 431

Query: 410 LINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLS 469
             +   +G SK      +  ++Y    I+  ++F    AP+YI     L+ + A  + L 
Sbjct: 432 WNSCNTSGYSKRVMRNAITMIVYNVSCIVAPQMFRQYSAPRYIPAKIALLVTQAVCIPLQ 491

Query: 470 IVYYCMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           +    +    N+ RDR+      +  +E     F D TD EN+ FRY Y
Sbjct: 492 LYIGYICKKENQKRDRE------QEGKEVKKYQFLDMTDIENRNFRYIY 534

>KLLA0D02970g 252052..253704 similar to sp|P15365 Saccharomyces
           cerevisiae YJR152w DAL5 allantoate permease, start by
           similarity
          Length = 550

 Score =  228 bits (580), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 151/475 (31%), Positives = 247/475 (52%), Gaps = 12/475 (2%)

Query: 52  TDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAI 111
           T +K+ A + RKID  L P++CI Y +QF+DK++ + A+   ++ DLK+ G  Y  + + 
Sbjct: 78  TPEKD-AKLLRKIDLMLFPIMCIIYSVQFMDKITTSNAAIMGLQTDLKMHGEQYSYVGSA 136

Query: 112 CNAGYLVGSIPANWVIQKFP-VAKYTGCALVTWAILLIAHIG-ATNYSSMMALRFLLGIM 169
              GYL G     +++QK     K     +V W ++L  H   + NY S + LR LLG +
Sbjct: 137 FYFGYLGGLFILPFLMQKTKKFMKMLTSIIVIWGMVLALHAAPSVNYPSFIFLRCLLGFL 196

Query: 170 EASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLG-HSTSTSLKPWKL 228
           E++I+P+  ++ S ++ K+EQ  R+  +   NG+ ++ G  +AYGL  H  S  L  WKL
Sbjct: 197 ESAITPAFTIITSQYWKKEEQFSRITCWFGFNGLGSIWGGAIAYGLYIHKDSYPLAAWKL 256

Query: 229 IFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAW 288
           +F++ G +  V   I +   PDSP  A F + EEKL +++R+ +NQ G  +  +K  Q  
Sbjct: 257 VFIITGCITIVVGFIMMIHLPDSPDKAWFFSEEEKLLLVERIRENQQGFGNHHIKKYQIV 316

Query: 289 EAAKDLNSWILALIGLGCGVVNGGTSNFISSLIK-GFGFSGLNATLLQLPTGAIELVCVF 347
           EA KD+ +W+  L  +   + NGG +NF S L+K  F FS   + L+ + +GA+ELV   
Sbjct: 317 EAFKDVRTWLYFLFSVSSNIPNGGITNFSSILLKEDFQFSTDKSLLVNMGSGAVELVGCP 376

Query: 348 TAGMVALFTKKNVRTIL---LFLLCIPTLAGLIGIHLIPL-EHKWALVGCCWLLYIIGGP 403
             GM++ +  K    ++   L      T    +G+ ++   +H  +      +L+ I   
Sbjct: 377 LFGMLSFWCLKRKYKVVGSRLAWAFFATAICFMGVCMLAFAKHDKSARLAGLMLFGISPV 436

Query: 404 VIMCWI-LINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASY 462
             +C +  I+    G +K  +V  +  L Y + NI G   F A +AP Y      L+ +Y
Sbjct: 437 SFICVLSCISSNTLGFTKKWTVSSINLLAYASANIAGPHTFIATQAPSYTGAKISLVVNY 496

Query: 463 AGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYS 517
           A  M + ++ Y +    N+ RD+   + T E   E I   F D TDFEN  FRY+
Sbjct: 497 AAAMVIIVLIYIVNARENKRRDKIEAERTHEQVVENI--EFADLTDFENLKFRYA 549

>Kwal_33.15276
          Length = 552

 Score =  226 bits (577), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/536 (28%), Positives = 271/536 (50%), Gaps = 34/536 (6%)

Query: 1   MASKEQYEVNVNDAEQQSVTSGSSSPDQIPIADK-----HAVGVELFQELLDAELDTDDK 55
           ++S E  +     +E+ +VT    S + + +A K     HA  V L ++   A+   D K
Sbjct: 33  VSSTESEKSRKRVSEETAVTD---SDEDVDVALKYLKRAHAEKVALSEDSTSAQEAVDKK 89

Query: 56  EY---------APIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYG 106
                      + + RK+D ++LP LC TY+L FLDK  LNYA++  +K+   LKG+++ 
Sbjct: 90  AQNYFGSHELDSKLLRKVDWYILPFLCCTYLLMFLDKALLNYAASMGIKK--HLKGDEFS 147

Query: 107 DIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLL 166
           ++  I +A Y+       + IQ++PV+K  G  ++ W  +L  H    +Y+S+M +R LL
Sbjct: 148 NLGTIFSAAYIFAEPFVTFCIQRYPVSKVMGVFIMLWGAVLACHSACKSYASLMIVRTLL 207

Query: 167 GIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPW 226
           G+ E+S +   + +  M+Y K EQ  R+  + +  G   +VG L+++G  H   T    W
Sbjct: 208 GLFESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYHGTEFTSW 267

Query: 227 KLIFLVIGLLNFVWA-GIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPK 285
           +++FLV+GL+  ++    F+Y+ PD+  NA FL  +EK++V+  +  NQ G+++ +LK  
Sbjct: 268 QIMFLVVGLVTVLFGIATFVYL-PDNVTNAWFLNEDEKVEVLRHIRANQTGLENKKLKKH 326

Query: 286 QAWEA-AKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIE-L 343
           Q  E    D  ++ + ++     +  G    F  ++ + FGF    + LLQLP GAI  +
Sbjct: 327 QLKELFCLDKLTYPMLMLTACSQISTGSIGTFSVTITQTFGFDKYESALLQLPIGAITAM 386

Query: 344 VCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGP 403
           + + T  M++ +    + T+ ++   IP + G I +  +PL HK   +   +LLY     
Sbjct: 387 IILITTQMLSRWGNYTLVTVSMY---IPAIIGCIVMICLPLSHKIGNLFALYLLYSGSCV 443

Query: 404 VIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYA 463
           +   +I  +   +G SK      +  ++Y    I+  ++F A  AP+Y+     L+ +  
Sbjct: 444 ITNIYIWNSCNTSGYSKRVFRNAITMIVYNISCIVAPQMFRAYSAPRYMPAKITLLVTQC 503

Query: 464 GMMFLSIVYYCMMHYRNRTRDRKY-GKLTPESEREGIINGFKDYTDFENKYFRYSY 518
             + L +    +    N+ RDR+  GK  P  +       F D TD EN+ FRY Y
Sbjct: 504 VCVPLQLYIGYLCREENKKRDREQEGKEVPSYQ-------FLDLTDIENRSFRYVY 552

>CAGL0G04081g 388383..389924 highly similar to tr|Q07904
           Saccharomyces cerevisiae YLR004c, hypothetical start
          Length = 513

 Score =  218 bits (555), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 261/525 (49%), Gaps = 32/525 (6%)

Query: 12  NDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPIRRKI------- 64
            D E++S  S + + +     ++  V ++  ++  D E   DD  ++  RR I       
Sbjct: 3   KDLEKESQLSKAYTSESSFSENEVDVALKFLKQNGDVERVIDD--HSVDRRAIFYGSKKL 60

Query: 65  --------DRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGY 116
                   D+++L  LC+TY+L FLDK  LNYA+A  +K++LK  G+++ +++ I +A Y
Sbjct: 61  DKKIKRKLDKYILSFLCVTYLLMFLDKALLNYAAAMGIKKNLK--GDEFSNLSTIFSAAY 118

Query: 117 LVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPS 176
           +        +IQ FP++K  G  + TW  +L  H     Y+S+M +R LLG+ E++ +  
Sbjct: 119 IFMEPIVTLLIQYFPLSKIMGTFICTWGAVLACHSACKTYASLMIVRTLLGMFESASAVG 178

Query: 177 NMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLL 236
            + +  M+Y K EQ  R+  + +  G   ++G L+++G  H        W+++FLV+GL+
Sbjct: 179 CIAISGMYYTKSEQSARIGFWATQAGTGYVIGGLISFGFLHYHGRDFTSWQIMFLVVGLI 238

Query: 237 NFVWAGI-FLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEA-AKDL 294
             V+  + FLY+ PD+  NA FL H+EK+ VI+ +  NQ G+++ + K     E   KD 
Sbjct: 239 TVVFGIVTFLYL-PDNVTNAWFLDHDEKVAVIEHIRDNQTGVENKKFKKSHIKELFLKDK 297

Query: 295 NSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLP-TGAIELVCVFTAGMVA 353
            +W + +I     +  G   +F +++ K FGF    + LLQLP    + ++ + T  M++
Sbjct: 298 LTWPMLMITACSQISTGAIGSFSTTITKTFGFDSYESALLQLPIGAIVAIIIIVTTQMIS 357

Query: 354 LFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINV 413
            +    + T  ++   IP + G I +  +PLEHK   +   +L+Y     +   +I    
Sbjct: 358 RWGHFTLVTTSMY---IPAVIGSIVLISLPLEHKIGNLFSLYLVYSGSCVITNIYIWNTC 414

Query: 414 TIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYY 473
             +G  K      +  ++Y    I+  ++F A  AP+YI     L+ + A  + L +   
Sbjct: 415 NTSGYCKRIFRNAITMIVYNISCIVAPQMFRAYSAPRYIPAKIALLVTQAVCIPLQLYVG 474

Query: 474 CMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
            +    N  RD++     PE         F D TD EN+ FRY Y
Sbjct: 475 YLSKKENEKRDKEQEGQAPEKYM------FLDLTDIENRNFRYVY 513

>KLLA0E09548g complement(846600..848135) similar to sgd|S0003994
           Saccharomyces cerevisiae YLR004c, start by similarity
          Length = 511

 Score =  204 bits (519), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 134/462 (29%), Positives = 244/462 (52%), Gaps = 13/462 (2%)

Query: 60  IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVG 119
           + RK+D ++LP LC TY+L FLDK  LNYA++  +K++L   G+++ ++  I +A Y+  
Sbjct: 60  VLRKLDIFVLPFLCCTYLLMFLDKALLNYAASMGIKDNLV--GDEFSNLGTIFSASYIFA 117

Query: 120 SIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMM 179
              A +++Q+FPV++  G  ++ W ++++ H     Y+S+M +R LLG+ E+  +   + 
Sbjct: 118 EPFAVYLLQRFPVSRVLGSFIICWGVVVVCHCVCKTYASLMIVRVLLGLFESCSAVGCIT 177

Query: 180 MCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFV 239
           +  M+Y K EQ  R+  + +  G   ++G L+++G  H   T    W+++FLV+GL+   
Sbjct: 178 VNGMYYTKSEQTQRIGYWAAQAGTGYIIGGLMSFGFLHYHGTEFTSWQIMFLVVGLVTVG 237

Query: 240 WAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWE-AAKDLNSWI 298
           +  +  +  PD+   A FL  +EK++VI+ +  NQ G++  ++K  Q  E   KD  +W 
Sbjct: 238 FGIVTYFYLPDNVPKAWFLNEKEKVQVIEHIRSNQTGLETKKIKMHQVKELLLKDKLTWP 297

Query: 299 LALIGLGCGVVNGGTSNFISSLIKG-FGFSGLNATLLQLPTGAIELVCVF-TAGMVALFT 356
           + L+  GC  ++ G+    S  I G FGF     +LLQLP G + ++ +  T  ++  F+
Sbjct: 298 MLLLT-GCSQISTGSIGTFSVTITGTFGFDSYQTSLLQLPIGCVTIMIILITTQLIGRFS 356

Query: 357 KKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIA 416
           +  + T  ++   IP + G I +  +PL +K   +   +LLY     +   +I      +
Sbjct: 357 QFTLITTSMY---IPAIIGCIVMICLPLTNKIGNLLSLYLLYSGSCTITNIYIWNTCNTS 413

Query: 417 GSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMM 476
           G +K  +   +  ++Y    I+  ++F A   P+YI     L+ +    + L +     +
Sbjct: 414 GYTKRLARNGLTMIVYNIACIVAPQMFRAYSYPRYIPAKIALLVTQCVCVPLQL----YI 469

Query: 477 HYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
            Y + T +R+  K   ESE +     F D TD EN+ FRY Y
Sbjct: 470 GYTSYTENRRRDKEQAESETKPEQYQFLDKTDIENRNFRYIY 511

>Kwal_26.6658
          Length = 545

 Score =  200 bits (509), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 146/515 (28%), Positives = 251/515 (48%), Gaps = 21/515 (4%)

Query: 16  QQSVTSGSSSPD--QIPIADKHAVGVELFQELLDAELDTDDKEYAPIRRKIDRWLLPVLC 73
           ++ V +   SP+  +I I       ++L  + +D EL  ++ +   + RKID  + P++ 
Sbjct: 38  EKDVITTILSPNGKKIDITTDFDDAMDLGFQAIDIELTPEENK--KLVRKIDLCMFPLMS 95

Query: 74  ITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVA 133
           + Y +QF+DK +L  A+   +  DLK+ G+ Y    +    GYL G      ++QK    
Sbjct: 96  LIYAIQFMDKTTLGNAAIMGLLPDLKMTGDQYSWAGSAFYFGYLGGLFVLPPLLQKCQYF 155

Query: 134 KYTGCALV-TWAILLIAHIG-ATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQP 191
               CA++ TW ++L  H   + NY + + LR LLG  E++I+P+  ++ + ++ K+EQ 
Sbjct: 156 MKLLCAIIITWGMVLALHSAPSVNYGAFIFLRCLLGFFESTITPAFTIITAQYWKKEEQF 215

Query: 192 FRMCTFLSMNGVATMVGALLAYGLG-HSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAPD 250
            R+C +   NG+  M G  +AYGL   ++  S+  WK++F+  G +   +  + +   PD
Sbjct: 216 LRICIWFGFNGLGAMWGCSMAYGLYIRASEYSIAAWKIVFISTGCITIFFGLLMMLHLPD 275

Query: 251 SPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVN 310
           SP  A FL+  +K+ +  R+  NQ G  +  +K KQ  EA  D  +W+     +   + N
Sbjct: 276 SPTKAWFLSKHDKVLLTRRIRDNQQGFGNHHIKKKQIQEALIDPRTWLYFFYCVSASIPN 335

Query: 311 GGTSNFISSLIKG-FGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKK---NVRTILLF 366
           G  +NF S L K  FG++     L+ +   AI+ + +   G+ + F  K   N     L 
Sbjct: 336 GALTNFQSILFKSDFGYTTEKTLLVSIGIAAIQWIGLPLLGLASFFCAKRKINYLESRLI 395

Query: 367 LLCIPTLAGLIGIHLIPL--EHKWALVGCCWLLYIIGGPVIMCWILINVT--IAGSSKIS 422
              +  L  LIG+ ++    E+K A +    L Y+   P+    +L N++    GS+K  
Sbjct: 396 WSMMALLVALIGVCMLAFAKENKNAKLAGIALNYL--SPLAFICVLGNISANTLGSTKKW 453

Query: 423 SVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRNRT 482
           +V  +  + Y A NI G   F + +AP Y      L+  YA  + +    Y +    N+ 
Sbjct: 454 TVSSITLIGYAAANIAGPHTFISSQAPHYSGAKITLVVCYASGIAILATLYLLNARENKR 513

Query: 483 RDRKYGKLTPESEREGIINGFKDYTDFENKYFRYS 517
           RD    +  P+ E       F D TDFEN +FRY+
Sbjct: 514 RDEIVLEKLPQIENI----EFADLTDFENPFFRYT 544

>Kwal_47.16596
          Length = 504

 Score =  182 bits (462), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 146/539 (27%), Positives = 253/539 (46%), Gaps = 59/539 (10%)

Query: 3   SKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDT---DDKEYAP 59
           S++  E++    ++  V+S +SS  +       A G +    L DA L+T     +E   
Sbjct: 2   SEDNKELSRGVIDEAEVSSRNSSLIE---KTNQASGED---ALDDAYLETVTFTAEEERA 55

Query: 60  IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVG 119
           + RKID ++LP++C  +  Q+LDK SL+YA+ + + +DLK+  +D     + C+  + +G
Sbjct: 56  LVRKIDLYILPIMCFVFFSQYLDKQSLSYATVFGLTKDLKMGAHD----ISWCSTIFYIG 111

Query: 120 SIPANWV----IQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISP 175
            + AN+V    +   P A  TG  +V W++  +              R  LGI EA + P
Sbjct: 112 QLGANFVFTYLMTVIPRAPMTGACVVIWSVCCMCLAAPNTKQGFWVGRLFLGIFEAVVQP 171

Query: 176 SNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGL 235
           + +++ S +Y K+EQP R   ++SMN +A ++G+ L YG+G +  +S   WK++F+  G 
Sbjct: 172 ACVLITSYWYRKREQPMRTACWISMNAIAQIIGSYLMYGIGKTNKSSTADWKILFIACGA 231

Query: 236 LNFVWAGIFLYM-APDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDL 294
           ++ + AG+  Y+  P SP  ARFLT  EK   + R+            K +Q +E  K  
Sbjct: 232 ISLI-AGVLFYLWIPISPRTARFLTKREKEIAVKRLFDESDRTATNVFKKEQLFECLK-F 289

Query: 295 NSWILALIGLGCGV-VNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVA 353
           +   L+    G  V V  GT  F S +++ FG+   +      P GA++L+ ++ A +  
Sbjct: 290 DWLFLSAAAFGFLVTVTSGTIVFQSLMLRSFGYGKFDIMKFGSPAGAVQLLFIWLAVLAV 349

Query: 354 LFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINV 413
                    I L L+CIP LAG I +  +     W ++   WL     G VI C + + +
Sbjct: 350 RLIPSERAMITLVLVCIP-LAGSIMVLCLSKNSGWWMIVGSWL-----GSVISCIMSVLL 403

Query: 414 TIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYY 473
           ++  S+   + K            + S  F+A      I   +  I +Y G + ++++ +
Sbjct: 404 SLMSSNVRGNTK----------KSVCSNAFFAGYCLAAIIYPQWWIGTYRGGLIVNVIMW 453

Query: 474 CMMH-----YR------NRTRDRKYGKLTPESEREGI---INGFKDYTDFENKYFRYSY 518
            ++      YR      N+ RD+           EGI    +   D TD +N + RY Y
Sbjct: 454 VLLDILLIFYRFKAILENKKRDKMI--------EEGITLETHLVDDLTDKQNIHHRYVY 504

>Scas_630.15
          Length = 550

 Score =  171 bits (434), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 248/528 (46%), Gaps = 37/528 (7%)

Query: 11  VNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAEL-DTDDKEYAPIRRKIDRWLL 69
           VN++ Q SV S  S   +I I  K A     F E  DA + +   ++   +RRK+  W++
Sbjct: 36  VNESSQVSVESKHSGEYKI-ITSKDADATFTFMEENDASVPEITPEQEKRLRRKV-AWII 93

Query: 70  PVLCITY-MLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQ 128
             L  T   L + DK +L+YAS + + +D  L  N Y +   +   GY++G +   WV Q
Sbjct: 94  VSLTATIDFLLYSDKATLSYASIFELWDDTHLTQNRYNNANTLFYVGYIIGLVNLIWV-Q 152

Query: 129 KFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPS-NMMMCSMFYNK 187
           KF + K       TW I++  H  A NY  + ALRF LG +EA   P+ N+ M       
Sbjct: 153 KFSIRKVMAFMCTTWTIIIFLHCVAYNYQGIYALRFFLGFVEAIAVPTLNISMNQFLTPD 212

Query: 188 QEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLYM 247
           ++  +    + S  G    V +L+AYG+ H+ S  +  WKL  ++IG + F+   +  Y+
Sbjct: 213 EKNAYAPIFYSSCIGCGVFV-SLIAYGILHAHS-HVHTWKLFMIIIGGMTFLMTAVVYYI 270

Query: 248 APDSPANARFLTHEEKLKVIDRVSK-NQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGC 306
            P +P +A+FL  EEK+ VI RV K +   I+   +K  Q  EA KD  SW+ +   L  
Sbjct: 271 YPSNPTDAKFLNKEEKVWVIRRVQKSSNSSIEQKVIKKYQIIEALKDPVSWLFSAFFLLQ 330

Query: 307 GVVNGGTSNFISSLI-KGFG-FSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRTIL 364
            + N  T  ++ +L+ +  G  + L+ T++ + +G    VC   A +  L+ KKN     
Sbjct: 331 QLANNLT--YMQNLLFENIGHITNLDTTIVSIASGGFASVCAIIATIFLLY-KKNFTAFS 387

Query: 365 LFLLCIPTLAGLIGIHLIPLEHKWA-----LVGCCWLLYIIGGPVIMCWILINVTIAGSS 419
           +    +P+LA  I +  I    +W      L   C    + G P ++ +     + +G +
Sbjct: 388 VVFWTLPSLAACIAMVSI----RWGDNIPLLTMLCLASPLFGIPWVLMFSWSVTSCSGYT 443

Query: 420 KISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITG-MKGLIASYAGMMFLSIVYYCMMHY 478
           K  +   M    Y   NII  +++   +AP+++   +  ++ S+     L++V Y ++  
Sbjct: 444 KRVTRNAMVMFWYCIANIISPQLWQEHDAPRFVPAWITQIVLSFFLAPSLALVIYFILRR 503

Query: 479 RNRTRDRKYGKLTPESEREGIIN----------GFKDYTDFENKYFRY 516
           RN  R +    +    + EG I+             D TD EN+ F Y
Sbjct: 504 RNVKRLQ---NIQNSKDEEGFIDYDGENIVASGAQLDLTDLENEKFIY 548

>Kwal_23.6486
          Length = 547

 Score =  164 bits (416), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 141/519 (27%), Positives = 241/519 (46%), Gaps = 25/519 (4%)

Query: 17  QSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPI----RRKIDR---WLL 69
           + V S +   D +P  +K+ V      ++    L+ +D    PI     R++ R   W++
Sbjct: 33  ERVVSPADDRD-LPELEKYKVISSRDADVTLKFLEENDHLVEPISAERERRLSRKVTWIV 91

Query: 70  PVL-CITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPAN-WVI 127
             L     M+ + DK  +++A+ ++  ED  L  N Y +   +   G++ G   +N + +
Sbjct: 92  VSLTAFIDMVLYADKAVMSFAAIFTFFEDTGLTQNRYNNANTLFYVGFIFGQ--SNLYFL 149

Query: 128 QKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNK 187
           QKFPV K        W I++  H  A N+  + ALRF LG +E+   P+       F   
Sbjct: 150 QKFPVGKVVAVMTSLWCIIIFLHCTAFNHQGVYALRFFLGFVESIGIPALNTTMGQFLTA 209

Query: 188 QEQPFRMCTFLSMN-GVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLY 246
           +E+      F S   GV   VG  +AYG+ H TSTS+  WK+  ++IG ++ +   + + 
Sbjct: 210 EEKAATAPIFYSTCLGVTIPVG-FIAYGVLHITSTSVPTWKIFCIIIGAISLLVTILVVL 268

Query: 247 MAPDSPANARFLTHEEKLKVIDRVSKNQ-MGIKDTRLKPKQAWEAAKDLNSWILALIGLG 305
           + P++P +A+FLT EEK+ VI RV       I+  + K  Q  EA  D  +W+     L 
Sbjct: 269 IYPNNPTDAKFLTKEEKVWVIRRVQHTTGSSIEQKQFKKYQVKEALLDPITWLFGAFFLL 328

Query: 306 CGVVNGGTSNFISSLIKGF-GFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRTIL 364
             + N       + L KG  G S L+ATL+ + +GA ++ C   A    L  KKN+    
Sbjct: 329 QQLANNLAYQ-QNLLFKGIGGISNLDATLVSVASGAFDVACAILASWF-LSYKKNMTAFS 386

Query: 365 LFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGSSKISSV 424
           +    IP+  G IG   +P  +K  L+    L    G P I+ +   + T +G +K  + 
Sbjct: 387 VVFWTIPSFVGSIGSIALPWSNKMGLLATMCLATPFGVPWILMFSWNSTTCSGYTKKLTR 446

Query: 425 KIMWFLLYTAGNIIGSKIFYAKEAPKYITG-MKGLIASYAGMMFLSIVYYCMMHYRNRTR 483
                  Y   NII  +++    AP+Y    +  ++ S+     L++V + +++ RN+ R
Sbjct: 447 NAFVMFWYGIANIISPQLWQESSAPRYYPAWIVQIVCSFFTAPALALVIWYILNKRNKER 506

Query: 484 ------DRKYGKLTPESEREGIINGFKDYTDFENKYFRY 516
                 +   G +  + ++  +     D TD+ENK F Y
Sbjct: 507 AAALATEDTVGVVEHDGQKVKVNVAMLDLTDYENKAFIY 545

>YLL055W (YLL055W) [3368] chr12 (30109..31704) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1596 bp, 531 aa]
          Length = 531

 Score =  164 bits (414), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 241/519 (46%), Gaps = 29/519 (5%)

Query: 24  SSPDQIPIADKHAVGVELFQELLDAEL-DTDDKEYAPIRRKIDRWLLPVLCITYMLQFLD 82
           SS D+I +  + A     F E  DA + +   ++   ++RK+   +   +    +L ++D
Sbjct: 14  SSSDEILVPSRLADVTLAFMEENDAAVPEITPEQEKKLKRKLFLTIFTFVSAINLLLYMD 73

Query: 83  KLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVT 142
           K +L+Y S     ED  L  N Y  +  +   G+ +G  P  ++ QK P+ K+ G  L T
Sbjct: 74  KATLSYDSILGFFEDTGLTQNTYNTVNTLFYVGFAIGQFPGQYLAQKLPLGKFLGGLLAT 133

Query: 143 WAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNG 202
           W IL+     A N+S ++ALRF LG+ E+ + P  +    MF++  E+      F +   
Sbjct: 134 WTILIFLSCTAYNFSGVVALRFFLGLTESVVIPILITTMGMFFDASERAAAQPFFFAACM 193

Query: 203 VATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEE 262
            + +    +AYG+ H T+ S+  WK+  ++IG L F+   + +   P++PA+ +F + +E
Sbjct: 194 GSPIPTGFIAYGVLHITNPSISLWKIFTIIIGGLTFIMTVVVILWFPNNPADVKFFSIQE 253

Query: 263 KLKVIDRVSKNQ-MGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLI 321
           ++ +I RV  +    I+    K  Q  EA KD  +W+  L  L   + N       + L 
Sbjct: 254 RVWIIRRVQASTGSSIEQKVFKKSQFREAMKDYITWLFGLFFLLQQLANNLPYQ-QNLLF 312

Query: 322 KGF-GFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIH 380
           +G  G   L +TL+ +      +VC F A ++ L   KN+  +      +P L G I   
Sbjct: 313 EGMGGVDALGSTLVSVAGAGFAVVCAFIATLM-LAKWKNISALTAIFWTLPALVGSIAAA 371

Query: 381 LIPLEHKWA-LVGCCWLLYIIGGPVIMCWILINVTIAG-SSKISSVKIMWFLLYTAGNII 438
            +P ++K   L   C    I G P I+     + + +G + K++   +  F +  A NII
Sbjct: 372 ALPWDNKIGILANICMAGQIFGIPFIIALSWASSSASGYTKKLTRSSVSLFAMGIA-NII 430

Query: 439 GSKIFYAKEAPKYITG-MKGLIASYAGMMFLSIVYYCMMHYRNRTRDRKYGK-------- 489
             +I+  K++P+++   +  ++ S++    + ++ + ++  RN  R + Y +        
Sbjct: 431 SPQIWREKDSPRFLPAWIVQIVLSFSLAPAILLLIHFILKRRNNQRLKNYDENLQNYLDR 490

Query: 490 ------LTPESEREGIINGFK------DYTDFENKYFRY 516
                   P S  EG +   +      D TD EN+ F Y
Sbjct: 491 IQLIESENPSSIEEGKVVTHENNLAVFDLTDLENETFIY 529

>KLLA0C18678g complement(1655735..1657387) similar to sgd|S0003978
           Saccharomyces cerevisiae YLL055w, start by similarity
          Length = 550

 Score =  154 bits (390), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 132/525 (25%), Positives = 232/525 (44%), Gaps = 20/525 (3%)

Query: 5   EQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAP-IRRK 63
           E Y  + +D E +   + S       ++ + A     F E  D ++     E    + RK
Sbjct: 31  EHYSEDSDDTELRDDKTKSKYA---VVSSRDADATLGFLEEFDPQVPAITAEQEKRLSRK 87

Query: 64  IDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPA 123
           +   ++ +     ++ + DK + +YAS   + E++ +  N Y +   +   G++VG   A
Sbjct: 88  VTWIIVSLTAFINLILYSDKATASYASILGLWEEVGITQNQYNNSNTLFYVGFIVGQ--A 145

Query: 124 N-WVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
           N + +Q +P+          W I++  H   TNY S   LRF LG +E+   P       
Sbjct: 146 NLYFVQTYPLKYVVSVMTALWTIVIFLHCACTNYRSFYVLRFFLGFVESVAIPCLNTTMG 205

Query: 183 MFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAG 242
            F    E+      F S     T+    +AYG+ + TSTS+  WK+  ++IG   F+   
Sbjct: 206 QFLTADEKAASAPMFYSTCVGVTIPVGFIAYGVLNITSTSVSLWKIFMMIIGACTFLLTI 265

Query: 243 IFLYMAPDSPANARFLTHEEKLKVIDRVSKNQ-MGIKDTRLKPKQAWEAAKDLNSWILAL 301
           + L++ P++P +A+FL   EK+ VI RV +     I+   +K  Q  EA  D  SW+ A 
Sbjct: 266 LVLFIYPNNPTDAKFLNTNEKVWVIRRVQQTTGSSIEQKVVKKHQIKEALLDPISWLFAA 325

Query: 302 IGLGCGVVNGGTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNV 360
             L   + N       + L K  G  S L++TL+ + +G   + C   A    L+  KN 
Sbjct: 326 FFLLQQLANNLPYQ-QTLLFKSIGNISSLDSTLVSVASGGFAVACCILATTFLLYF-KNY 383

Query: 361 RTILLFLLCIPTLAGLIGIHLIPLEHKWALVG-CCWLLYIIGGPVIMCWILINVTIAGSS 419
               +    IP+  G I +  IP +   AL+   C      G P I+ +   + T +G +
Sbjct: 384 TAFSVVFWTIPSFVGSIAMVSIPFDKHIALLAMLCMASPAFGVPWILMFSWNSTTCSGYT 443

Query: 420 KISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITG-MKGLIASYAGMMFLSIVYYCMMHY 478
           K  +   +    +   N+I  +++  K+ P+YI   +  ++ S++    ++IV + ++  
Sbjct: 444 KKLTRNAIVMFFFCVANLISPQLWQEKDGPRYIPAWIVQIVLSFSIAPSIAIVIWYILRK 503

Query: 479 RNRTR-------DRKYGKLTPESEREGIINGFKDYTDFENKYFRY 516
           RN+ R       ++K+G +    E         D TD ENK F Y
Sbjct: 504 RNQERAINLEAEEKKFGLIEVNGESIKANIAMLDLTDHENKTFIY 548

>KLLA0F00286g 14519..16138 some similarities with sp|Q9C0U9
           Schizosaccharomyces pombe Putative membrane transporter,
           hypothetical start
          Length = 539

 Score =  148 bits (374), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/456 (26%), Positives = 218/456 (47%), Gaps = 29/456 (6%)

Query: 80  FLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCA 139
           F+DK ++ Y +   +  D  +   D+ ++ +I  AGYL+   P + ++QK P+ KY   +
Sbjct: 92  FMDKSTIGYTTILGIYTDTGISKGDFNNLNSIFYAGYLIAQWPCHILMQKLPLGKYLAGS 151

Query: 140 LVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLS 199
           + +WAI++       NY S+MA RF LG  EA + P+  +   MF   +++      F +
Sbjct: 152 IFSWAIIVGLTGICNNYGSLMACRFFLGATEAVVVPACEITLGMFLTTEQREIVQPVFWA 211

Query: 200 MNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLT 259
               A ++ + +++GL H T+TS  PW++   +   L+ + A I L + PD+PANA+FL+
Sbjct: 212 ATAAAPLLSSFISFGLMH-TNTSTYPWRIFMAINAGLSLILAIIVLLLYPDNPANAKFLS 270

Query: 260 HEEKLKVIDRVSKN-QMGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFIS 318
            +EK+ +I +V ++ +  I+   +K  Q +E  KD  SW+         + N  T    +
Sbjct: 271 TKEKVYLIKQVQRSTESSIEQKTIKKYQIYETFKDPVSWLFFFQSFTLMLSNSLTYQ-QN 329

Query: 319 SLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIG 378
            L    G   L ++L+       +++       V L        I    L +P +A  I 
Sbjct: 330 QLYVDIGVDNLGSSLVSAAGSVWDILLYLIFAFVILNYPNQSGYIAAGCLILP-IASSIA 388

Query: 379 IHLIPLEHKWALVGCCWLLYIIGGPVIMCWIL----INVTIAGSSKISSVKIMWFLLYTA 434
           +  I   +K+AL+ C   + + G    + +I+       + AG +K     +M+ L Y A
Sbjct: 389 MVTIDWSNKYALLAC---MILAGSSKGITYIIALGWTTSSAAGYTKKLYRNVMFMLAYGA 445

Query: 435 GNIIGSKIFYAKEAPKYITG-MKGLIASYAGMMFLSIVYYCMMHY----RNRTR------ 483
            NII  +++  K+AP+Y    +  ++ S+    FL+IV    + Y    RN+ R      
Sbjct: 446 ANIISPQLWNPKDAPRYYPSWIIQIVVSF----FLNIVILLTIRYILAKRNKERYQWVQE 501

Query: 484 --DRKYGKLT-PESEREGIINGFKDYTDFENKYFRY 516
             +  +G ++  E   E +     D TDFENK F Y
Sbjct: 502 HPEDNFGIVSFTEGVNERVNLAMLDLTDFENKRFIY 537

>KLLA0C19019g 1689555..1691090 weakly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1}, start by
           similarity
          Length = 511

 Score =  134 bits (338), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 102/416 (24%), Positives = 195/416 (46%), Gaps = 25/416 (6%)

Query: 4   KEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPIRRK 63
           K   EV   D E +S +  S S +Q              + L +  L+ D KE A   RK
Sbjct: 22  KSVIEVGECDGEGESGSIASFSIEQ--------------ESLENENLEIDPKEEAAFVRK 67

Query: 64  IDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPA 123
           +D  LLP+L   Y L  LD+ ++  A    M+EDL+L    Y +  ++  + YL   +P 
Sbjct: 68  LDTRLLPMLAFMYFLSSLDRSNIGNAYTSGMREDLQLTSKQYSNAVSVFYSTYLAAELPT 127

Query: 124 NWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSM 183
             +++K     Y    +++W+I+ + +    +Y+S++ALR LLG  E    P+  ++ S+
Sbjct: 128 TLILKKTKPKYYMSFLVLSWSIITLCNAFVQSYASLIALRVLLGAFEGGFFPAMTLIISI 187

Query: 184 FYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGH-STSTSLKPWKLIFLVIGLLNFVWAG 242
            Y KQEQ  R+  F   + ++   G L+A GL     +  L+ W+ ++++ GL++ V A 
Sbjct: 188 LYKKQEQGKRIAFFFGSSALSGAFGGLIATGLASMKPAGGLEGWRWLYIIEGLIS-VCAS 246

Query: 243 IFLYMA-PDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILAL 301
           ++L++  P    N  +L+  E   +  R  +    + D R +    ++A KD  ++I   
Sbjct: 247 VWLFLELPKDFDNIPYLSARETEILKIRAKQRVAYMGDGRFEWSYVFDALKDFKTYISFT 306

Query: 302 IGLGCGVVNGGTSNFISSLIK-GFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNV 360
           I     V+  G S F+++++K G G++   A  + +P   +  + VF   +++ +    +
Sbjct: 307 IQFCQDVILYGFSTFVTAILKLGLGYTSREAQYMSVPVYILAAI-VF---LISAYISDRL 362

Query: 361 RTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYI---IGGPVIMCWILINV 413
           +      +C   +  +  I L+ + +       C+L+      G  + + W+  NV
Sbjct: 363 KVRAPIFVCYNVIGAVGYILLLSVHNNSVKYFACYLITFSLYTGTGLNIAWLTNNV 418

>ADR330W [2071] [Homologous to ScYGR260W (TNA1) - SH]
           complement(1283989..1285470) [1482 bp, 493 aa]
          Length = 493

 Score =  133 bits (335), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 126/493 (25%), Positives = 223/493 (45%), Gaps = 22/493 (4%)

Query: 32  ADKHAVGVELFQELLDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASA 91
           A+     +E+  +   AE   D      I RK+D  LLP++CI Y L  LDK ++  A+ 
Sbjct: 17  ANNEEFEIEIGSDEDVAEPGLDHPMERRIVRKMDLCLLPLMCILYFLSNLDKSNIGNAAI 76

Query: 92  YSMKEDLKLKGNDYGDIAAICNAGYLV-GSIPANWV-IQKFPVAKYTGCALVTWAILLIA 149
             M EDLKL GN YG+   +  A Y+    I AN + I   PV   TGC ++ + ++ + 
Sbjct: 77  AGMTEDLKLVGNQYGNCVTVFFATYITFDPIGANLMNIVGAPVMM-TGC-IIGFGLISLC 134

Query: 150 HIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGA 209
                NY  ++ +R LLG  E +I P+  M  S+ Y +++   R         V++  G 
Sbjct: 135 TAWVKNYWQLLLIRILLGAFEGNIYPAINMYLSVCYRREQYAIRFAWVFFAACVSSSFGG 194

Query: 210 LLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDR 269
           L++YG  H    SL  W+ I++V G L       + +    +  ++ F   EE+  +I R
Sbjct: 195 LISYGCAH-IKGSLNAWQYIYIVEGALTLAVVPFYWFGLSKNLQDSWFFNKEEREYIIRR 253

Query: 270 VSKNQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGL 329
                    + R + +Q W A +D+ +WI A+      +   G + F+  +I G GF+ +
Sbjct: 254 YETMYTYNPNERFEWRQLWLAVRDVKTWISAISLFCIDLTTFGLTIFMPIIISGMGFTHI 313

Query: 330 NATLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGL---IGIHLIPLEH 386
            A L+ +P      +  F    ++   K  +R+  +   C+    GL   +G H   ++ 
Sbjct: 314 RAQLMTVPVYFFTAITFFICAYLS--DKLRLRSPFIVGACVTCAIGLAIVLGSHSNAVKF 371

Query: 387 KWALVGCCWLLYIIGGPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAK 446
               V    L   +       W+  NV+     + +++ I  F   ++G ++  +IF   
Sbjct: 372 FGIFVLA--LGIYVNASTNCLWLSGNVS-NYYKRATALGINLFSGSSSG-LVAGQIFTEA 427

Query: 447 EAPKYITGMKGLIASYAGMMFLSIV-YYCMMHYRNRTRDRKYGKLTPESEREGIINGFKD 505
           E P Y TG+   ++     +FL+++  +C  +YR    ++K   +  +S++E +   F  
Sbjct: 428 EKPGYKTGLTLCMSLQIAAIFLTLLQLFC--YYR---LNKKKKAMLAQSDKEEL--KFDR 480

Query: 506 YTDFENKYFRYSY 518
               EN +F Y Y
Sbjct: 481 SLGDENPHFLYMY 493

>KLLA0A09449g 825574..827106 similar to sp|P53322 Saccharomyces
           cerevisiae YGR260w TNA1, start by similarity
          Length = 510

 Score =  132 bits (331), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 119/461 (25%), Positives = 208/461 (45%), Gaps = 12/461 (2%)

Query: 60  IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYL-V 118
           + RK+D +L+P++C+ Y L  LDK ++  A    + E L L GN YG+   +  A Y+  
Sbjct: 60  VVRKMDLYLVPLMCMLYFLSNLDKSNIGNAEVAGLSESLNLTGNQYGNCVTVFYATYIFF 119

Query: 119 GSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNM 178
             I AN +    P    TGC L+ +  + +      +Y  ++ +R LLG  EA+I PS  
Sbjct: 120 DPIGANLLKIIGPKYMMTGC-LICFGAISLGTAWVKDYGHLLLVRVLLGAFEATIYPSIN 178

Query: 179 MMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNF 238
           M  S+ Y +++   R         +++  G L++YG     + SL  W+ I++V G ++ 
Sbjct: 179 MYLSICYRREQYAIRFAWVFFAACISSSFGGLISYGCS-KINGSLNAWQYIYIVEGCISL 237

Query: 239 VWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWI 298
            +A  +     ++   + F T EE+  ++DR           + +  Q W A KDL +W+
Sbjct: 238 GFAPFYALGLANNLEESWFWTAEERQYIVDRYETMSTFNPADKFEWSQVWLAVKDLKTWV 297

Query: 299 LALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKK 358
            A+      +   G + F+  +I   GFS +NA L+ +P   +  +  F    V+   + 
Sbjct: 298 SAVALFCIDMTAFGLTVFMPIIITSMGFSSVNAQLMTVPVYFLTAITFFACAYVS--DRI 355

Query: 359 NVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWL-LYIIGGPVIMCWILINVTIAG 417
            +R+  +   CI    GL  I L    H   L G   L L I     + C  L       
Sbjct: 356 RIRSPFIVGACISCATGL-AIVLGSDVHGVRLFGIFVLALGIYVNASMNCLWLSGNNGNY 414

Query: 418 SSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMH 477
             + +++ I  F+  ++G ++  +IF A++ P+Y  G+   +        L++V Y M  
Sbjct: 415 FKRATALGINLFVGSSSG-LVSGQIFRAEDKPRYALGLAICLGLQVFAAMLTVVQYYM-- 471

Query: 478 YRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           YR R   +K   +    E +  I   +  +D  N  F+Y Y
Sbjct: 472 YR-RLNKQKQALIKRCEELDEPIPHDEHLSDM-NPQFKYMY 510

>Kwal_14.782
          Length = 491

 Score =  131 bits (329), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 97/414 (23%), Positives = 185/414 (44%), Gaps = 32/414 (7%)

Query: 11  VNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPIRRKIDRWLLP 70
           + D  + S+  G+   + +P             +  +AE   D +E   +  K+DR LLP
Sbjct: 7   LKDTTKVSINDGADVSEVVP------------GDFFEAEYYIDPREERALVSKLDRRLLP 54

Query: 71  VLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKF 130
           +L   Y L  LD+ ++  A    MKEDL+L    Y +  ++  + YL   +PA W+++  
Sbjct: 55  MLAFMYFLSSLDRSNIGNAYTSGMKEDLRLTSRQYSNAVSVFYSTYLAAELPAVWLLKIA 114

Query: 131 PVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQ 190
               Y    +  W+++ ++     +Y S++A R LLG  E    P+  ++ +M Y  +EQ
Sbjct: 115 KPRYYMSTLVFCWSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQ 174

Query: 191 PFRMCTFLSMNGVATMVGALLAYGLGHSTSTS-LKPWKLIFLVIGLLNFVWAGIFLYMAP 249
             R+  F   + ++   G L+A GL    STS L+ W+ ++++ GL++        +  P
Sbjct: 175 AKRIAFFFGSSALSGAFGGLIATGLASVKSTSGLEGWRWLYIIEGLISVCATAWLFFGLP 234

Query: 250 DSPANARFLTHEE--KLKVIDRVSKNQMGIKDTRLKPKQAWE----AAKDLNSWILALIG 303
           D+    +FL   E   +K+ ++     MG       P  +W     A KD  ++   +I 
Sbjct: 235 DNLDEMKFLNDRELAVMKIREKQRVQYMGA-----NPAFSWSQVLLAFKDFKTYFAFVIQ 289

Query: 304 LGCGVVNGGTSNFISSLIK-GFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRT 362
               ++  G S F+++++K G G++   A  + +P   +  +    +  V+   +  VR 
Sbjct: 290 FCQDIILYGFSTFLTAILKLGLGYTSREAQYMSVPVYILAAIVFMVSAYVS--DRFQVRG 347

Query: 363 ILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYI---IGGPVIMCWILINV 413
            + F  C   L     I L+ +++       C+L+      G  + + W+  NV
Sbjct: 348 PVFF--CYNILGATGYIILLAVKNNAVKYFACYLITFSLYTGTGLNITWLTNNV 399

>Kwal_47.16586
          Length = 502

 Score =  129 bits (325), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 116/475 (24%), Positives = 210/475 (44%), Gaps = 45/475 (9%)

Query: 46  LDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDY 105
           +D ++  DD     I  K D  +LP++ + Y+   LDK +++ A    + +DL ++G ++
Sbjct: 34  IDHDVLFDDALERSICWKFDVRILPMIAVMYLFNALDKGNISNAKTDHIDKDLGIEGQEW 93

Query: 106 GDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFL 165
            ++ +I    +++ + P + VI+K+  A      + T+  + +      NY S+MA R+ 
Sbjct: 94  NNMLSIFYIPFVLFAFPLSLVIKKYNAANVIPALMFTFGSISLLSATVFNYGSLMAARWF 153

Query: 166 LGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKP 225
           LGI E++  P  +   S FY + E   R+  F +   +A     LL++G+    ++ LK 
Sbjct: 154 LGICESAFFPGIIYYLSTFYRRHELARRLSIFYAAANIANAFSGLLSFGIFQIKNSKLKG 213

Query: 226 WKLIFLVIGLLNFVWAGI-FLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKP 284
           W+++FLV G L  ++A + FLY+ P SP  + FL+  EK     R+  +     D ++  
Sbjct: 214 WQILFLVEGSLTVIFAVVAFLYL-PRSPEKSHFLSENEKECARWRIEIDSSAKSDEKVSF 272

Query: 285 KQAWEAAKD--LNSWILA--LIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGA 340
           K A +  K     +W+    LIG+    +N      + SL KG   + L      +   A
Sbjct: 273 KDAIKVFKHPVAIAWMFQEILIGVPLNSINNWFPQIVQSLGKGTVHTNLYTVAPNVWGAA 332

Query: 341 IELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYII 400
             ++  F++          VR++ + +    TL G +            + GC      +
Sbjct: 333 ALIILCFSSDYA------RVRSVFIMIGVSVTLIGFV------------VFGCIDTKAHL 374

Query: 401 GGPVIMCWILI--------------NVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAK 446
           G     C+++               N      ++   +  +   L  A  +I + IF AK
Sbjct: 375 GVAYFSCFLMTTGSSVSSVLTSTWYNNNTPNENRRVVISAIGVPLANAAGLISTNIFRAK 434

Query: 447 EAPKYITGMKGLIASYAGMMFLSIVYYCM-MHYRNRTRDRKYG-----KLTPESE 495
           +APKYI  + G+ A + G   L I      M + NR R+++ G     K  P SE
Sbjct: 435 DAPKYIPAL-GITAGFGGAAILLIAAILAYMIFDNRRRNKRQGVNLTYKDVPTSE 488

>ABR113C [705] [Homologous to ScYLL055W - NSH] (601035..602474)
           [1440 bp, 479 aa]
          Length = 479

 Score =  127 bits (318), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 118/471 (25%), Positives = 213/471 (45%), Gaps = 11/471 (2%)

Query: 54  DKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICN 113
           + E   + RK+  +++ +      + ++DK  L+Y++     ED+ +  N Y ++  +  
Sbjct: 10  EAEEKKLARKVMWYIVGLTASINFITYIDKAQLSYSTLLGFFEDVNMSLNRYNNVNTLFY 69

Query: 114 AGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASI 173
            GY+ G I   + IQKFP+       L  W I+++     T+Y  +  LR  LG  EA I
Sbjct: 70  VGYITGQINLLF-IQKFPLKNVVIVLLTIWCIIMMVQCAMTDYKGVYVLRLCLGFTEAII 128

Query: 174 SPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVI 233
            P+      MF  + E+      F+      ++   +L+Y +    + ++  WK++ ++I
Sbjct: 129 IPALNNTMLMFLTENEKAATAPIFVIATVSVSIPMGVLSYLILLIKNPAISHWKILSIII 188

Query: 234 GLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQ-MGIKDTRLKPKQAWEAAK 292
           G L FV A + LY+ P++P +A+FL+ +EK+ VI RV       I+  ++K  Q  E  +
Sbjct: 189 GSLTFVVALVALYLYPNNPTDAKFLSLKEKVWVIRRVQDTTGSSIEQKKIKKHQIIEGLR 248

Query: 293 DLNSWILALIGLGCGVVNGGTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVCVFTAGM 351
           D  SW L L+      +    S   + L+K  G    ++A+L+   +G + ++    A  
Sbjct: 249 DPISW-LFLLFFATQQLANNLSYQRNLLLKSAGHIDDMHASLISSSSGGLAVIGSLVASF 307

Query: 352 VALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLE-HKWALVGCCWLLYIIGGPVIMCWIL 410
           + +F KKN     + L  IP+  G + +  +P   H   +V  C      G P IM    
Sbjct: 308 I-MFKKKNFTAYTVVLWSIPSFIGCVAMMALPDNAHIAMVVMICIASSTDGIPWIMMISW 366

Query: 411 INVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMK-GLIASYAGMMFLS 469
              + +G SK  +   M  + Y+  N+I  +++     P+Y       L  S+     L+
Sbjct: 367 STTSTSGYSKRLTRIGMVMVGYSISNLISPQLWQEAHGPRYYPAWAVQLSLSFFFAPALA 426

Query: 470 IVYYCMMHYRNRTR----DRKYGKLTPESEREGIINGFKDYTDFENKYFRY 516
           I+   ++  RN+ R        G +  + +         D TD ENK+F Y
Sbjct: 427 ILIRIILARRNKERLALASDNLGAVEIDGDLVKTNLAMLDLTDLENKHFIY 477

>CAGL0F08371g 835733..837322 highly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1, hypothetical
           start
          Length = 529

 Score =  127 bits (319), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 120/474 (25%), Positives = 212/474 (44%), Gaps = 36/474 (7%)

Query: 52  TDDKEY------APIRRKI----DRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLK 101
           TDD  Y       P+ +KI    D +++P+L + Y L  LDK ++  A    + + + LK
Sbjct: 61  TDDDGYMLPSLDHPMEKKILKKMDLFIIPLLGLMYFLSNLDKSNIGNAEVAGLSKSIGLK 120

Query: 102 GNDYGDIAAICNAGYLV-GSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMM 160
           G +Y     +    Y+V   + AN +    P    + C L   AI L A     NY  ++
Sbjct: 121 GKEYNIAVTVFFGTYIVFDPVGANLLKIMGPNRMMSSCLLCFGAISL-ATAFIKNYGQLL 179

Query: 161 ALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS 220
           A+R LLG+ E  I P+  M  S+ Y +++   R     +   +++  G L+AYG      
Sbjct: 180 AVRLLLGMFEGMIYPAINMYLSVCYRREQYAVRFAFVFTAAALSSAFGGLIAYGCS-KIH 238

Query: 221 TSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDT 280
            SL+ W+ I++V G ++  +  ++++       ++ F T EE+  VI+R +       D 
Sbjct: 239 GSLEAWQYIYIVEGAISIGFVPVYIWGLGRKLEDSWFFTEEEREYVIERYNTMNTFNPDE 298

Query: 281 RLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGA 340
           + +  Q W A KD+ +W+ A+   G  +   G + F+  ++   GFS + A L+ +P   
Sbjct: 299 KFEWFQVWLAVKDIKTWVSAIALFGIDLTTFGLTVFLPIIVTSLGFSHVRAQLMTVPVYF 358

Query: 341 IELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGC---CWLL 397
           +  V  F   + +   K  +R+  +   C+ T  GL  I L    H     G    C  +
Sbjct: 359 LTAVVFFVCAIWS--DKLKLRSPFIIGACLTTSIGL-AIVLGSTVHGVRYFGVFILCMGI 415

Query: 398 YIIGGPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKG 457
           Y+       C  L         + +++ I  F+   +G ++  +IF AK+ P+YI G+  
Sbjct: 416 YV--NAACNCLWLSGNNGNYFKRATALGINLFIGSGSG-LVSGQIFLAKDKPRYIMGLSL 472

Query: 458 LIASYAGMMFLSIVYYCM---MHYRNRTRDRK-------YGKLTPESEREGIIN 501
            +    G   LSIV   +   ++YR+  + +K        G+  P  ER   +N
Sbjct: 473 CL----GFQVLSIVMTALQFYLYYRSNQQKQKIIDHCHEIGEPIPYDERLSDLN 522

>Kwal_27.12832
          Length = 508

 Score =  122 bits (307), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 88/336 (26%), Positives = 156/336 (46%), Gaps = 17/336 (5%)

Query: 15  EQQSVT----SGSSSPDQIPIADKHAVGVELFQELLDAELD--TDDKEYAPIRRKIDRWL 68
           E+Q+V+      + S   I I +  A     F E   A  D   D  E   + RK+DR  
Sbjct: 10  EEQNVSMINHDLTKSSSAISIVENQACAESAFSEEQTASSDLYIDPDEEKALMRKLDRRF 69

Query: 69  LPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQ 128
           +PVL   Y LQ LDK ++  A    MKEDL+L  + Y +  ++  + +LV  +P    ++
Sbjct: 70  VPVLAFAYFLQSLDKTNIGNAYTSGMKEDLQLTPHQYSNAVSVLYSTFLVAQVPTVLYLK 129

Query: 129 KFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQ 188
             P   +    +  W+++ + +    +Y S++ALR LLG  E    P+ +++ SM Y  +
Sbjct: 130 IIPSRYFLSAMVFCWSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPE 189

Query: 189 EQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTS-LKPWKLIFLVIGLLNFVWAGIFLYM 247
           EQ  R+  F     +A   G L+A GL      S L  W+ ++++ GL++ + A I++Y 
Sbjct: 190 EQAKRIALFFGCAALAGAFGGLIATGLATVNGASGLNGWRWLYIIEGLIS-ITASIWIYF 248

Query: 248 A-PDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQA----WEAAKDLNSWILALI 302
             P       FL  +E+  +  R  +    +     KP  +    W+A KD   +   +I
Sbjct: 249 GLPTDIEKPAFLNEQEQAIMHIRAKQRLQYVGS---KPDFSWTFVWDALKDYKVYTGLVI 305

Query: 303 GLGCGVVNGGTSNFISSLIK-GFGFSGLNATLLQLP 337
                ++    + F+ +++K G G++   A  + +P
Sbjct: 306 QFCQNIILYAFTTFLPAILKLGMGYTSREAQYMSVP 341

>YGR260W (TNA1) [2206] chr7 (1012490..1014094) Nicotinic acid
           permease, member of the allantoate permease family of
           the major facilitator superfamily (MFS) [1605 bp, 534
           aa]
          Length = 534

 Score =  122 bits (306), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 120/507 (23%), Positives = 216/507 (42%), Gaps = 30/507 (5%)

Query: 12  NDAEQQSVTSGSSSPDQIPIADKHAVGVELFQEL-----LDAELDTDDKEYAP------- 59
           ND  ++  T  +   D+   A  H    +   EL     + A    DD   +P       
Sbjct: 24  NDGSEEKPTEVTFQEDEGHDASLHNRSHDKKSELATEREIMATTTDDDGIPSPSHPMEKR 83

Query: 60  IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGY-LV 118
           + RK+D +L+P++ + Y L  LDK ++  A    + +D+ L G  Y     +  A Y L 
Sbjct: 84  VLRKMDIYLIPLMGMLYFLSNLDKSNIGNAEVAGLSKDIHLVGTQYNTCVTVFFATYVLF 143

Query: 119 GSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNM 178
             I  N +    P    + C L  +  + +      NY+ ++ +R LLG  E  I P+  
Sbjct: 144 DPIGTNLLKIMGPPLMMSIC-LTCFGAISLGTAWVKNYAQLIVVRLLLGAFEGMIYPAIN 202

Query: 179 MMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNF 238
           M  S+ Y +++   R     S   +++  G L+AYG     S SLK W+ I++V G ++ 
Sbjct: 203 MYLSVCYRREQYALRFAFVFSAACLSSSFGGLIAYGCSK-ISGSLKDWQYIYIVEGCISL 261

Query: 239 VWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWI 298
            +   + +    +  ++ F   EEK  + +R         D + +  Q W+A KD+ +W 
Sbjct: 262 GFVPFYAFGLSKNLEDSWFFNKEEKEYISERYKTMNTFDPDEKFEWFQVWQAVKDVKTWA 321

Query: 299 LALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKK 358
            A+   G  +   G + F+  +I   GF+ + A L+ +P   +  +  F   + +   + 
Sbjct: 322 SAVALFGIDLTTFGLTVFLPIIITSMGFTNVRAQLMTVPIYFLTAIVFFICAVWS--DRI 379

Query: 359 NVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGC---CWLLYIIGGPVIMCWILINVTI 415
            +R+  +   C+ T  G I I L    H     G    C  +Y+       C  L   T 
Sbjct: 380 KLRSPFILGACLTTSIG-IAIVLGSQVHGVRYFGVYILCMGIYV--NAACNCLWLSGNTG 436

Query: 416 AGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCM 475
               + +++ I  F    +G ++  +IF AK+ P+YI G+   +A     +F+++V   +
Sbjct: 437 NYFKRATALGINLFFGSGSG-LVSGQIFVAKDKPRYIKGLSISLAFQVFSIFMTVVQIFL 495

Query: 476 MHYRNRTR----DR--KYGKLTPESER 496
               N  +    DR  + G+  P  ER
Sbjct: 496 YKRENDKKKAIIDRCNELGEPIPYDER 522

>Scas_645.7
          Length = 546

 Score =  111 bits (278), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 112/499 (22%), Positives = 209/499 (41%), Gaps = 26/499 (5%)

Query: 20  TSGSSSPDQIPIADKHAVGVELFQELLDAELDTD------DKEYAPIRRKIDRWLLPVLC 73
           TS  SS D      K    +   +E+L    D D            I +K+D +L+P++ 
Sbjct: 50  TSQESSTDCHHRDSKKERDLTRDREILATTTDDDGIPSISHPMEKQILKKMDIFLIPLMG 109

Query: 74  ITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGY-LVGSIPANWVIQKFPV 132
           I Y L  LDK ++  A    + +D+ L G  Y     +    Y L   I +N +    P 
Sbjct: 110 ILYFLSNLDKSNIGNAEVAGLSDDIGLVGTQYNTCVTVFFGTYILFDPIGSNLLKIMGPP 169

Query: 133 AKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPF 192
              + C L  + ++ +      NY+ ++ +R LLG  E  I P+  M  S+ Y +++   
Sbjct: 170 TMMSIC-LFCFGVISLGTAWIKNYAQLIVVRLLLGAFEGMIYPAINMYLSVCYRREQYAM 228

Query: 193 RMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSP 252
           R     S   +++  G L+AYG       SL  W+ I++V G ++  +   + +    + 
Sbjct: 229 RFAFVFSAAALSSSFGGLIAYGCSQ-IHGSLHSWQYIYIVEGAISIGFVPFYYFGLNKNL 287

Query: 253 ANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGG 312
            +  F   EE+  +++R         D + +  Q W A KD+ +W+ A+   G  +   G
Sbjct: 288 EDTWFFNKEEREYIVERYKTMNTYNPDEKFEWFQVWLAVKDIKTWVSAVALFGIDLTTFG 347

Query: 313 TSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKK-NVRTILLFLLCIP 371
            + F+  +I   GF+ + A L+ +P   +  +  F     AL++ K  +R+  +   C+ 
Sbjct: 348 LTVFLPIIITSLGFTNVRAQLMTVP---VYFLTAFVFFGCALWSDKLRLRSPFIIGACLT 404

Query: 372 TLAGLIGIHLIPLEHKWALVGC---CWLLYIIGGPVIMCWILINVTIAGSSKISSVKIMW 428
           T  G I I L    H     G    C  +Y+       C  L         + +++ I  
Sbjct: 405 TAVG-ISIVLGSKVHGVRYFGVFILCMGIYV--NAACNCLWLSGNNGNYFKRATALGINL 461

Query: 429 FLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRNRTRD---- 484
           F+   +G ++  +IF A + P Y+ G+   +A     + ++ + + +    N  ++    
Sbjct: 462 FIGSGSG-LVSGQIFVAADKPGYVKGLSICLAFQILSIIMTFIQFILYKRANAKKEAIII 520

Query: 485 --RKYGKLTPESEREGIIN 501
              + G+  P  ER   +N
Sbjct: 521 HCEEIGEPIPYDERLSDMN 539

>AFR229C [3421] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH]
           (853001..854608) [1608 bp, 535 aa]
          Length = 535

 Score =  110 bits (274), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 125/508 (24%), Positives = 224/508 (44%), Gaps = 54/508 (10%)

Query: 43  QELLDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKG 102
           ++  D +L    +E   + RK+D  +    C+ +    +D+ +L  A A +M +D+K+  
Sbjct: 50  RKAFDPQLTWTHEEERKLVRKLDLRVALTSCVLFAALQIDRGNLGQAVADNMLDDIKMNT 109

Query: 103 NDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMAL 162
           NDY     +    +L+  +P+  + +K     +    +V W+++ ++    +N +  +  
Sbjct: 110 NDYNLGNQLFYVFFLLAEVPSQLISKKLGPDIFIPIQMVAWSVVAMSQAALSNKTGYLIT 169

Query: 163 RFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTF-LSMNGVATMVGALLAYGLGHSTST 221
           R ++G++E       ++  S FY   E P R+  F  +M+ V      L           
Sbjct: 170 RSVIGLLEGGFIADLVLWLSYFYTATELPIRLSFFWTTMSLVEVCTSLLAFLLFRLRGIA 229

Query: 222 SLKPWK-------LIFLVIGLLNFVWAGIFLYMAPDSPANARFL------THEEKLKVID 268
            L  W+       L+ L+IGL     +G +L M P +      L      T  E+L V++
Sbjct: 230 GLTGWQWLFLLEGLLTLIIGL-----SGFYL-MVPSAVQTKNMLHPQGWFTEREELIVVN 283

Query: 269 RVSKNQMGIKDTR----LKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGF 324
           RV ++     D      L PK  W+A  D + W + +IGL   + +G  S +++  +K  
Sbjct: 284 RVLRDDPSKGDMHNRQALTPKLIWQALTDYDLWPIYVIGLVHYLPDGTVSPYLTLTLKSV 343

Query: 325 GFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIP-----TLAGLIGI 379
           GFS     LL +P      + +     +  F++K  +  LL L  IP     TL GL+  
Sbjct: 344 GFSKFTVQLLAIPRSI---IFIIFLLGITRFSEKISQRALLGL--IPSVWNTTLLGLLRW 398

Query: 380 HLIPLEHKWALVGCCWLLYIIGGPVI----MCWILINVTIAGSSKISSVKIMWFLLYTAG 435
               L   W       LL  +G P I    + W   N     +  IS+   ++ +    G
Sbjct: 399 WSGSLVKAWPTYTILTLL--LGAPYIHAICVSWASRNSNSIKTRAISAA--VYNMFVQMG 454

Query: 436 NIIGSKIFYAKEAPKYITGMKGL---IASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTP 492
           +II ++++   +AP Y  G + L   +A+   +  L  +YY  MH RN++RD+K+  +T 
Sbjct: 455 SIISNQLYREDDAPLYHRGNEILFWIMATNIPLFILVKLYY--MH-RNKSRDKKWNSMTE 511

Query: 493 ESEREGIINGFKDYTDFENKY--FRYSY 518
             +R  I+N     TD  NK   FR+++
Sbjct: 512 CQQRAYIVNT----TDKGNKRLDFRFAH 535

>KLLA0F09405g 867882..869513 similar to sp|P40445 Saccharomyces
           cerevisiae YIL166c, start by similarity
          Length = 543

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 107/466 (22%), Positives = 199/466 (42%), Gaps = 28/466 (6%)

Query: 71  VLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKF 130
           V C  ++   LD+ +L+ A A ++ EDL +  ND+     +    + +  +P+  + ++ 
Sbjct: 86  VACFLFIALQLDRGNLSQAVADNLLEDLHMDTNDFNLGNQLFYLSFFLAELPSQLISKRL 145

Query: 131 PVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQ 190
               +    +  W+++ +A     N +  +  R L+G +E       ++  + F+  +E 
Sbjct: 146 GPDIFIPIQICAWSVVAMAQAAMHNKAGFLICRCLIGALEGGFIADLVLWLTYFFTSKEL 205

Query: 191 PFRMCTFLSMNGVATMVGALLAYGLGHSTST-SLKPWKLIFLVIGLLNFV--WAGIFLYM 247
             R+  F +   +  +V ALLAYG+        L  W+ +FL+ G+L F+   +G +L M
Sbjct: 206 SIRLSWFWTSLSIVQVVSALLAYGILRMRGIGGLAGWQYLFLLEGILTFLIGLSGFYL-M 264

Query: 248 APDSPANARFL------THEEKLKVIDRVSKNQMGIKDTRLKP----KQAWEAAKDLNSW 297
            P +     ++      T  E+  V++RV ++     D   +     K  W A  D + W
Sbjct: 265 VPGAVQTKNWMHPKGWFTEREEKIVVNRVLRDDPSKGDMHNRQPISFKLLWSAISDYDLW 324

Query: 298 ILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTK 357
            + LIGL   V     S +++  +K  GFS LN  LL +P   I +  +      A    
Sbjct: 325 PIYLIGLIAYVPMNTVSTYLTLTLKSVGFSTLNVQLLSIPYQVIHITLLIGVTWYAERID 384

Query: 358 KNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVI----MCWILINV 413
           +     ++  +      G++      L   W     C LL  +GGP +    + W+  N 
Sbjct: 385 QRAYMGVIASIWNALFLGVLRWWKGSLVEAWPTFALCTLL--LGGPYVHAICVSWVSRNS 442

Query: 414 TIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIA-SYAGMMFLSIVY 472
               +  +SS   ++ +    G I  ++I+   +AP Y TG   L A S AG   + +  
Sbjct: 443 NSIKTRALSSA--LYNMAVQVGAIYSTQIYRKNDAPLYHTGNTVLFAISIAG---IPVFL 497

Query: 473 YCMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKYFRYSY 518
           +   +YR R + RK    +  SE E  +   +  +D  NK   + +
Sbjct: 498 FAKWYYRTRNK-RKEAIWSQMSEDER-VEYIQTTSDQANKRLDFRF 541

>YIL166C (YIL166C) [2512] chr9 complement(30938..32566) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS) [1629 bp, 542 aa]
          Length = 542

 Score =  107 bits (267), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 118/531 (22%), Positives = 231/531 (43%), Gaps = 49/531 (9%)

Query: 2   ASKEQYEVNVNDAE----QQSVTSGSSSPDQIPIADKH----------AVGVELFQELLD 47
             KE+Y++ V  A+     +S+TS S S    P  D H          + G E   +  D
Sbjct: 3   VQKEEYDI-VEKAQLSVSAESLTSDSESISHNPFDDFHKAERWRKVYESSGYEGLSKF-D 60

Query: 48  AELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMK--EDLKLKGNDY 105
            E      E   + RK+D  L   L +  M  FLD +  N A A S     DLK+  NDY
Sbjct: 61  PEFTWTKDEEKKLVRKMD--LKIFLWVFIMFAFLDLIRKNIARAVSDNFIVDLKMNTNDY 118

Query: 106 GDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFL 165
                +    +L   +P N + ++F   +     +V W+++ I   G  N    +A R L
Sbjct: 119 NLGQTVYLVIFLASELPGNLLSKRFGPERVIPVQIVLWSVICITQAGLKNRGQFIATRCL 178

Query: 166 LGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTST-SLK 224
           LG+++    P N++  S +Y   E  FR+  F     +  ++G+LLA G+       +L 
Sbjct: 179 LGMVQGGFIPDNILYLSYYYTGAELTFRLSFFWCAIPLFQILGSLLASGIIEMRGIHNLA 238

Query: 225 PWKLIFLVIGLLNFVWAGIFLYMAPDSPAN----------ARFLTHEEKLKVIDRVSKNQ 274
            W+ +F++ G L+        Y+    P            + F  +EEK+ +++R+ ++ 
Sbjct: 239 GWQYLFIIEGFLSLSVGVASFYLMRRGPTQTGESAFHKGKSLFTEYEEKI-MVNRILRDD 297

Query: 275 MGIKD-TRLKP---KQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLN 330
               D +  +P   K+      + + W L + G+   +      +++S ++K   +S   
Sbjct: 298 PSKGDMSNRQPVTFKEILYTLTEFDLWPLFIQGITAFISLQTVGSYLSLILKSLNYSTFL 357

Query: 331 ATLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLE-HKWA 389
           + +L +P  A+ L+ +  A +++   K+  +++ + +  +  L  ++ +  +P + + W 
Sbjct: 358 SNILAIPGQALLLINLPLAALLSRKLKE--KSLCVGIANVWVLPFIVSLVALPTDTNPW- 414

Query: 390 LVGCCWLLYIIGGP----VIMCWILINVTIAGSSKISSV-KIMWFLLYTAGNIIGSKIFY 444
            +    L  I+G P    ++  W+     I+ S +  +V   ++ +    G II S ++ 
Sbjct: 415 -IKYILLTGILGLPYTHSILAGWV---SEISNSVRSRTVGTALYNMSAQVGAIIASNMYR 470

Query: 445 AKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESE 495
             + P Y  G K L+      + +++        RN+ +DRK+  +T E +
Sbjct: 471 NDDKPYYTRGNKILLGFTCFNICMAVATKFYYISRNKYKDRKWNSMTKEEQ 521

>ACL203C [846] [Homologous to ScYIL166C - NSH; ScYOL162W - NSH]
           (4853..6466) [1614 bp, 537 aa]
          Length = 537

 Score =  106 bits (265), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 115/500 (23%), Positives = 209/500 (41%), Gaps = 44/500 (8%)

Query: 46  LDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDY 105
            D EL     E   + R++D  +  + CI +     D+ +    ++  M E+L +  NDY
Sbjct: 55  FDPELKWSKDEEKRLVRRLDFKVAFIACILFCAMEADRFNYFQGTSDEMLEELNVTTNDY 114

Query: 106 GDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFL 165
                + N  +L+G++P   + +++ V +   C ++ W  + +A  G  N   ++ LR  
Sbjct: 115 NLGNQLFNVFHLLGTVPVQLIAKRYGVERVVPCQMIIWGCVAMAQAGMRNKVGLIILRVF 174

Query: 166 LGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTST-SLK 224
           +G+ EA  +   +   + FY  +E   R+  F    G+   V  L +YG+        L 
Sbjct: 175 MGLAEAGFAAIMVTWLTSFYTAKELGMRVSYFWVAQGLMNSVLPLASYGIFRMRGICGLS 234

Query: 225 PWKLIFLVIGLLNFVWAGI--FLYMAPDSPANARFL------THEEKLKVIDRV-----S 271
            W+ +FL  G++  V  GI  F Y  P        L      T  ++L  ++R+     S
Sbjct: 235 GWQWLFLFEGVITCV-MGIFGFFYFVPSIVETKSLLHPKGWFTERQELIAVNRLLRDDPS 293

Query: 272 KNQMGIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNA 331
           K  M  K T +  K   EA  D + W L L+ L           ++  ++K  GFS    
Sbjct: 294 KGDMNNK-TGVSAKLFIEALLDYDLWPLYLLALVHFFPEAAAGPYMLIILKDVGFSTFTV 352

Query: 332 TLLQLPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLA--GLIGIHLIPLEHKW- 388
            LL +       V +    M+ ++   + R++L  + C+  L   G +       E +W 
Sbjct: 353 QLLSISNFFSNTVAILV--MLKIYEVVDERSLLSLVSCVWKLVLLGFLRWWKGAFETRWE 410

Query: 389 ------ALVGCCWLLYIIGGPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKI 442
                  L+ C ++      P++  W   N     +  +S+  +  F     G + G++I
Sbjct: 411 TYALMVVLLACPYIF-----PMMFSWASRNSHSIKTRSVSAAVLQVF--NVIGFVCGNQI 463

Query: 443 FYAKEAPKYITGMKGLIASYAGM--MFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGII 500
           +   +AP Y  G   L         +F+ +  Y M  +RNR R+  +  +T E +R+  I
Sbjct: 464 YRMDDAPLYHRGNTILFFLMLANIPIFIGVKLYYM--WRNRRRELVWNAMT-EQDRQSYI 520

Query: 501 NGFKDYTDFENKY--FRYSY 518
              ++ TD  NK   FR+++
Sbjct: 521 ---ENTTDKGNKRLDFRFAH 537

>KLLA0D07370g complement(630095..631894) similar to
           ca|CA4956|IPF4583 Candida albicans putative allantoate
           permease (by homology), start by similarity
          Length = 599

 Score =  105 bits (263), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 112/501 (22%), Positives = 205/501 (40%), Gaps = 48/501 (9%)

Query: 46  LDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDY 105
            D E     +E   + RK++  +  V C  ++   LD+ +L+ A   ++ EDL +  NDY
Sbjct: 117 FDPEFTWTKEEEQKVVRKLNIRVALVACYLFVALQLDRGNLSQAVVDNLLEDLGMNRNDY 176

Query: 106 GDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFL 165
                I    +L+  IP+  + ++     +    + +W+++ +A     N +     R L
Sbjct: 177 NLGNQIFYISFLLAEIPSQLISKRLGPDIFIPIQICSWSVVAMAQAAMHNKTGFFICRCL 236

Query: 166 LGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTST-SLK 224
           +G +E       ++  + F+  +E   R+  F +   +  ++ A+LAYG+        L 
Sbjct: 237 IGALEGGFIADLVLWLTYFFTSKEFSIRLSWFWTSLSLVQILSAILAYGILRMRGIGGLA 296

Query: 225 PWKLIFLVIGLLNFVWAGIFLYMAPDSPANAR--------FLTHEEKLKVIDRVSKNQMG 276
            W+ +FL+ G+L F       Y+   S    +        F   EEK+ V++RV ++   
Sbjct: 297 GWQYLFLLEGILTFFIGLTGFYLMVPSAVQTKNWMHPKGWFTEREEKI-VVNRVLRDDPS 355

Query: 277 IKDTRLKP----KQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNAT 332
             D   +     K  W A  D + W +  IGL   V     + +++  +K  GFS  N  
Sbjct: 356 KGDMHNRQPISFKLIWSAISDYDLWPIYFIGLIAYVPTNVLTTYLTLTLKSVGFSTFNVQ 415

Query: 333 LLQLPTGAIELVCVFTAGMVALFTKKNVRTIL---------LFLLCIPTLAGLIGIHLIP 383
           LL +P   I +  +F  G+     +   R  +          FL  +    G        
Sbjct: 416 LLSIPYQVIHI--IFLLGITWFSERVKQRAYMGIISAVWNAFFLAILRWWKG-------S 466

Query: 384 LEHKWALVGCCWLLYIIGGPVI----MCWILINVTIAGSSKISSVKIMWFLLYTAGNIIG 439
           L   W     C LL  +G P +    + W+  N     +  +SS   ++ +    G I  
Sbjct: 467 LVEAWPTFALCTLL--LGSPYVHAICVSWVSRNSNSIKTRALSSA--LYNMAVQVGAIYS 522

Query: 440 SKIFYAKEAPKYITGMKGL--IASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESERE 497
           ++I+   + P Y TG   L  +A     +FL + +Y   H RN+ ++  + K++ +   E
Sbjct: 523 AQIYRENDKPLYHTGNTVLFSLAVVTTPIFLFVKWY--YHKRNKDKEAIWSKMSEDERIE 580

Query: 498 GIINGFKDYTDFENKYFRYSY 518
            I N     TD  NK   + +
Sbjct: 581 YIHNT----TDTANKRLDFRF 597

>AGL026W [4285] [Homologous to ScYGR260W - NSH]
           complement(664335..665975) [1641 bp, 546 aa]
          Length = 545

 Score =  105 bits (261), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 189/438 (43%), Gaps = 32/438 (7%)

Query: 16  QQSVTSGSSSPDQIPIADKHAVGVELFQELLD--AELDTDDKEY--APIRRKIDRWLLPV 71
             S  S S S   +P+  K     E  +++ D  A L T++ E   +  R ++D  +L +
Sbjct: 44  DDSKASESESEQAVPVKPKSIF--ETREQIPDSLAHLTTEELEKLASKTRLRMDFRILIM 101

Query: 72  LCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFP 131
           LC  Y+   LD+ ++  A    ++EDLKL    Y    +I   GY +  +P+N V+ +  
Sbjct: 102 LCWIYICNQLDRTNIASARLGGLEEDLKLTSLQYQTAVSILFVGYTIFQVPSNIVLNRLG 161

Query: 132 VAKYTGCALVT-WAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQ 190
             +     L+T W  +      A +++S+  LR L+G++E+      +   S +Y K+E 
Sbjct: 162 KPRLFISVLMTLWGGISACCAAAHSFASLAVLRVLIGVVESGFFVCCLYYLSCWYTKKEL 221

Query: 191 PFRMCT-FLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAP 249
            FR    F        +     A   G      L+PW+  FL+ GLL  V       + P
Sbjct: 222 TFRNAILFSGSLLSGALSLLASAIIRGMEGVGGLQPWRWCFLLEGLLTVVTVPFSYIVLP 281

Query: 250 DSPANARFLTHEEKLKVIDRVSKNQMGIKDTR--LKPKQAWE-----AAKDLNSWILALI 302
           D+P+N RFL+  EK  VI ++  +     D    L     +      A +D   W++A  
Sbjct: 282 DNPSNTRFLSQMEKDIVIWKLKMDVGEYDDDEAVLHEHNNYRFALKLAVRDPKVWLIAG- 340

Query: 303 GLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKN--- 359
            + C V + G  NF  S+++   +S     LL  P   I ++C +     +  T++    
Sbjct: 341 TVSCLVASSGVQNFYPSVVETLNYSRTKTLLLTAPPFFIAMICTWCWARHSDITQERFFH 400

Query: 360 --------VRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGC-CWLLYIIGGPVIMCWIL 410
                   + T L+ +L   T      + L+P     + + C  W+ +I+  P +     
Sbjct: 401 MLIPVPVAIMTYLVAMLSTKTAPRYFAMCLMPASIYSSYIICISWISHIVPRPPLK---- 456

Query: 411 INVTIAGSSKISSVKIMW 428
             V++A  + +++V ++W
Sbjct: 457 RAVSLAMMNTVANVMLIW 474

>CAGL0F00209g complement(22109..23731) weakly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1, hypothetical
           start
          Length = 540

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 156/354 (44%), Gaps = 26/354 (7%)

Query: 12  NDAEQQSVTS--GSSSPDQIPIADKHAVGVELFQELLDAELDTDDKEYAPIRRKIDRWLL 69
            D+  Q+V    G    + IP+        E  ++    EL+  DK+    RRK+D  +L
Sbjct: 36  EDSSLQNVDDIKGDFEEEAIPLFVSKDEIPESLKDYTTEELEILDKK---TRRKMDLRIL 92

Query: 70  PVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQK 129
            +LC  Y+  +LD+ ++  A    ++EDL L    Y    +I   GY+   IP N ++ +
Sbjct: 93  IMLCWIYICNYLDRSNIASARLGGLEEDLHLSSQQYQTAISILFVGYITMQIPCNIILNR 152

Query: 130 F-PVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQ 188
               + +    +  W I+        +Y  ++A+R +LG +E+     ++   S +Y K+
Sbjct: 153 LGRPSVFLSVIMTAWGIVSTCTGAVQSYGGLLAIRVILGFVESGFFGCSLYYLSCWYTKK 212

Query: 189 EQPFRMCTFLSMNGVATMVGALLAYG-LGHSTSTS-LKPWKLIFLVIGLLNFVWAGIFLY 246
           E   R     S + ++     L++ G + H   T  L+ W+  F++ G +      +  +
Sbjct: 213 ELGLRNSILYSGSLISGAFSGLISAGIIEHMDGTRGLRAWRWCFIIEGAITVGTVPLAYF 272

Query: 247 MAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLK------PKQAWEAAK----DLNS 296
           + PD+P N++FLT  E+  V+ ++ + ++G  D+  +          W A K    D   
Sbjct: 273 ILPDNPDNSKFLTETERDLVMWKL-RMEVGDSDSDKEMLGESGHNSFWYALKLALTDTKV 331

Query: 297 WILALIGLGC---GVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVF 347
           W+L     GC    V   G +NF  S++K   +  +    L  P   I ++  F
Sbjct: 332 WLLT----GCLTFLVAAAGVTNFFPSVVKTLNYGRIKTLCLTAPPYLIAIITTF 381

>Kwal_33.13267
          Length = 550

 Score = 99.0 bits (245), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 129/543 (23%), Positives = 225/543 (41%), Gaps = 58/543 (10%)

Query: 1   MASKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQEL-----------LDAE 49
           +  K+ Y VN  + E  SV S  S  +  P  D+H    E ++ +            D  
Sbjct: 16  LPEKDLYVVNAGELEISSVESSGSHTN--PFLDEHIA--EYYRNVYDKCQYECRNAFDPG 71

Query: 50  LDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIA 109
               ++E   I RK+D  +    C  +    +D+ +L  A A +M EDLK+  NDY    
Sbjct: 72  FKWTEQEEKKIIRKLDWRVAIPACFMFAALQIDRGNLGQAVADNMLEDLKMTTNDYNAGM 131

Query: 110 AICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIM 169
            I  A +++  +P+  + +K     +    ++ W+++ +A    TN       R LLG++
Sbjct: 132 QIFYACFVIAEVPSQLMSKKIGPDLFIPMQMMGWSVVAMAQSAITNKGGYFVTRALLGLL 191

Query: 170 EASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTST-SLKPWKL 228
           E       ++  S FY  +E   R+  F +   +  +  ALLA+ +        L  W+ 
Sbjct: 192 EGGFIADLVLWLSYFYTSKELTIRLSWFWTSYSLVQICTALLAFAILRMRGIGGLTGWQW 251

Query: 229 IFLVIGLLNFVWAGIFLYMAPDSPANAR--------FLTHEEKLKVIDRV-----SKNQM 275
           + L+ G L  +      Y+   S    R        F   EEKL V++RV     SK  M
Sbjct: 252 LLLLEGALTLLMGASAFYLMVPSAVQTRNWLHPKGWFTEREEKL-VVNRVLRDDPSKGDM 310

Query: 276 GIKDTRLKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQ 335
             +   L  ++ W A  D + W +  IG+   +     + +++  +K  GFS  N  LL 
Sbjct: 311 NNRQA-LSFRKLWAALTDFDLWPIYAIGIIAYIPVNTLTPYLTLNLKHLGFSTFNVQLLT 369

Query: 336 LPTGAIELVCVFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGC-C 394
           +P   + ++ +     +    ++        L+C+   A +     + L   W   G   
Sbjct: 370 IPYNILHIILLLLVTWITERFQERA------LVCLS--APVFSSFFLALIRWWPGSGTKA 421

Query: 395 WLLYII-----GGPVI----MCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYA 445
           W  Y+I     G P I    + W+  N     S  ISS   ++ +    G+I  ++I+ A
Sbjct: 422 WPTYVITTLFLGQPYIHAICVSWVSRNSNSIKSRSISSA--LYNMFVQLGSIAANQIYRA 479

Query: 446 KEAPKYITG-MKGLIASYA--GMMFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGIING 502
            + P Y  G M+    S A   ++ L+ +YY    YRN+ +D  +  ++ E ER   I  
Sbjct: 480 DDKPLYHRGNMQLFFISVALIPILLLTKLYYV---YRNKKKDEIWNTMS-EDERANYILT 535

Query: 503 FKD 505
            +D
Sbjct: 536 SRD 538

>AER444W [2944] [Homologous to ScYIL166C - NSH]
           complement(1487859..1489502) [1644 bp, 547 aa]
          Length = 547

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 117/541 (21%), Positives = 222/541 (41%), Gaps = 33/541 (6%)

Query: 1   MASKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVE----LFQELLDAELDTDDKE 56
           ++S +++    +D+E+Q  T G +  +   +A+ +    E      +   D +L    +E
Sbjct: 17  LSSTKEFNAVWSDSEEQR-TVGDNPFEDPNVAEYYRKVYEDAKYECRHAFDPKLTWTKEE 75

Query: 57  YAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGY 116
              I RK+D  +  V CI      +D  +L+ A A +M +DL +  N Y     + +   
Sbjct: 76  ERRIVRKLDIHVALVACILLGAFQIDSGNLSQAVADNMLDDLNMDTNQYNLGNQLFSIIV 135

Query: 117 LVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPS 176
           L+  IP   + ++  +       +V W+++ ++     NY+     R  +G+ E     +
Sbjct: 136 LLAEIPVQLLSKRIGLDIVIPSQVVCWSVVAMSQTAMKNYTGFFITRMFIGLFEGGFMSN 195

Query: 177 NMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS-TSLKPWKLIFLVIGL 235
             +  S FY  +E   R+  F +    A M+ +L A+G+       +L  W+ +FL+ GL
Sbjct: 196 LTLWLSYFYTSRELAVRVSLFFATMSTAHMMTSLGAFGIFRMRGLCNLAGWQWMFLLEGL 255

Query: 236 LNFVWAGIFLYMAPDSPANAR-------FLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAW 288
           +      I   +   S    +       + +  E L  ++RV ++     D   +   + 
Sbjct: 256 ITLCIGMIGYMLVVPSIVQTKNKLYRKGWFSESEMLIAVNRVLRDDPSKGDMHNRQGLSL 315

Query: 289 EA----AKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELV 344
            A     +D + W + LIGL   +     S ++   ++  GFS LN  L+ LP  A   +
Sbjct: 316 GAFLNTLRDYDLWPVYLIGLIQYITEATVSPYLLLTLRNAGFSRLNVQLMALPNSASYSI 375

Query: 345 CVFTAGMVALFTKKNVRTILLFLLCI--PTLAGLIGIHLIPLEHKWALVGCCWLLYI--I 400
            V      A    +  R ++  + C+    L G++        + W       +L     
Sbjct: 376 GVLVITKFAQIIDE--RALVGLIPCVWKAVLLGMLRWWPGTFVNAWGTYAIMIVLLAAPF 433

Query: 401 GGPVIMCWILINVTIAGSSKISSVKIMWF-LLYTAGNIIGSKIFYAKEAPKYITGMKGLI 459
             P+ + W+  N   A S K  +V    F + Y  G I  ++I+ A +AP Y  G   L 
Sbjct: 434 TNPICVGWVSKN---ANSIKTRTVACATFQMFYRTGIIAATQIYRADDAPLYHRGNSILF 490

Query: 460 ASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFENKY--FRYS 517
                 + + I       +RN++RD+ +  ++ +  R    N     TD  NK   FR++
Sbjct: 491 WIIIANIPVIISTKLYYIWRNKSRDKIWDAMSEDERR----NYIHTTTDLGNKRLNFRFA 546

Query: 518 Y 518
           +
Sbjct: 547 H 547

>Sklu_1875.1 YAL067C, Contig c1875 643-2361 reverse complement
          Length = 572

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 99/403 (24%), Positives = 171/403 (42%), Gaps = 33/403 (8%)

Query: 73  CITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPV 132
           C+ Y +++LD ++LN A    MKE+LK KGND      +   G ++  IP  + + K P+
Sbjct: 131 CMAYWVKYLDTVNLNNAYVSGMKEELKFKGNDLVQTQVMFTVGNIIFQIPFLFFLNKVPL 190

Query: 133 AKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPF 192
                   + W+IL I      +   + A+RF +G  EA    +   +   FY K ++  
Sbjct: 191 NYLLPALDICWSILTIGASQVDSVPHLKAIRFFIGAFEAPAYLAYQYLFGCFY-KHDEMV 249

Query: 193 RMCTFLSMNGVATMVGALLAYGLGHSTSTSLK------PWKLIFLVIGLLNFVWAGIFLY 246
           R   F  +   A   G L A G+  +   SL        W+  F++  +++ V   +  Y
Sbjct: 250 RRSAFYYLGQYA---GILSAGGIQSAVFASLDGVNGLSGWRWNFIIDAIVSIVIGILGFY 306

Query: 247 MAPDSPAN--ARFLTHEEKLKVIDRVSKNQMGIKD--TRLKPKQAWEA-AKDLNSWILAL 301
           M P  P N  + FLT +E      R+ +N     D  +++   + W+    D   +IL L
Sbjct: 307 MLPGDPYNCYSIFLTDDEIRLARKRLKENNTEKSDFASKVFDLEVWKRIVFDWKVYILTL 366

Query: 302 IGLGCGVVNGGTSN----FISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTK 357
             + C   N G+S     ++ SL K +    LN   L + T  + +V +F  G+ A   K
Sbjct: 367 WNIFCWNNNNGSSGAYLLWLKSL-KKYSIPKLNK--LSMITPGLGMVYLFVTGVFA--DK 421

Query: 358 KNVRTILLFLLCIPTLAG--LIGIHLIPLEHKWALVGCCWLLYIIG---GPVIMCWILIN 412
            + R   +    +    G  ++ +  +P   KW      ++L   G    PV+  W    
Sbjct: 422 SHSRWGAIIFTQVFNFMGNVILAVWDVPEGAKW----YAFMLQYFGWAMAPVLYSWQNDI 477

Query: 413 VTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGM 455
                 ++  ++ IM  L  T+   I   ++   EAP+Y+ G 
Sbjct: 478 CRKDAQARAVTLVIMNMLAQTSTAWISVLVWKTPEAPRYLKGF 520

>AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH]
           (137788..139482) [1695 bp, 564 aa]
          Length = 564

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 141/318 (44%), Gaps = 22/318 (6%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIP 122
           K+D  L    C+ Y +++LD ++LN A    MKE+L + GND  +  A+   G ++  +P
Sbjct: 117 KLDVLLAFYSCLAYWVKYLDTVNLNNAYVSGMKEELGMSGNDLVNTQAMFTVGAVIFQLP 176

Query: 123 ANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
             +++ K P+        + W++L +      N   + A+RFL+G+ EA    S   +  
Sbjct: 177 FIFILNKVPLNYVLPALDLGWSVLTLGAAHVNNVGQLKAIRFLIGVFEAPAYLSYQYLFG 236

Query: 183 MFYNKQEQPFRMCTF---------LSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVI 233
            FY K ++  R   F         LS  G+ + V A L           L  W+  F++ 
Sbjct: 237 CFY-KHDEIVRRSAFYYLGQYAGILSSGGIQSAVSATL------DGKNGLSGWRWSFIID 289

Query: 234 GLLNFVWAGIFLYMAPDSPAN--ARFLTHEEKLKVIDRVSKNQMGIKD--TRLKPKQAWE 289
            +++ +   I  YM P  P N  + FLT +E      R+ ++ +   D  +++  KQ W+
Sbjct: 290 AIISIIVGIIGFYMLPGDPNNCYSIFLTDDEIRLARRRLEESNIDKSDFSSKIFDKQLWK 349

Query: 290 A-AKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVCVF 347
               D   +IL++  + C   N G +      +K    FS  N   L + T A+ +V + 
Sbjct: 350 NIMTDWKIYILSIWNIFCWNNNNGPAGAYLLWMKSLERFSTPNLNRLSMITPALGMVYLI 409

Query: 348 TAGMVALFTKKNVRTILL 365
              ++A      +  ILL
Sbjct: 410 LTSLIADLGHSRLAAILL 427

>CAGL0L08052g complement(878996..880450) similar to sp|P25621
           Saccharomyces cerevisiae YCR028c FEN2 high affinity
           H+/pantothenate symporter, start by similarity
          Length = 484

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 106/245 (43%), Gaps = 10/245 (4%)

Query: 49  ELDTDDKEYAPIRR----KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGND 104
           E D + K+    +R    KID ++L  +C+ Y + ++D++    A    MK DLK+ G D
Sbjct: 13  EFDPESKKEPVNKRWVIAKIDLFVLSFVCLQYWINYVDRIGFTNAYVSGMKADLKMVGKD 72

Query: 105 YGDIAAIC-NAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALR 163
              IA  C   GY+VG IP N ++ K P   +       W IL +     T++  +  LR
Sbjct: 73  L-SIANTCFTVGYVVGMIPHNLILLKVPPRIWLSFCTFAWGILTLGMYHVTHFHQVCVLR 131

Query: 164 FLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS--T 221
           F   + E+       ++   +Y ++E P R   F S   V +M    +   + H  +   
Sbjct: 132 FFQALFESCTFSGTHLILGSWYLEKELPIRSAIFTSSGLVGSMFSGFMQSSIFHHLNGRN 191

Query: 222 SLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTR 281
            L  W+ +F++   +    A   L   P  P +    +     KVI   +++++     R
Sbjct: 192 GLAGWRWLFIIDFCITIPIALYGLLFFPGMPESTNDNSRLSMTKVI--FNEHELQYARRR 249

Query: 282 LKPKQ 286
           L P+ 
Sbjct: 250 LPPRD 254

>YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1782 bp, 593 aa]
          Length = 593

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 100/441 (22%), Positives = 187/441 (42%), Gaps = 40/441 (9%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIP 122
           K+D  L    CI Y +++LD +++N A    MKEDL  +GND      +   G ++  +P
Sbjct: 134 KLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQVMYTVGNIIFQLP 193

Query: 123 ANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
               + K P+        + W++L +      +   + A+RF +G  EA    +   +  
Sbjct: 194 FLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAFEAPSYLAYQYLFG 253

Query: 183 MFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTS------LKPWKLIFLVIGLL 236
            FY K ++  R   F  +      +G L A G+  +  +S      L+ W+  F++  ++
Sbjct: 254 SFY-KHDEMVRRSAFYYL---GQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIV 309

Query: 237 NFVWAGIFLYMAPDSPAN--ARFLTHEEKLKVIDRVSKNQMGIKD--TRLKPKQAWEAA- 291
           + V   I  Y  P  P N  + FLT +E      R+ +NQ G  D  T++   + W+   
Sbjct: 310 SVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVFDIKLWKTIF 369

Query: 292 KDLNSWILALIGLGC----GVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVF 347
            D   +IL L  + C     V +G    ++ SL K +    LN   L + T  + +V + 
Sbjct: 370 SDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSL-KRYSIPKLNQ--LSMITPGLGMVYLM 426

Query: 348 TAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALV-GCCWLLYIIG----- 401
             G++A   K + R    F +    +  +IG  ++     W +  G  W  +++      
Sbjct: 427 LTGIIA--DKLHSR---WFAIIFTQVFNIIGNSILA---AWDVAEGAKWFAFMLQCFGWA 478

Query: 402 -GPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIA 460
             PV+  W          ++  ++  M  +  ++   I   ++  +EAP+Y   +KG   
Sbjct: 479 MAPVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRY---LKGFTF 535

Query: 461 SYAGMMFLSIVYYCMMHYRNR 481
           +      LSI  + ++++  R
Sbjct: 536 TACSAFCLSIWTFVVLYFYKR 556

>Kwal_56.24353
          Length = 582

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 94/401 (23%), Positives = 167/401 (41%), Gaps = 31/401 (7%)

Query: 73  CITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPV 132
           C+ Y +++LD  +LN A    +KE+L  KGN   +   +   G +V  +P  + + K P+
Sbjct: 141 CLAYWVKYLDTANLNNAYVSGLKEELNFKGNQLVETQVMYTIGNIVFQLPFIFFLDKVPL 200

Query: 133 AKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPF 192
                   + W+IL I          +  +RF +G+ EA    +   +   FY K ++  
Sbjct: 201 NFVLPALDICWSILTIGAAKVDTVPHLKVIRFFIGVFEAPAYLAYQYLFGSFY-KHDEMV 259

Query: 193 RMCTFLSMNGVATMVGALLAYGLGHST------STSLKPWKLIFLVIGLLNFVWAGIFLY 246
           R   F  +   A   G L A GL  +          L  W+  F++ G+++ V   I  Y
Sbjct: 260 RRSAFYYLGQYA---GILSASGLQSAIYAVLDGKRGLSGWRWNFIIDGVISVVVGIIGFY 316

Query: 247 MAPDSPAN--ARFLTHEEKLKVIDRVSKNQMGIKD--TRLKPKQAWEAAKDLNSW---IL 299
           + P  P N  + FLT +E      R+ +N     D  +++  K+ W   + L +W   +L
Sbjct: 317 VLPGDPYNCYSIFLTDDEIRLARKRLRENNTEKPDFASKVFDKKVW--IRILTNWKIYVL 374

Query: 300 ALIGLGCGVVNGGTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVCVFTAGMVALFTKK 358
            L  + C   N GTS      +K    +S  +   L + T A+ +V +F   + A   K 
Sbjct: 375 TLWNIFCWNNNNGTSGAYLLWLKSLKRYSIPHVNRLGMVTPALGMVYLFLTSLFA--DKL 432

Query: 359 NVRTILLFLLCIPTLAG--LIGIHLIPLEHKWALVGCCWLLYIIG---GPVIMCWILINV 413
           + R   + +  +    G  ++    +P   KW      ++L   G    PV+  W     
Sbjct: 433 HSRWGAIIVTQVFNFIGNVILAAWNVPEGAKW----FAFMLQYFGWAMAPVLYSWQNDIC 488

Query: 414 TIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITG 454
               S++  ++ IM  L  T    +   ++   EAP+++ G
Sbjct: 489 RRDASARAITLVIMNMLAQTTTAFMSVLVWKTTEAPRFLKG 529

>AGR235W [4546] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH]
           complement(1187805..1189493) [1689 bp, 562 aa]
          Length = 562

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 116/530 (21%), Positives = 213/530 (40%), Gaps = 44/530 (8%)

Query: 3   SKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVG----VELFQ-----------ELLD 47
           SK + E        +  T   S  D I   + HA       E ++           +  D
Sbjct: 22  SKREVENEKEPVSTKEATEPCSDLDAIKSHEVHAFSDPAIAEYYRREYDKVQYECRQFFD 81

Query: 48  AELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDY-- 105
             L    +E   + RK+D  ++ ++ I Y    LD  SL  A+A +M  +L +  N Y  
Sbjct: 82  PTLTWTKEEERQVLRKLDIHIVGLIVIVYFACQLDYGSLGQATADNMLNELHMDANQYNL 141

Query: 106 GDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFL 165
           G+  +I  A  L   +P   VI+++   K     ++ W  +++   G  N     A R L
Sbjct: 142 GNQLSIFVA--LAFELPMQLVIRRYGADKAIPYQMLIWGAIVLCQAGMKNCYGFYATRVL 199

Query: 166 LGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYG-LGHSTSTSLK 224
            GI  A +  +  +  + FY   E  FR     + + +  +  AL+AYG L      +L 
Sbjct: 200 SGIAAAGLLTTVTVWLTYFYTSGELAFRTAFLFATSTMDQVFSALIAYGVLRLRGVCNLS 259

Query: 225 PWKLIFLVIGLLNFVWAGIFL--YMAPDSPANAR-------FLTHEEKLKVIDRVSKNQ- 274
            W+ +F+V G++ F  AG+++   M P S A  +       +L+  ++L  ++R+ ++  
Sbjct: 260 GWQWLFIVEGIITFS-AGLYVCFTMVP-SIAQTKGVMYPKGWLSERQQLIAVNRLLRDDP 317

Query: 275 -MGIKDTR--LKPKQAWEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNA 331
             G  + R  +  ++   +  D + W L  I L   +       ++   ++  GFS L  
Sbjct: 318 SKGTMNNRQGITIREFLRSLSDYDFWPLYAISLIVSIPEAAVVPYLPLNLRSLGFSSLKV 377

Query: 332 TLLQLPTGAIELVC--VFTAGMVALFTKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWA 389
            +L +P   I  +   +FT  +  ++ ++ +  I   +    TL G +         KW 
Sbjct: 378 QILIIPAFFIHAISMLIFTK-LSDVWDERALMEIFPLIWKGITL-GCLRWWSGSFVDKWG 435

Query: 390 LVGCCWLLYIIG--GPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKE 447
                  L  +    P+   W   N     +  +++    +F     G I+ ++ +   +
Sbjct: 436 TYALLITLRAVPSYSPIYTGWSSKNANSVRTRAVAAAAGQFF--NKIGYILANQTYRKDD 493

Query: 448 APKYITGMKGLIASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESERE 497
           AP Y  G   L       + L I       +RN+ RD  + K+T E ER+
Sbjct: 494 APAYHRGNLLLFCINLITIPLMIGSKLYFVWRNKRRDELWNKMT-EKERQ 542

>Kwal_33.13713
          Length = 500

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 94/215 (43%), Gaps = 8/215 (3%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIP 122
           KID ++L  +C+ Y + ++D++  + A    MKEDL LKG+ +  I      GY++G IP
Sbjct: 51  KIDLFVLSFVCLQYWINYVDRVGFSNAYVSGMKEDLGLKGDQFNLINTCFTVGYVLGMIP 110

Query: 123 ANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
            N ++       +     + W +L  +    T++    A+RF   + E+       ++  
Sbjct: 111 NNLILLVVQPRIWLSFCTLAWGLLTFSMYKVTSFQQCCAIRFFQAVFESCTFSGTHLILG 170

Query: 183 MFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS--TSLKPWKLIFLVIGLLNF-- 238
            +Y ++E   R   F S   V ++    +   +  S      L  W+ +F+V  L+    
Sbjct: 171 SWYKERELTIRTAIFTSSGLVGSIFSGFMQVAIHKSLDGHRGLAGWRWLFIVDFLITLPV 230

Query: 239 -VWAGIFLYMAPDSPANARF---LTHEEKLKVIDR 269
            V+  IF    PD     R    L  E++L+   R
Sbjct: 231 AVYGFIFFPTTPDHINRKRHGPSLFSEQELQFAKR 265

>YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin
           symporter, member of the allantoate permease family of
           the major facilitator superfamily (MFS) [1782 bp, 593
           aa]
          Length = 593

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 79/317 (24%), Positives = 140/317 (44%), Gaps = 35/317 (11%)

Query: 3   SKEQYEVNVNDAEQQSVTSGSSSPDQIPIADKHAVGVELFQE-------LLDAELDTDDK 55
           ++E+   +V+ + +  VT+ +++ +  P   +H +  E+  E         D      +K
Sbjct: 36  AEEELHHSVDKSSKTDVTAETTAVEPHPHNLRHDLPYEVRDEAGRKWWKYFDEFEYRVNK 95

Query: 56  EYAPIRR-------------KIDRWLLPVLCIT-----YMLQFLDKLSLN-YASAY--SM 94
           EY   R+             K +R LL  L I      +ML +   + LN Y +AY  +M
Sbjct: 96  EYKKSRKWYEFLYPNHTTQTKAERRLLYKLDIIIALYFFMLCWSKSVDLNNYTNAYVSNM 155

Query: 95  KEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGAT 154
           KEDL +KGNDY   + I N G +V  +P  +++ +FP         + W     A   A 
Sbjct: 156 KEDLNMKGNDYVYTSTIANVGAIVFQLPFMYLLPRFPSHIILPVMDLGWTWFTFACYRAN 215

Query: 155 NYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYG 214
           + + + A RF+L    A+  P +  +   +Y   E   R+C F     + ++   LL   
Sbjct: 216 SLAELRAYRFILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSR 275

Query: 215 LGHSTS--TSLKPWKLIFLVIGL-LNFVWAGIFLYMAPDSPAN--ARFLTHEEKLKVIDR 269
           +  S +    L  W+ +FL+  + ++   A I  ++ P  P+   + FLT EE      R
Sbjct: 276 IFKSLNGVHGLAGWRWMFLIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARAR 335

Query: 270 VSKNQM--GIKDTRLKP 284
             +NQ+  G+  ++L P
Sbjct: 336 NKRNQIKDGVDKSKLAP 352

>YCR028C (FEN2) [562] chr3 complement(170881..172419) High affinity
           H[+]/pantothenate symporter, member of the allantoate
           permease family of the major facilitator superfamily
           (MFS) [1539 bp, 512 aa]
          Length = 512

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 115/266 (43%), Gaps = 17/266 (6%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIP 122
           KID ++L  +C+ Y + ++D++    A    MKEDLK+ GND      +   GY+VG +P
Sbjct: 32  KIDLFVLSFVCLQYWINYVDRVGFTNAYISGMKEDLKMVGNDLTVSNTVFMIGYIVGMVP 91

Query: 123 ANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
            N ++   P   +       W +L +     T++  + A+RF   + E+        +  
Sbjct: 92  NNLMLLCVPPRIWLSFCTFAWGLLTLGMYKVTSFKHICAIRFFQALFESCTFSGTHFVLG 151

Query: 183 MFYNKQEQPFRMCTFLSMNGVATMVGALLAYGL-GH-STSTSLKPWKLIFLV---IGLLN 237
            +Y + E P R   F     V +M    +   +  H +    L  W+ +F++   I L  
Sbjct: 152 SWYKEDELPIRSAIFTGSGLVGSMFSGFMQTSIFTHLNGRNGLAGWRWLFIIDFCITLPI 211

Query: 238 FVWAGIFLYMAPDSPAN------ARFLTHEEKLKVIDRVSKNQMGIKD--TRLKPKQAWE 289
            ++  IF    PD  +        R++ +E++L      ++ ++  +D  TRL       
Sbjct: 212 AIYGFIFFPGLPDQTSAVSKFSMTRYIFNEQEL----HYARRRLPARDESTRLDWSTIPR 267

Query: 290 AAKDLNSWILALIGLGCGVVNGGTSN 315
             K  + W+ +L+ +  G   G  SN
Sbjct: 268 VLKRWHWWMFSLVWVLGGENLGFASN 293

>Scas_689.11
          Length = 508

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 98/218 (44%), Gaps = 11/218 (5%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIP 122
           KID ++L  +C+ Y + ++D++  N A    MKEDL +K +D          GY+VG +P
Sbjct: 36  KIDVFVLSFVCLQYWINYVDRVGFNNAYVSGMKEDLNMKKDDLNVTLTCFTVGYVVGMLP 95

Query: 123 ANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
            N ++   P   +      +W +L +     T++    A+RF   + E+       ++  
Sbjct: 96  NNLILLVVPPRLWLSFCTFSWGLLTLGMFKITSFEQACAIRFFQALFESCTFSGTHLILG 155

Query: 183 MFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS--TSLKPWKLIFLV---IGLLN 237
            +Y + E P R   F S   + ++    +   +        +L+ W+ +F++   I +  
Sbjct: 156 SWYKEDELPLRSAIFTSSGLIGSIFSGFMQVAIHTRLDGVGNLEGWRWLFIIDFCITIPI 215

Query: 238 FVWAGIFLYMAPDSPANA------RFLTHEEKLKVIDR 269
            ++  IF    PD  +++      R++  E++L+   R
Sbjct: 216 SIYGLIFFPGVPDHTSSSSKFSMTRYIFTEQELQYARR 253

>KLLA0B07953g 703782..705578 similar to sp|P53241 Saccharomyces
           cerevisiae YGR065c VHT1 plasma membrane H+-biotin
           symporter, start by similarity
          Length = 598

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 95/205 (46%), Gaps = 9/205 (4%)

Query: 87  NYASAY--SMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWA 144
           NY SAY   M+EDL +KGNDY + + I N G +V  +P  +V+ +FP         + W 
Sbjct: 143 NYTSAYVSHMREDLNMKGNDYINTSVISNVGAIVFQLPFMYVLPRFPAHIILPIMDMGWT 202

Query: 145 ILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVA 204
               A   A N +S+ A RFLL    A+  P +  +   +Y   E   R+C F     + 
Sbjct: 203 WFTFACFRANNLASLRAYRFLLSAFGAAYYPVSQYVLGSWYAPDEISSRVCLFFFGQLLG 262

Query: 205 TMVGALLAYGLGHSTSTSL--KPWKLIFLVIGL---LNFVWAGIFLYMAPDSPANARFLT 259
            +   LL   +  S +  L    W+ +FL+  +   L   + G F+     S   + FLT
Sbjct: 263 GVTSGLLQARIFKSLNGVLGHAGWRWMFLIDSMAISLPTAFIGFFVIPGIPSKCYSLFLT 322

Query: 260 HEEKLKVIDRVSKNQM--GIKDTRL 282
            EE +    R  +NQ+  G++ ++L
Sbjct: 323 DEEIVIARRRNLRNQIKDGVQKSQL 347

>KLLA0A06193g 566780..568096 similar to sp|P25621 Saccharomyces
           cerevisiae YCR028c FEN2 high affinity H+/pantothenate
           symporter, hypothetical start
          Length = 438

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 87/204 (42%), Gaps = 4/204 (1%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAIC-NAGYLVGSI 121
           ++D  +L  +C+ Y + ++D++    A    MKEDL  K N + +IA  C   GYL+G I
Sbjct: 6   RVDLTVLSFVCLQYWINYVDRIGFTNAYVSGMKEDLGFKSNQF-NIANTCFTVGYLLGMI 64

Query: 122 PANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMC 181
           P N ++ +     +       W IL ++     +      +RF     E+       ++ 
Sbjct: 65  PHNLILLRIKPRIWLSFCTFAWGILTLSMFSIDSVWQCYVIRFFQAWFESCTFSGTHLIL 124

Query: 182 SMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS--TSLKPWKLIFLVIGLLNFV 239
             +Y   + P R   F S   +  M    L   +  S +    L  WK +F++ GL+   
Sbjct: 125 GSWYTPSQLPIRTAIFTSSGLLGAMTSGFLQVAIHDSLNGKAGLPGWKWLFIIDGLITIP 184

Query: 240 WAGIFLYMAPDSPANARFLTHEEK 263
            A   L+  P+  A+AR   H+  
Sbjct: 185 IALYGLFFFPEPDADARESNHKNS 208

>Sklu_2010.5 YCR028C, Contig c2010 7036-8589
          Length = 517

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 89/193 (46%), Gaps = 4/193 (2%)

Query: 63  KIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIP 122
           K+D ++L  +C+ Y + ++D+++   A    MK+DL L GND+  I      GY++G +P
Sbjct: 46  KVDLFVLSFVCLQYWINYVDRVAFANAYVSGMKQDLGLHGNDFNLINTCFTVGYVIGMVP 105

Query: 123 ANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCS 182
            N ++   P   +     + W +L ++    ++++   A+RF   + E+       ++  
Sbjct: 106 NNLMLLVVPPRIWLSFCTLAWGVLTLSMYRVSSFNQCCAIRFFQALFESCTFSGTHLILG 165

Query: 183 MFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHST---STSLKPWKLIFLVIGLLNFV 239
            +Y + E   R   F S   V ++    +   + HS+      L  W+ +F++  L+   
Sbjct: 166 SWYREDELSVRSAIFTSSGLVGSLFSGFMQVSI-HSSLDGRRGLAGWRWLFIIDFLITLP 224

Query: 240 WAGIFLYMAPDSP 252
            A       PD+P
Sbjct: 225 IAVYGFVCFPDTP 237

>CAGL0K04609g complement(437799..439628) highly similar to sp|P53241
           Saccharomyces cerevisiae YGR065c H+/biotin symporter,
           hypothetical start
          Length = 609

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 112/263 (42%), Gaps = 19/263 (7%)

Query: 61  RRKIDRWLLPVLCITYMLQFL------DKLSLNYASAY--SMKEDLKLKGNDYGDIAAIC 112
           + K +R LL  L I   L FL         S NY +AY   MKEDL  KGNDY   + I 
Sbjct: 129 QSKAERRLLYKLDIIVALYFLIVNWSRSVDSSNYTNAYVSHMKEDLHFKGNDYIYTSTIA 188

Query: 113 NAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEAS 172
           N G +V  +P  +++ +FP           W+    A   A +   + A RF+L    A+
Sbjct: 189 NVGSIVFQLPFIYILPRFPAHYVLPIMDFGWSWFTFACYRAKSLPELRAYRFILSSFGAA 248

Query: 173 ISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTS--TSLKPWKLIF 230
             P    +   +Y   E   R+C F     + ++   LL   +  S +    L  W+ +F
Sbjct: 249 YYPVAQYLMGCWYAPDEISSRVCLFFCGQLLGSVTSGLLQARIFKSLNGVHGLAGWRWMF 308

Query: 231 LVIGLLNFVWAGIF-LYMAPDSPAN--ARFLTHEEKLKVIDRVSKNQM--GIKDTRLKPK 285
           L+  +   +   I   ++ P  P+   + FLT EE      R  +NQ+  G+  ++L   
Sbjct: 309 LIDAIAISIPTAILGFFVIPGIPSKCYSLFLTDEEIRIARARNKRNQIVDGVDRSKLPHI 368

Query: 286 QAWEAAKDL----NSWILALIGL 304
            +W+  K +      W+L +  L
Sbjct: 369 WSWKVWKKVFFTPTFWVLVIFDL 391

>Scas_630.25
          Length = 582

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 98/211 (46%), Gaps = 14/211 (6%)

Query: 73  CITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPV 132
           CI Y +++LD ++LN A    MKE+L  KGND      +   G ++  +P  + + K P+
Sbjct: 140 CIAYWVKYLDTVNLNNAYVSGMKEELNFKGNDLVHTQVMYTVGNIIFQLPFLFYLNKIPL 199

Query: 133 AKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPF 192
                   + W++L I      +   + A+RF +G  EA    +   +   FY K ++  
Sbjct: 200 NYLLPGLDMAWSLLTIGAAYVNSVPHLKAIRFFIGGFEAPSYLAYQYLFGCFY-KHDEMV 258

Query: 193 RMCTFLSMNGVATMVGALLAYGLGHSTSTSLK------PWKLIFLVIGLLNFVWAGIF-L 245
           R   F  +      VG L + G+  +  ++L        W+  F++  +++ V+ GI   
Sbjct: 259 RRSAFYYL---GQYVGILSSGGIQSAVYSNLDGRNGLSGWRWSFIIDAIIS-VFVGILGF 314

Query: 246 YMAPDSPAN--ARFLTHEEKLKVIDRVSKNQ 274
           Y+ P  P N  + FLT +E      R+SKNQ
Sbjct: 315 YVLPGDPDNCYSIFLTDDEIRLARKRISKNQ 345

>KLLA0D12716g complement(1084062..1085849) similar to sp|P39709
           Saccharomyces cerevisiae YAL067c SEO1 suppressor of
           sulfoxyde ethionine resistance, start by similarity
          Length = 595

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 92/432 (21%), Positives = 176/432 (40%), Gaps = 30/432 (6%)

Query: 74  ITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVA 133
           I Y +++LD ++LN A    MKE++  KGND  +   +   G ++  IP  +++ K P+ 
Sbjct: 144 IAYWVKYLDTVNLNNAYVSGMKEEIGFKGNDLVNTQVMYTVGNIIFQIPFIFILNKVPLN 203

Query: 134 KYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFR 193
                  + W++L +          + A+RF +G  EA    +   +   FY K ++  R
Sbjct: 204 YVLPGLDICWSLLTLGAAYVDTVPHLKAIRFFIGAFEAPSYLAYQYLFGCFY-KHDEMVR 262

Query: 194 MCTFLSMNGVATMVGALLAYGLGHSTSTSLK---PWKLIFLVIGLLNFVWAGIFLYMAPD 250
              F      A ++ +       H+T   L     W+  F++  +++     +  YM P 
Sbjct: 263 RSAFYYFGQYAGVLSSGGIISAVHATMNGLHGKSGWRWNFIIDAVISVAVGLLGFYMLPG 322

Query: 251 SPAN--ARFLTHEEKLKVIDRVSKNQMGIKD--TRLKPKQAWEAAK-DLNSWILALIGLG 305
            P N  + FLT +E      R+ +N     D   +   K+ W+    D   ++L L  + 
Sbjct: 323 DPYNCYSIFLTDDEIRLARKRLRENNTEKSDFHNKFFDKEVWKRIIFDWKIYVLTLWNIF 382

Query: 306 CGVVNGGTSN----FISSLIKGFGFSGLN---ATLLQLPTGAIELVCVFTAGMVALFTKK 358
           C   N G+S     +++SL    G + L+        + T  + +V +F   ++A   K 
Sbjct: 383 CWNNNNGSSGAFLLWLNSLKNSDGSTRLSIEKKNQFSMITPGLGMVYLFLTSLLA--DKG 440

Query: 359 NVRTILLFLLCIPTLAG--LIGIHLIPLEHKWALVGCCWLLYIIG---GPVIMCWILINV 413
           + R   + +  +    G  ++    +P   KW      ++L   G    PV+  W     
Sbjct: 441 HTRWGAIIVTQVFNFIGNVILAAWNVPEGAKW----FAFMLQYFGWAMAPVLYSWQNDIC 496

Query: 414 TIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYY 473
                ++   + +M  L  T+   I   ++   EAP+Y   +KG   +      LS   +
Sbjct: 497 RRDAQARAVILVVMNMLAQTSTAWISVLVWKTVEAPRY---LKGFTWTAVAAFCLSAWTF 553

Query: 474 CMMHYRNRTRDR 485
            ++++  R   R
Sbjct: 554 VVLYFYKRDERR 565

>Kwal_26.9264
          Length = 614

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 98/430 (22%), Positives = 175/430 (40%), Gaps = 48/430 (11%)

Query: 87  NYASAY--SMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWA 144
           NY++AY   M++DLK+  NDY +  AI N G +V  +P  + + +FP         + W+
Sbjct: 163 NYSNAYFAGMEKDLKMTKNDYINTTAISNVGAIVLQLPFMYFLPRFPAHYILPFMDLGWS 222

Query: 145 ILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLS---MN 201
           +  +A   A +   + A RF +    ++  P +  +   +Y   E   R+C F     + 
Sbjct: 223 MFTLACYRAQSLPELRAYRFFVSAFGSAYYPVSQYVLGSWYAPDEISSRVCLFFCGQLLG 282

Query: 202 GVATMVGALLAYGLGHSTSTS-LKPWKLIFLVIGL-LNFVWAGIFLYMAPDSPAN--ARF 257
           G+ +  G L A    H      L  W+ +FL+  + ++   A I  ++ P  P+   + F
Sbjct: 283 GITS--GLLQASTFKHLNGVRGLAGWRWMFLIDAVAISIPCAVIGFFVIPGVPSKCYSLF 340

Query: 258 LTHEEKLKVIDRVSKNQMGIKDTRLK-----PKQAWEAA-KDLNSWILALIGLGCGVVN- 310
           LT EE      R  +NQ+  K  + K       + W+    +   W+L +    C   N 
Sbjct: 341 LTDEEIRVARARNKRNQIHDKVDKEKLLSLFSLKIWKKVFFNPVFWVLVVFD-TCSWNNM 399

Query: 311 -GGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVA-LFTKKNVRTILLFLL 368
              + +F+  L     FS +    L +    +  V VF     A LF  K V  ++  ++
Sbjct: 400 TAFSGSFLFWLRNDHKFSVVQIQNLSVLPACLGFVFVFICACGADLFRCKWVFMVMSQIM 459

Query: 369 CIPTLAGLIGIHLIPLEHKWAL-VGCCWLLYII------GGPVIMCWILINVTIAGSSKI 421
              + A L+         KW + VG  W  ++I        P +  W  IN  +    ++
Sbjct: 460 NCISCAILV---------KWDVPVGAKWFAFLITYFSVAASPCL--WSFINDFLRMDPQL 508

Query: 422 SSVKIMWFLLYTAGN----IIGSKIFYAKEAPKYITGMKGLI---ASYAGMMFLSIVYYC 474
            +V   W  +Y+        I +  +   E P++ TG    +   A Y    F+ + +Y 
Sbjct: 509 RAV--TWIAIYSFSQSTYAWIPTLTWKTVEQPRFKTGYTASLIFSAVYGSWTFVVLYFYK 566

Query: 475 MMHYRNRTRD 484
               +N  R+
Sbjct: 567 RCEKKNALRN 576

>AEL143W [2363] [Homologous to ScYCR028C (FEN2) - SH]
           complement(358539..360098) [1560 bp, 519 aa]
          Length = 519

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 105/248 (42%), Gaps = 12/248 (4%)

Query: 48  AELDTDDKEYAP---------IRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDL 98
           AE DT  K++           +  KID ++L  +C+ Y + ++D++S   A    M ++L
Sbjct: 39  AERDTPPKDHQKGEPAVNERILLYKIDLFVLSFVCLQYWINYVDRVSFGNAYVSGMDKEL 98

Query: 99  KLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSS 158
            L GN +  I      GY++G +P N ++   P   +     + W +L +A   AT++  
Sbjct: 99  GLHGNQFNVINTCFTVGYILGMLPNNLLLLVLPPRIWLSVCTLGWGLLTLAMYRATSFEY 158

Query: 159 MMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGL--G 216
             A+RF   + E+       ++   +Y + E   R   F +   + +M   ++   +   
Sbjct: 159 CCAVRFFQAVFESCTFSGTHLILGSWYKENELALRSAVFTASGLIGSMCSGMMQVAIFDA 218

Query: 217 HSTSTSLKPWKLIFLVIGLLNFVWAGIFLYMAPDSPANARFLTHEEKLKVID-RVSKNQM 275
                 +  W+ +F++  L+    A       P +P + R  T        + R ++ ++
Sbjct: 219 MDGRRGISGWRWLFIIDFLVTVPIAIYGFIFFPGTPDHNRADTSALVFSKAELRYARARL 278

Query: 276 GIKDTRLK 283
             +D R +
Sbjct: 279 PARDERAR 286

>AFR578C [3770] [Homologous to ScYGR065C (VHT1) - SH]
           (1474397..1476274) [1878 bp, 625 aa]
          Length = 625

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 93/220 (42%), Gaps = 15/220 (6%)

Query: 81  LDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCAL 140
           LD  +L       M+EDL + GND    + I   G +V  +P  +++ ++P         
Sbjct: 171 LDSNNLTNTYISGMREDLGMHGNDLIYTSTISKIGAIVFQLPFVYLLPRYPSVYILPLMD 230

Query: 141 VTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSM 200
           + W+   I    A     + A RFL+    A+  P +  +  ++Y   E   R+C F   
Sbjct: 231 LGWSFFTIMCAFARTVPELQAYRFLISAFGAAYYPVSQYVLGLWYAPDELSSRVCLFFCG 290

Query: 201 NGVATMVGALLAYGLGHSTSTSL--KPWKLIFLVIGL---LNFVWAGIFLYMAPDSPANA 255
             +  +   +L   +  S + ++    W+ +FL+ GL   +  V  G F+     S   +
Sbjct: 291 QLLGGVTSGVLQARIYKSLNNAMGFAGWRWMFLIDGLAISIPTVILGFFVLPGIPSKCYS 350

Query: 256 RFLTHEE---------KLKVIDRVSKNQ-MGIKDTRLKPK 285
            FLT EE         +  ++D VS NQ + ++  RL  K
Sbjct: 351 LFLTDEEIRIARQRNRQNHIVDNVSANQLLSLRSWRLWKK 390

>CAGL0K04565g complement(431909..433771) similar to sp|P53241
           Saccharomyces cerevisiae YGR065c Vitamin H transporter,
           hypothetical start
          Length = 620

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 78/185 (42%), Gaps = 7/185 (3%)

Query: 85  SLNYASAY--SMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVT 142
           S NY +AY  +MKEDL + GNDY   + I   G +V  IP  +++ + P         + 
Sbjct: 174 SANYVNAYVSNMKEDLHMGGNDYVYTSTISTIGQIVFQIPFMYLMPRVPPHYLLPFMDLG 233

Query: 143 WAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNG 202
           W+   +A   A     M   RF++G   A+  P +  +   +Y   E   R+  F     
Sbjct: 234 WSAFTLACFRAKTLKEMQGYRFMVGSFGAAYYPVSQYIFGSWYAPDELTSRVLLFSYGQL 293

Query: 203 VATMVGALLAYGLGHSTS--TSLKPWKLIFLVIGL---LNFVWAGIFLYMAPDSPANARF 257
           + ++   LL   +  S      L  W+ +FL+  +   +     G FL     S   + F
Sbjct: 294 LGSVTSGLLQAKIFKSLDGVCGLAGWRWMFLIDAIAISIPTAIMGFFLIPGIPSKCYSLF 353

Query: 258 LTHEE 262
           LT EE
Sbjct: 354 LTDEE 358

>Scas_683.23
          Length = 601

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 81/185 (43%), Gaps = 7/185 (3%)

Query: 85  SLNYASAY--SMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVT 142
           S N+ +AY  +MKEDL ++GNDY    +I N G +V  +P  +++ ++P         + 
Sbjct: 155 SNNFTNAYVSNMKEDLHMEGNDYIHTTSIANVGAIVFQLPFMYLLPRYPAHIILPAMDMG 214

Query: 143 WAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNG 202
           W+    A   A   + +   +F+L    A+  P +  +   +Y   E   R+  F     
Sbjct: 215 WSWFTFACYRAKTLAELRGYQFILNAFGAAYYPVSQYILGCWYAPDEISSRVFLFFCGQL 274

Query: 203 VATMVGALLAYGLGHSTS--TSLKPWKLIFLVIGLLNFVWAGIF-LYMAPDSPAN--ARF 257
           +  +   LL   +  +      L  W+ +FL+  +   +   I   ++ P  P+   + F
Sbjct: 275 LGGVTSGLLQARIFENLDGVNGLAGWRWMFLINAIAISIPTAIMGFFVIPGIPSKCYSLF 334

Query: 258 LTHEE 262
           LT EE
Sbjct: 335 LTDEE 339

>Sklu_2043.2 , Contig c2043 4428-5156 reverse complement
          Length = 242

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 4/130 (3%)

Query: 81  LDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCAL 140
           LD  +++Y     MKEDL++ GN+     +   AG+++G IP   +  K P+  Y     
Sbjct: 96  LDSSAVSYVYVSGMKEDLRMFGNELTYQNSCFMAGFIIGQIPLTMLAMKLPIYWYLPIMD 155

Query: 141 VTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSM 200
               +  +      NY  + ALRF  G+  +   P    +   +  K E   R   +   
Sbjct: 156 SIRELFTLFIYKIDNYHQLCALRFCAGLFGSFFFPKVQFVIGRWCKKTEINLRSAMYF-- 213

Query: 201 NGVATMVGAL 210
             VA+ VG++
Sbjct: 214 --VASQVGSI 221

>Sklu_2244.6 YOL162W, Contig c2244 14189-14881 reverse complement
          Length = 230

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 95/227 (41%), Gaps = 19/227 (8%)

Query: 288 WEAAKDLNSWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVF 347
           WEA  D + W +  IGL   +  G  + +++  +K  GFS  N  LL +P      V   
Sbjct: 2   WEAISDYDLWPVCAIGLIAYIPVGTLTPYLTLTLKQLGFSTFNVQLLTIPYN----VLHI 57

Query: 348 TAGMVALFTKKNVRTILLFLLCIPT----LAGLIGIHLIPLEHKWALVGCCWLLYIIGGP 403
              ++  +  + V    L  L  P     L G I      L   W     C L   +G P
Sbjct: 58  ILLLIITWVTERVGDRSLVSLAAPVYSTILMGFIRCWPGSLVQPWPTYVLCTLF--LGTP 115

Query: 404 VI----MCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITG-MKGL 458
            I    + W+  N     S  +SS   ++ +    G+I  ++I+ A + P Y  G ++  
Sbjct: 116 YIHAICVSWVSRNSNSIKSRAVSSA--LYNMFVQLGSIAANQIYRADDKPFYHRGNVQSF 173

Query: 459 IASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGIINGFKD 505
             S+  ++ L +V      +RN+ R RK+  +T E E+E  I   +D
Sbjct: 174 WISFYLILLLLLVKV-YYVWRNKVRARKWDPMT-EDEKETYILTTQD 218

>Scas_21.1
          Length = 140

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 14/129 (10%)

Query: 399 IIGGPVIMCWILINVTIAGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITG-MKG 457
           + G P I+ +   + + +G SK  +   M    +   NII  +++ AK+ P+YI   +  
Sbjct: 13  VFGVPWILMFSWNSTSCSGYSKKLTRNAMVLFWFGIANIISPQLWQAKDGPRYIPAWIVQ 72

Query: 458 LIASYAGMMFLSIVYYCMMHYRNRTRDRKYGKLTPESEREGIIN----------GFKDYT 507
           ++ S+     L++V + ++  RNR+R      L  +++  G I+             D T
Sbjct: 73  IVLSFFIAPLLALVIWFILSRRNRSR---ISNLDEDTKVIGFIDRGGEKIKANVALLDLT 129

Query: 508 DFENKYFRY 516
           D EN+ F Y
Sbjct: 130 DLENEAFVY 138

>YOL163W (YOL163W) [4662] chr15 (9596..10105) Protein of unknown
           function [510 bp, 169 aa]
          Length = 169

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 71/168 (42%), Gaps = 16/168 (9%)

Query: 140 LVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLS 199
           ++ W+++       T  SS    R L+G+ E       ++  S FY+  E   R+  F  
Sbjct: 1   MIAWSLVATLQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWV 60

Query: 200 MNGVATMVGALLAYGLGHSTST-SLKPWKLIFLVIGLLNFVWAGIFLY--MAPDSPANAR 256
              +  ++ +++A+G+ H      +  W+ +FL+  +   V  GI  Y  M P      +
Sbjct: 61  TLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLV-IGISAYFLMVPSVVQTKK 119

Query: 257 -------FLTHEEKLKVIDRVSKNQ--MGIKDTR--LKPKQAWEAAKD 293
                  F   EEK+ +++++ ++    G  + R  +  K  W+   D
Sbjct: 120 PWSKKGWFTEREEKI-IVNKILRDDPTKGDMNNRQGMSLKMLWQGITD 166

>YOL162W (YOL162W) [4663] chr15 (10118..10765) Protein of unknown
           function [648 bp, 215 aa]
          Length = 215

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 99/211 (46%), Gaps = 15/211 (7%)

Query: 302 IGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKKNVR 361
           +GL   +     + +++ +++  GF+   A LL +P   + ++ +F  G+     K N R
Sbjct: 1   MGLLAYIPTNVLATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLF--GLTWSTEKCNNR 58

Query: 362 ---TILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGS 418
              ++L  L  +P LA ++      + +KW       L  I+  P I   I +++    S
Sbjct: 59  LGLSLLQPLYTVPLLA-VLRFWKGTMFNKWGTYAIITL--ILDNPYIHA-ICVSLCSRNS 114

Query: 419 SKISSVKI---MWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCM 475
             + +  +   ++ +   AG II S I+   +AP Y  G  G++   A  MF  ++   +
Sbjct: 115 QSVKTRTVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKG-NGVLFGLALFMFPILIGSKL 173

Query: 476 MH-YRNRTRDRKYGKLTPESEREGIINGFKD 505
           ++ Y N+ RD+++  ++ E E++  ++   D
Sbjct: 174 IYVYINKQRDKRWNAMS-EEEKDHYLSTTSD 203

>Sklu_2358.2 YIL166C, Contig c2358 1699-2198
          Length = 167

 Score = 35.0 bits (79), Expect = 0.055,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 42/86 (48%)

Query: 45  LLDAELDTDDKEYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGND 104
           + D E    ++E   + RK+D  L    C  ++   +D+ +L+ A A ++ +DL +  ND
Sbjct: 69  VFDPEFTWTEEEGKNLIRKLDWRLALTDCFMFVALQVDRGNLSQAVADNLLDDLNMTTND 128

Query: 105 YGDIAAICNAGYLVGSIPANWVIQKF 130
           Y     I    +LV  +P+  + +K 
Sbjct: 129 YNVGNQIFFVCFLVAEVPSQLISKKL 154

>Scas_530.1
          Length = 1549

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 20/111 (18%)

Query: 308  VVNGGTSNFISSLIKGFGFSGLNATLLQ----LPTGAIELVCVFTAGMVALFTKKNVRTI 363
            V NGG + ++SS+I    F  LNA        LP   +E +C               +  
Sbjct: 1191 VSNGGIAGYLSSVIGYKSFVNLNARTDVYVGFLPNDTLENLC--------------DKYF 1236

Query: 364  LLFLLCIPTLAGLIGIHLIPLEH--KWALVGCCWLLYIIGGPVIMCWILIN 412
            L++L    TL  ++   L+ L+H  +W  +     L+  G P    ++++N
Sbjct: 1237 LIYLRIAETLTSMLSTKLLKLDHALEWIHLTASETLFKQGDPANGIYVVLN 1287

>CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces
           cerevisiae YDR387c, hypothetical start
          Length = 547

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 14/153 (9%)

Query: 112 CNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEA 171
           C  G L+GS  A+   ++  +A +  C L   A L +A   A+N   ++  RF++GI   
Sbjct: 104 CFVGSLLGSPLADKYGRRITLAIF--CVLFIVAALWMAL--ASNLVLLVFGRFVVGIAVG 159

Query: 172 SISPSNMMMCSMFYNKQEQPFRM-CTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIF 230
           + +      C+  Y  +  P ++    L++N +A   G  L+Y   +        W+++F
Sbjct: 160 TAA-----QCTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILF 214

Query: 231 LVIGLLNFVWAGIFLYMAPDSPANARFLTHEEK 263
                L+ V A IFL M    P + R+L    K
Sbjct: 215 ----GLSAVPAIIFLSMLDFIPESPRWLVSMSK 243

>Kwal_14.1625
          Length = 506

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 71/164 (43%), Gaps = 12/164 (7%)

Query: 92  YSMKEDLKLKGNDYGDIAAICNAGYLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHI 151
           +  ++ + L     G   +I   G LVGS+ A  V  ++   +Y+    V   I  +   
Sbjct: 70  HGFQQCIPLSEEQMGLATSIFCIGGLVGSLYAGKVADRYGRKRYSFSNCVIGVIGSLILF 129

Query: 152 GATNYSSMMALRFLLGIMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALL 211
            A +Y+S++  R ++GI   S     +++  +F N+        +  SMN V   +G LL
Sbjct: 130 RANSYASLLIGRLIVGISCGSC----IVVTPLFINEISPKELRGSLGSMNQVCINIGILL 185

Query: 212 AYGLGHSTSTSLKPWKLIFLV---IGLLNFVWAGIFLYMAPDSP 252
              L    + S + W+ + L    + L+ F    + L+   +SP
Sbjct: 186 TQLLALRYADSYR-WRWLMLAGAGLALIQF----LLLFAIEESP 224

>YLR386W (VAC14) [3765] chr12 (893628..896270) Protein involved in
           Fab1p-dependent phosphatidylinositol(3,5) bisphosphate
           synthesis, vacuolar size and acidity, and transport of
           Ppn5p to the multivesicular body, has moderate
           similarity to S. pombe SPBC25H2.03 [2643 bp, 880 aa]
          Length = 880

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 213 YGLGHSTSTSLKPWKLIFL------VIGLLNFVWAGIFLYMAPDSPANARFLTH---EEK 263
           Y +   T   L  W  + L      +I  L     G+F ++  DS  + R +TH   +  
Sbjct: 216 YAINPDTRVFLVDWLKVLLNTPGLELISYLPSFLGGLFTFLG-DSHKDVRTVTHTLMDSL 274

Query: 264 LKVIDRVSKNQMGIKDTRLK 283
           L  +DR+SK Q  IK  RL+
Sbjct: 275 LHEVDRISKLQTEIKMKRLE 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,741,914
Number of extensions: 714158
Number of successful extensions: 2574
Number of sequences better than 10.0: 79
Number of HSP's gapped: 2514
Number of HSP's successfully gapped: 79
Length of query: 518
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 412
Effective length of database: 12,926,601
Effective search space: 5325759612
Effective search space used: 5325759612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)