Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1710.227925912940.0
Kwal_55.215572712597421e-98
KLLA0E21857g2752556787e-89
YOR036W (PEP12)2882496675e-87
ACR092C2742596457e-84
Scas_699.403112606303e-81
CAGL0I01012g2822636041e-77
KLLA0C13233g262871522e-11
Kwal_26.8414260821479e-11
YOL018C (TLG2)397701427e-10
AFL232W301891391e-09
Sklu_2407.11276821362e-09
CAGL0G04807g245871301e-08
Scas_697.44281861292e-08
Scas_607.24172571284e-08
KLLA0A10681g364731267e-08
YOR106W (VAM3)283751222e-07
CAGL0G08932g367721222e-07
Sklu_2256.2377711115e-06
Kwal_34.16287362701115e-06
AEL026C349691062e-05
YLR026C (SED5)3402511011e-04
Scas_721.106377711011e-04
CAGL0D01914g33571973e-04
Sklu_2338.530780973e-04
Kwal_26.753230359947e-04
KLLA0F17798g31760930.001
Scas_720.3231069900.002
AFR210C32962900.002
YMR183C (SSO2)29569880.004
Scas_333.329869830.014
Scas_660.1921978820.015
CAGL0L00561g26489830.016
CAGL0E06160g28274810.025
Kwal_56.2425928869790.041
KLLA0C15961g28669790.046
YDR468C (TLG1)22463780.052
AFL139W29769770.084
CAGL0K06501g22578730.23
CAGL0M13123g66472740.28
CAGL0H06325g27577671.3
Scas_681.4140932671.8
Scas_719.61096213672.0
KLLA0D02618g1328129672.1
YDR223W46789662.3
KLLA0E03443g23163643.4
Sklu_2330.2809119644.3
Scas_585.491845636.4
KLLA0D12320g25061609.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1710.2
         (279 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement         503   0.0  
Kwal_55.21557                                                         290   1e-98
KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces...   265   7e-89
YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...   261   5e-87
ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...   253   7e-84
Scas_699.40                                                           247   3e-81
CAGL0I01012g complement(82834..83682) similar to sp|P32854 Sacch...   237   1e-77
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    63   2e-11
Kwal_26.8414                                                           61   9e-11
YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin ...    59   7e-10
AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH] complement(...    58   1e-09
Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement      57   2e-09
CAGL0G04807g complement(458085..458822) similar to sp|Q12241 Sac...    55   1e-08
Scas_697.44                                                            54   2e-08
Scas_607.2                                                             54   4e-08
KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces c...    53   7e-08
YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog (t...    52   2e-07
CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces c...    52   2e-07
Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement         47   5e-06
Kwal_34.16287                                                          47   5e-06
AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH] (585366..58...    45   2e-05
YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin ...    44   1e-04
Scas_721.106                                                           44   1e-04
CAGL0D01914g 201005..202012 highly similar to sp|Q01590 Saccharo...    42   3e-04
Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement         42   3e-04
Kwal_26.7532                                                           41   7e-04
KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces...    40   0.001
Scas_720.32                                                            39   0.002
AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH] (811271..81...    39   0.002
YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin ...    39   0.004
Scas_333.3                                                             37   0.014
Scas_660.19                                                            36   0.015
CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces cer...    37   0.016
CAGL0E06160g complement(619255..620103) highly similar to sp|P32...    36   0.025
Kwal_56.24259                                                          35   0.041
KLLA0C15961g 1387763..1388623 gi|15824638|gb|AAL09428.1 Kluyvero...    35   0.046
YDR468C (TLG1) [1285] chr4 complement(1398014..1398688) Syntaxin...    35   0.052
AFL139W [3056] [Homologous to ScYMR183C (SSO2) - SH; ScYPL232W (...    34   0.084
CAGL0K06501g complement(639611..640288) similar to tr|Q03322 Sac...    33   0.23 
CAGL0M13123g complement(1288061..1290055) weakly similar to sp|P...    33   0.28 
CAGL0H06325g complement(624076..624903) some similarities with s...    30   1.3  
Scas_681.4                                                             30   1.8  
Scas_719.6                                                             30   2.0  
KLLA0D02618g complement(220267..224253) similar to sgd|S0004417 ...    30   2.1  
YDR223W (YDR223W) [1059] chr4 (912091..913494) Protein of unknow...    30   2.3  
KLLA0E03443g 320167..320862 similar to sgd|S0002876 Saccharomyce...    29   3.4  
Sklu_2330.2 YML076C, Contig c2330 2931-5360                            29   4.3  
Scas_585.4                                                             29   6.4  
KLLA0D12320g complement(1048556..1049308) similar to sgd|S000419...    28   9.2  

>Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement
          Length = 279

 Score =  503 bits (1294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/259 (96%), Positives = 251/259 (96%)

Query: 1   MSFYRDSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTK 60
           MSFYRDSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTK
Sbjct: 1   MSFYRDSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTK 60

Query: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120
           AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF
Sbjct: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120

Query: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDXXXXXXXXKSVVIEREPINNE 180
           QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELED        KSVVIEREPINNE
Sbjct: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDQHQQQQQQKSVVIEREPINNE 180

Query: 181 EFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQS 240
           EFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQS
Sbjct: 181 EFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQS 240

Query: 241 AARELNKAMKSQRRSSKWC 259
           AARELNKAMKSQRRSSKWC
Sbjct: 241 AARELNKAMKSQRRSSKWC 259

>Kwal_55.21557
          Length = 271

 Score =  290 bits (742), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 149/259 (57%), Positives = 186/259 (71%), Gaps = 8/259 (3%)

Query: 1   MSFYRDSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTK 60
           M  + ++  E   F D+P+FE++  +I   LFEMNG LSTLQQF+KTLQ    QG+  +K
Sbjct: 1   MPPFDENLNEAPHFSDNPQFEEWVDKIMNNLFEMNGHLSTLQQFIKTLQKNQSQGNTRSK 60

Query: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120
            + N++KK+V + N I+ L K IN LVHK++ IEET LDR+QLISR+KLTRDVKYSVQ F
Sbjct: 61  MIANLDKKSVYHINAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRDVKYSVQEF 120

Query: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDXXXXXXXXKSVVIEREPINNE 180
           Q  Q EF  T+K++N +AK AL ++E        E  ED        + + IERE INNE
Sbjct: 121 QEAQKEFTSTSKVMNAQAKQALAEDE--------ETREDNVINSKSQEQITIEREAINNE 172

Query: 181 EFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQS 240
           EFAYQQ LI+ERDEEI++IE GI ELN IF DLG IVQQQG+LVDNIE+NIY+V N+TQS
Sbjct: 173 EFAYQQRLIQERDEEIAHIESGIEELNDIFHDLGTIVQQQGYLVDNIESNIYTVANNTQS 232

Query: 241 AARELNKAMKSQRRSSKWC 259
            AREL KAM+SQR SS WC
Sbjct: 233 GARELTKAMRSQRSSSIWC 251

>KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces
           cerevisiae YOR036w PEP12 syntaxin (T-SNARE), vacuolar,
           hypothetical start
          Length = 275

 Score =  265 bits (678), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 181/255 (70%), Gaps = 7/255 (2%)

Query: 6   DSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENI 65
           DS  E  ++ DSPEFE     IS  LFE+NG LST+  FV  L+     G  NTK ++NI
Sbjct: 3   DSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNI 62

Query: 66  NKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQS 125
           NKK V   +  + L  SINE +HKV+ +EE++LD+  LI+REKLTRD K+SVQ F+  Q 
Sbjct: 63  NKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQ 122

Query: 126 EFAKTTKLINNKAKSALVKEEQG---LDEVLREELEDXXXXXXXXKSVVIEREPINNEEF 182
            F + TK IN+ AK AL  EEQ    +D VLREE ED          VVIEREPINNEEF
Sbjct: 123 HFLEVTKRINDMAKVALEDEEQNNSLMDTVLREE-EDEHAKRTQ---VVIEREPINNEEF 178

Query: 183 AYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAA 242
           AYQQ+LIRERD+EISNIE+GI+ELNGIF+DLG +VQQQG LVD+IE N+Y+V ++T++AA
Sbjct: 179 AYQQHLIRERDQEISNIEQGITELNGIFKDLGGLVQQQGQLVDSIEANLYNVEDNTRNAA 238

Query: 243 RELNKAMKSQRRSSK 257
            EL++AM+S R SSK
Sbjct: 239 NELSRAMRSGRSSSK 253

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score =  261 bits (667), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 177/249 (71%), Gaps = 3/249 (1%)

Query: 13  RFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVSY 72
           RF DSPEF+    E++A+LFE+NG +STLQQF  TL++  ++G V+ K VE INK++V+ 
Sbjct: 19  RFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAK 78

Query: 73  TNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQSEFAKTTK 132
              I  L K +N  V K+DAIEE SLD++Q+I+REKL RDV YS Q FQ +Q +F +  K
Sbjct: 79  IEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMK 138

Query: 133 LINNKAKSALVKEEQGLDEVLREELE---DXXXXXXXXKSVVIEREPINNEEFAYQQNLI 189
            +N +AK +L   E   D  L +E +              +VIER+PINNEEFAYQQNLI
Sbjct: 139 QVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLI 198

Query: 190 RERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKAM 249
            +RD+EISNIERGI+ELN +F+DLG++VQQQG LVDNIE NIY+  ++TQ A+ EL KAM
Sbjct: 199 EQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKAM 258

Query: 250 KSQRRSSKW 258
           + Q+R+S+W
Sbjct: 259 RYQKRTSRW 267

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score =  253 bits (645), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 176/259 (67%), Gaps = 4/259 (1%)

Query: 1   MSFYRDSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTK 60
           MS + +  +E  R+ D+P+FE++  +I + LFEMNG L T Q F+K L++ Y  G  NT 
Sbjct: 1   MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTM 60

Query: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120
            VENI+ +++   + +S L K++N LVH ++AI +  LDR+QL +REKL RD++ SVQ F
Sbjct: 61  VVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEF 120

Query: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDXXXXXXXXKSVVIEREPINNE 180
           Q  QSEFA   K IN +AK +L ++++                      +VIEREPINNE
Sbjct: 121 QRCQSEFAGIRKQINEQAKISLSEQQE----EAAGAAALEEEAAQQQHHIVIEREPINNE 176

Query: 181 EFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQS 240
           EFAYQQ LIR+RDEEI+NIERGI ELN +FQDLG+IVQQQ  LVD+IE NIY+   ST  
Sbjct: 177 EFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNH 236

Query: 241 AARELNKAMKSQRRSSKWC 259
           A+ EL++A++ QRRS++WC
Sbjct: 237 ASNELSRALRYQRRSNRWC 255

>Scas_699.40
          Length = 311

 Score =  247 bits (630), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 177/260 (68%), Gaps = 19/260 (7%)

Query: 14  FVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVSYT 73
           F DSPEF+     I A+LFE+NG + TLQQF  +LQN  + G + TK VEN+ K+A +  
Sbjct: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96

Query: 74  NNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQSEFAKTTKL 133
           +N+++L K  N++V ++D+++   LD+ Q+I REKL RDV+YS+  FQ  Q E+ +  K 
Sbjct: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156

Query: 134 INNKAKSALVKEEQGLDEVLREELEDXXXXXXXXK--------------SVVIEREPINN 179
           IN+K KSAL++     D+ ++   +D        +               V I REPINN
Sbjct: 157 INDKNKSALLQ-----DQSVKNYTDDDSNKAALSQEQDRQEQLQQQQQQHVEIIREPINN 211

Query: 180 EEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQ 239
           EEFAYQQNLI+ERD EI+NIE+GI+ELN IF+DLGA+VQQQG +VDNIE N+YSV ++TQ
Sbjct: 212 EEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQ 271

Query: 240 SAARELNKAMKSQRRSSKWC 259
            A++ELN+A +SQ+ S+KWC
Sbjct: 272 MASKELNRARRSQKVSTKWC 291

>CAGL0I01012g complement(82834..83682) similar to sp|P32854
           Saccharomyces cerevisiae YOR036w PEP12 syntaxin, start
           by similarity
          Length = 282

 Score =  237 bits (604), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 181/263 (68%), Gaps = 10/263 (3%)

Query: 6   DSFEENE---RFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGS--VNTK 60
           DS+EE E    F D P FE+   +IS++LFE+NG +STL+QF ++L    +     VN  
Sbjct: 2   DSYEERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNAN 61

Query: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120
            V+NINKKA++    ++ L K++NE V ++D IE++ LD+ Q+I+R+KL RD ++S+Q  
Sbjct: 62  VVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQES 121

Query: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDXXXXXXXXK----SVVIEREP 176
           QT Q +F+K  K IN +A+  L  EEQ    +L+E+ E              + VIEREP
Sbjct: 122 QTAQQQFSKIIKSINAEARGKL-NEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREP 180

Query: 177 INNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRN 236
           INNEEFAYQQ LI+ERDEEI+NIERGI+ELNGIF+DLGA++  QG +VDNIE NIYS   
Sbjct: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240

Query: 237 STQSAARELNKAMKSQRRSSKWC 259
           +T  A++ELNKA + Q+RSS++C
Sbjct: 241 NTAGASQELNKANRMQKRSSRYC 263

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 55/87 (63%), Gaps = 1/87 (1%)

Query: 173 EREPI-NNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNI 231
           ++EP+ N +E  +   +  ER ++IS I   + E+N IF+ LG++VQ+QG  VD I  N+
Sbjct: 155 QQEPLLNQDELDFHTIIQHERSQDISKIHSAVQEVNAIFKQLGSLVQEQGEQVDTIGENV 214

Query: 232 YSVRNSTQSAARELNKAMKSQRRSSKW 258
             + N+ Q A +EL+KA + QR+ ++ 
Sbjct: 215 TGLSNNLQKANKELHKANEYQRKKNRC 241

>Kwal_26.8414
          Length = 260

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%)

Query: 177 INNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRN 236
           ++ +E  +   + +ER EEIS I   + E+N IF  LG +V++QG  VDNI+ NI  +  
Sbjct: 158 VSQDELNFHTLVQQERSEEISRIHSAVQEVNAIFHQLGTLVREQGDDVDNIDNNISGLAG 217

Query: 237 STQSAARELNKAMKSQRRSSKW 258
           + Q A  +L KA +SQR+ ++ 
Sbjct: 218 NLQRANEQLGKADQSQRKKNRC 239

>YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [1194 bp, 397 aa]
          Length = 397

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           +RERDEEI+ + RG+ E++ IF+++  +V  QG +VD I+ N+ +     +SA +ELNKA
Sbjct: 247 LRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKA 306

Query: 249 MKSQRRSSKW 258
              Q+R+ K 
Sbjct: 307 THYQKRTQKC 316

>AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH]
           complement(5332..6237) [906 bp, 301 aa]
          Length = 301

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 58/89 (65%), Gaps = 2/89 (2%)

Query: 170 VVIEREPINNEEFAYQQNLIRE-RDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIE 228
           ++ ++E +  EE  +  +LI+E R +EISNI   + ++N IF+ LG +VQ+QG  VD I+
Sbjct: 192 ILRQQEHVPQEELDFH-SLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQVDTID 250

Query: 229 TNIYSVRNSTQSAARELNKAMKSQRRSSK 257
           +NI  + ++ Q A + L KA + QR+ +K
Sbjct: 251 SNINGLTSNLQGANQHLRKAERYQRQRNK 279

>Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement
          Length = 276

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%)

Query: 177 INNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRN 236
           ++ +E  +   + +ER +EIS I   + E+N IF  LG +VQ+QG  VD I+ NI  + N
Sbjct: 174 LSQDELDFHSIIQQERSQEISRIHSAVQEVNAIFHQLGTLVQEQGEQVDTIDNNISGLGN 233

Query: 237 STQSAARELNKAMKSQRRSSKW 258
           + Q A  +L  A + QR+ ++ 
Sbjct: 234 NLQKANDQLANAERYQRKKNRC 255

>CAGL0G04807g complement(458085..458822) similar to sp|Q12241
           Saccharomyces cerevisiae YOR106w VAM3 syntaxin,
           hypothetical start
          Length = 245

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 52/87 (59%)

Query: 172 IEREPINNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNI 231
           +E+  IN++E  +   +  +R  +IS I   + E+N IF+ LG +V++QG  VD ++ NI
Sbjct: 139 MEQGLINDDELDFHTIVQEDRSRQISRIHSSVQEVNAIFKQLGTLVREQGTQVDTVDENI 198

Query: 232 YSVRNSTQSAARELNKAMKSQRRSSKW 258
            +  N+   A  +LN+A + QR+ ++ 
Sbjct: 199 ANFDNNMHRANEQLNRADEHQRQRNRC 225

>Scas_697.44
          Length = 281

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 172 IEREPINNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNI 231
           I RE    ++  +Q  + +ER ++IS I   + E+N IF  LG++VQ+QG  VD I+ NI
Sbjct: 176 IRRE--TGDDVDFQTIIQQERSQQISRIHTAVKEVNAIFHQLGSLVQEQGEQVDTIDGNI 233

Query: 232 YSVRNSTQSAARELNKAMKSQRRSSK 257
             +  + Q A  +L +A ++QR+ ++
Sbjct: 234 SQLSGNMQKADEQLRRADENQRQRNR 259

>Scas_607.2
          Length = 417

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 120/257 (46%), Gaps = 21/257 (8%)

Query: 17  SPEFEQFSYEISAKLFEMNGLLSTLQQFVK--TLQNKYEQGSVNTKAVENINKKAVSYTN 74
            P F + + +I   L E+  L+  L +  K  +L   +E  S +   +E+++ K +    
Sbjct: 64  PPLFVEIARDIDEYLIEVASLMGKLTKLYKKNSLPG-FEDKSRDESVIEDLSYKVIQNFQ 122

Query: 75  NISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQV----FQTVQSEFAKT 130
               +TK + E +     +E   L++ +LI  + + +     +Q     F+ +Q+ + K 
Sbjct: 123 KCYNITKKL-EKIFNTQMMEGKQLNKGELIILDNILKRYAQKIQGESNRFRVLQNSYLKF 181

Query: 131 TKLINNKAKSALVKEEQGLDEVLREELEDXXXX---------XXXXKSVVIEREPINNEE 181
               + K  SA  K E    ++L  E+ED                 K++  ++E     E
Sbjct: 182 LNKDDLKPISA--KPESDTSQMLLFEMEDNEQSNVEAQQDIDAYSRKTLQRQQELTTTNE 239

Query: 182 FAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSA 241
            +  Q  +++RDEEI+ + +G+ E++ IF+++  ++  QG +VD I+ N+ +     + A
Sbjct: 240 SS--QQFLQQRDEEITQLAKGVLEVSTIFREMQGLIIDQGTVVDRIDYNLQNTTIQLKEA 297

Query: 242 ARELNKAMKSQRRSSKW 258
            +EL +A   Q+R+ K 
Sbjct: 298 NKELGQATVYQKRTQKC 314

>KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 364

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 48/73 (65%)

Query: 186 QNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAAREL 245
           Q  +++RDEEI+ + +G+ E++ IF+++ +++  QG +VD I+ N+ +     + A +EL
Sbjct: 232 QQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTVIELKQAQKEL 291

Query: 246 NKAMKSQRRSSKW 258
           +KA   Q+RS K 
Sbjct: 292 DKATHYQKRSQKC 304

>YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog
           (t-SNARE), required for vacuolar assembly [852 bp, 283
           aa]
          Length = 283

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 46/75 (61%)

Query: 184 YQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAAR 243
           +Q  + +ER ++I  I   + E+N IF  LG++V++QG  V  I+ NI  + ++ Q+A +
Sbjct: 188 FQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANK 247

Query: 244 ELNKAMKSQRRSSKW 258
           +L +A + QR  +K 
Sbjct: 248 QLTRADQHQRDRNKC 262

>CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 367

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 46/72 (63%)

Query: 187 NLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELN 246
           N +  RDEEI+ + +G+ E++ IF+++ +++  QG ++D I+ N+ +     +SA  ELN
Sbjct: 236 NYLHVRDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRIDYNLENTVIELKSAQNELN 295

Query: 247 KAMKSQRRSSKW 258
           KA   Q+R+ K 
Sbjct: 296 KATTYQKRTQKC 307

>Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement
          Length = 377

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 46/71 (64%)

Query: 188 LIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNK 247
            +++R+EEI+ + RG+ E++ IF+++  ++  QG +VD I+ N+ +     + A +EL++
Sbjct: 244 FLQQREEEITELARGVLEVSTIFREMQNLIIDQGTVVDRIDYNLENTVIELKQAQKELDR 303

Query: 248 AMKSQRRSSKW 258
           A   Q+R+ K 
Sbjct: 304 ATHYQKRTQKC 314

>Kwal_34.16287
          Length = 362

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 45/70 (64%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           +++R++EI+ + RG+ E++ IF+++  +V  QG ++D I+ N+ +     + A REL++A
Sbjct: 230 LQQREQEITQLARGVLEVSSIFREMQDLVVDQGTIIDRIDYNLENTVLELKGAQRELDRA 289

Query: 249 MKSQRRSSKW 258
              Q RS K 
Sbjct: 290 TVYQTRSQKC 299

>AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH]
           (585366..586415) [1050 bp, 349 aa]
          Length = 349

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 45/69 (65%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           + +RD EI+ + +G+ +++ IF+++  ++  QG +VD I+ N+ +     + A REL++A
Sbjct: 236 LEDRDAEITQLAKGVLKVSTIFREMQTLILDQGTVVDRIDYNLENTNIDLKQAQRELDQA 295

Query: 249 MKSQRRSSK 257
           +  Q+R+ K
Sbjct: 296 VGYQKRTQK 304

>YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin
           homolog (t-SNARE) required in ER to Golgi transport,
           found on Golgi membrane which receives transport
           vesicles [1023 bp, 340 aa]
          Length = 340

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 115/251 (45%), Gaps = 19/251 (7%)

Query: 14  FVDSP-EFEQFSYEISAKLFEMNGLLSTLQQFVKTL--QNKYEQGSVNTKAVENINKKAV 70
           F D+P E  + S+ I  K++ +   L  L Q  KT    N   Q S    AV++ +K  V
Sbjct: 85  FNDNPVEIAELSFLIKRKIYAIEQSLVQLSQLKKTDVNGNTSNQSSKQPSAVQH-SKNVV 143

Query: 71  SYTNN-ISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQSEFAK 129
           +  N  +  ++ S  +++ +   +E  + DR Q     KLT D  ++    QT  +  A 
Sbjct: 144 NLLNTQMKNISGSFKDVLEERQRLEMANKDRWQ-----KLTTDTGHAPADDQTQSNHAAD 198

Query: 130 TTKLIN-NKAKSALVKEEQGLDEVLREELEDXXXXXXXXKSVVIEREPINNEEFAYQQNL 188
            T   N N   ++L+ E    +     + E         + +++E   ++N  +      
Sbjct: 199 LTTYNNSNPFMTSLLDESSEKNNNSSNQGE-LSFPQNDSQLMLMEEGQLSNNVY------ 251

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ER+  +  IE  I E+  +FQ L ++VQ+QG ++  I+ N+  +  +   A REL K 
Sbjct: 252 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLKY 311

Query: 249 MKSQRRSSKWC 259
              + +S++W 
Sbjct: 312 F-DRIKSNRWL 321

>Scas_721.106
          Length = 377

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ER+  +  IE  I E+  +FQ L ++VQ+QG ++  I+ N+  V  +   A REL K 
Sbjct: 289 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVEDVDLNITGAQRELLKY 348

Query: 249 MKSQRRSSKWC 259
              + +S++W 
Sbjct: 349 F-DRVKSNRWL 358

>CAGL0D01914g 201005..202012 highly similar to sp|Q01590
           Saccharomyces cerevisiae YLR026c SED5, start by
           similarity
          Length = 335

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ER+  +  IE  I E+  +FQ L ++VQ+QG ++  I+ N+  V  +   A REL K 
Sbjct: 247 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDEVDLNITGAQRELLKY 306

Query: 249 MKSQRRSSKWC 259
              + +S++W 
Sbjct: 307 F-DRVKSNRWL 316

>Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement
          Length = 307

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 180 EEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQ 239
           EE A     ++ER+  +  IE  I E+  +FQ L  +VQ+QG  +  I+ N+  +  +  
Sbjct: 210 EEQAANNTYLQERNRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDLNIS 269

Query: 240 SAARELNKAMKSQRRSSKWC 259
            A REL K    +  S++W 
Sbjct: 270 GAQRELIKYF-DRVSSNRWL 288

>Kwal_26.7532
          Length = 303

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNK 247
           ++ER   +  IE  I E+  +FQ L  +VQ+QG ++  I+ N+  +  +   A REL K
Sbjct: 215 LQERSRAVETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVEDIDLNISGAQRELLK 273

>KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces
           cerevisiae YLR026c SED5 syntaxin (T-SNARE) singleton,
           start by similarity
          Length = 317

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 186 QNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAAREL 245
           Q  ++ER   I  IE  I E+  +FQ L  +VQ+QG  +  I+ N+  +  +   A REL
Sbjct: 226 QRYLQERSNAIETIESTIQEVGNLFQQLAHMVQEQGETIQRIDDNVGDIEMNIHGAQREL 285

>Scas_720.32
          Length = 310

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 40/69 (57%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           +++R +E+  +E+ ++ELN +F D+  +V +Q   VD I+ N+   +   +      NKA
Sbjct: 212 VQQRHQELLQLEKSMAELNQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGYTNKA 271

Query: 249 MKSQRRSSK 257
           + S RR+ +
Sbjct: 272 VDSARRARR 280

>AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH]
           (811271..812260) [990 bp, 329 aa]
          Length = 329

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%)

Query: 186 QNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAAREL 245
           Q  ++ER   +  IE  I E+  +FQ L  +VQ+QG  +  I+ N+  +  +   A REL
Sbjct: 238 QQYLQERGRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDINIAGAQREL 297

Query: 246 NK 247
            K
Sbjct: 298 LK 299

>YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin
           homolog (t-SNARE) involved in vesicle transport from
           Golgi to plasma membrane [888 bp, 295 aa]
          Length = 295

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 39/69 (56%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ R +E+  +E+ ++EL  +F D+  +V +Q   VD I+ N+   +   +      NKA
Sbjct: 197 VQARHQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGHTNKA 256

Query: 249 MKSQRRSSK 257
           +KS R++ K
Sbjct: 257 VKSARKARK 265

>Scas_333.3
          Length = 298

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 39/69 (56%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ R +E+  +E+ ++EL  +F D+  +V +Q   +D I+ N+   +   +      NKA
Sbjct: 200 VQARHQELLQLEKSMAELTQLFNDMEQLVIEQQETIDVIDQNVEEAQQDVEQGIGHTNKA 259

Query: 249 MKSQRRSSK 257
           ++S RR+ +
Sbjct: 260 VESARRARR 268

>Scas_660.19
          Length = 219

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 183 AYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAA 242
            +Q  ++RE+D  + NI   +  L+   Q +G  +Q QG L+D ++  + +V N      
Sbjct: 124 PFQDQMLREQDVHLDNIHETMQNLHVQAQTMGQELQDQGQLLDEMDEGMDTVVNKLARGR 183

Query: 243 RELNKAM-KSQRRSSKWC 259
           R+L     K++ R +  C
Sbjct: 184 RQLEWVYEKNKERYNDCC 201

>CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces
           cerevisiae YMR183c SSO2 syntaxin or sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1, hypothetical
           start
          Length = 264

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 171 VIEREPINNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETN 230
           + +R  ++NE+     N +  R +EI N+E+ +++L  +F+++  +V QQ   +D I+TN
Sbjct: 147 IFKRYLLSNEDAKMALNEVEHRMKEIKNLEKRMNDLAILFKEMEELVVQQEEPIDKIDTN 206

Query: 231 IYSVRNSTQSAARELNKAMK--SQRRSSK 257
           +  V    +S      +A+    Q+R +K
Sbjct: 207 VEKVVVDLESGITHTEQAIHIAEQKRKNK 235

>CAGL0E06160g complement(619255..620103) highly similar to sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1 or sp|P39926
           Saccharomyces cerevisiae YMR183c SSO2, start by
           similarity
          Length = 282

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ R +E+  +E+ ++EL  +F D+  +V +Q   ++ I+ ++   +   +      NKA
Sbjct: 185 VQARHQELMQLEKTMAELAQLFNDMEEMVVEQQENIEVIDKHVEEAQQDVEQGVGHTNKA 244

Query: 249 MKS---QRRSSKWC 259
           +KS    RR   WC
Sbjct: 245 VKSARAARRKKLWC 258

>Kwal_56.24259
          Length = 288

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 39/69 (56%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ R +E+  +E+ ++EL  +F D+  +V +Q   ++ I+ N+   +   +      NKA
Sbjct: 192 VQARHQELLKLEKTMAELTQLFNDMEQLVIEQQENIEVIDKNVEEAQQDVEQGVGHTNKA 251

Query: 249 MKSQRRSSK 257
           +KS RR+ +
Sbjct: 252 VKSARRARR 260

>KLLA0C15961g 1387763..1388623 gi|15824638|gb|AAL09428.1
           Kluyveromyces lactis SSO1, start by similarity
          Length = 286

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 40/69 (57%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           +++R +E+  +E+ ++EL  +F D+  +V +Q   ++ I+  + + +   +      NKA
Sbjct: 190 VQQRHQELLKLEKTMAELTQLFNDMEQLVIEQQENIEVIDKQVENAQQDVEQGVGHTNKA 249

Query: 249 MKSQRRSSK 257
           +KS RR+ K
Sbjct: 250 VKSARRARK 258

>YDR468C (TLG1) [1285] chr4 complement(1398014..1398688) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [675 bp, 224 aa]
          Length = 224

 Score = 34.7 bits (78), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%)

Query: 183 AYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAA 242
            +Q+ ++RE+D  +  I + +  L+   Q +G  ++ QG L+DN++  +  V N      
Sbjct: 129 PFQEQMLREQDVHLDGIHKTMQNLHIQAQTMGDELENQGQLLDNMDEGMDGVVNKLARGR 188

Query: 243 REL 245
           R+L
Sbjct: 189 RQL 191

>AFL139W [3056] [Homologous to ScYMR183C (SSO2) - SH; ScYPL232W
           (SSO1) - SH] complement(169508..170401) [894 bp, 297 aa]
          Length = 297

 Score = 34.3 bits (77), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%)

Query: 189 IRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKA 248
           ++ R +E+  +E+ ++EL  +F D+  +V +Q   V+ I+  +   +   +      NKA
Sbjct: 201 VQARHQELLKLEKTMAELTQLFNDMEHLVIEQQEQVEFIDKQVEEAQQDVEQGVGHTNKA 260

Query: 249 MKSQRRSSK 257
           +KS RR+ K
Sbjct: 261 VKSARRARK 269

>CAGL0K06501g complement(639611..640288) similar to tr|Q03322
           Saccharomyces cerevisiae YDR468c t-SNARE activity,
           hypothetical start
          Length = 225

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 183 AYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAA 242
            +Q+ ++RE+D ++ +I + +  L+   + +G  ++ QG L+D+++  + +V        
Sbjct: 130 PFQEQMLREQDTQLDDIHQTMKNLHLQAETMGQELEDQGQLLDDMDQGMDTVAGKLARGR 189

Query: 243 RELNKAM-KSQRRSSKWC 259
           R+L     K++ R +  C
Sbjct: 190 RQLEWVYEKNKERYNDCC 207

>CAGL0M13123g complement(1288061..1290055) weakly similar to
           sp|P39723 Saccharomyces cerevisiae YAL047c SPI6 STU2P
           Interactant, hypothetical start
          Length = 664

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 7/72 (9%)

Query: 62  VENINKKAVSYTNNISALTKSINELV---HKVDAIEETSLDRSQLISREKLTRDVKYSVQ 118
           V+ + KK   YTN++S + +S N+ +   HK    +E +L +S L  R+KL  D++  + 
Sbjct: 401 VDYLEKKCAQYTNHLSHINESPNDTLDNFHK----DEYALLKSDLFRRKKLIHDLEDQLT 456

Query: 119 VFQTVQSEFAKT 130
            +   + E+A++
Sbjct: 457 AYSLKEEEYAES 468

>CAGL0H06325g complement(624076..624903) some similarities with
           sp|P31377 Saccharomyces cerevisiae YAL014c FUN34,
           hypothetical start
          Length = 275

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 178 NNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGA-IVQQQGHLVDNIETNIYSVRN 236
           N+E FA QQ  + E+D  + ++   I   +GI  D+   +  Q  H++D++E  + +   
Sbjct: 177 NDELFARQQQQLLEQDTHLDSLATTIKNTHGISIDINQELTDQNEHILDDMENLLDTSSR 236

Query: 237 STQSAARELNKAMKSQR 253
           + + A R L+   ++ R
Sbjct: 237 NLERARRRLDSFQRTAR 253

>Scas_681.4
          Length = 1409

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 24/32 (75%)

Query: 19   EFEQFSYEISAKLFEMNGLLSTLQQFVKTLQN 50
            EF+ F  E++ KL ++NGLL+ ++  +KTL++
Sbjct: 1076 EFKSFEIEVNNKLEKLNGLLNHIKNQIKTLED 1107

>Scas_719.6
          Length = 1096

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 97/213 (45%), Gaps = 30/213 (14%)

Query: 41  LQQFVKTLQNKYEQGSVNTKAVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDR 100
           L+Q +KT Q K     V  K +E+  +K   YT + +++ K I+E V  V     +  D+
Sbjct: 308 LRQNIKTFQTKI--AEVMAK-IESKKEKIERYTADGASIEKEIDEKVVTV-----SQKDQ 359

Query: 101 SQLISREKLTRDVKYSVQVFQTVQSEFAKTTKLINNKAKSA----------LVKEEQGLD 150
               +R+ L R+V+   +  ++ Q E  +      N+ K+           L KE  G  
Sbjct: 360 EHQATRDSL-REVRKVFETEKSNQREAEQNITQCRNRIKTLDKTIEHLEQDLKKEMGGDK 418

Query: 151 EVLREE---LEDXXXXXXXXKS-VVIEREPINNEEFAYQQNLIRERDEEISNIERGISEL 206
           E +REE   LE          S + I  + + NEE    +++IR+R  E+  IER I + 
Sbjct: 419 EQMREEQISLEHESDQLRKELSDLQISMDEMKNEE----RDIIRQRQTELQGIERSIQQK 474

Query: 207 NGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQ 239
                +L  I Q + +L+ N + N+  + N+ Q
Sbjct: 475 K---LELNKIAQGENNLLSNFDRNMDRLLNAIQ 504

>KLLA0D02618g complement(220267..224253) similar to sgd|S0004417
           Saccharomyces cerevisiae YLR425w TUS1, hypothetical
           start
          Length = 1328

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 4   YRDSFEENERFVDSPEFEQFSYEISAKLFEMNG--LLSTLQQFVKTLQNKY--EQGSVNT 59
           Y  SF+      D P F+  +Y+I   L E++   LLS +   +K ++ K+    G +  
Sbjct: 526 YGASFDP-ALLPDDPNFKSMAYDIFIPLIELHKDILLSPILWKLK-IKGKFIDGVGKIYL 583

Query: 60  KAVENINKKAVSYTNNISALTKSINELVHKVDAIEETS----LDRSQLISREKLTRDVKY 115
           K   +  +  V Y  N++ + + IN    K +     S    +D S  I+R KL  DV +
Sbjct: 584 KWANDAKQVYVKYAQNMATVHEIINW--EKENNTRFASWLRQIDESTPITRSKLYHDVIF 641

Query: 116 SVQVFQTVQ 124
               F+++Q
Sbjct: 642 FGGFFKSLQ 650

>YDR223W (YDR223W) [1059] chr4 (912091..913494) Protein of unknown
           function, has low similarity to a region of S.
           cerevisiae Ifh1p, which is involved in regulation of
           ribosomal RNA expression [1404 bp, 467 aa]
          Length = 467

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 18  PEFE-QFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVSYTNNI 76
           PE E    ++ +  L  M+G    ++   + L+ KY       +   N++    S  N+ 
Sbjct: 203 PETESDVDFDEAVILTPMDGTDKGVKN-PRPLEKKYSSSCFEDRTPLNLDDGHFSECNHF 261

Query: 77  SALTKS----INELVHKVDAIEETSLDRS 101
           S L  S    +NE VHK+D +E    DR+
Sbjct: 262 STLDVSSFFHLNEHVHKIDEVELDGPDRT 290

>KLLA0E03443g 320167..320862 similar to sgd|S0002876 Saccharomyces
           cerevisiae YDR468c TLG1 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 231

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 34/63 (53%)

Query: 183 AYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAA 242
           A Q+ L+RE+D ++  I + +  ++     +G  + +QG +++ ++ N+  V N      
Sbjct: 136 AVQEQLLREQDNQLDMIHQTMQNIHLQASTMGQELTEQGMILEEMDGNVDGVMNKLSRGR 195

Query: 243 REL 245
           R+L
Sbjct: 196 RQL 198

>Sklu_2330.2 YML076C, Contig c2330 2931-5360
          Length = 809

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 50/119 (42%), Gaps = 10/119 (8%)

Query: 23  FSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVSYTNNISALTKS 82
           F Y + A L E      T  +F+ +++NK E   +     ++ +K   S TN ++   K 
Sbjct: 529 FFYSVEAYLHEY-----TFSKFIDSIENKSELHDLPAPVSDSFSKCCQSCTNAMNEFLKL 583

Query: 83  INELVHKVDA--IEETSLDRSQLISREKLTRDVKYSVQVFQTVQSEFAKTTKLINNKAK 139
             EL+  +    I         L+ R    R V  +V  F+ +QS  A+   L+   +K
Sbjct: 584 TPELIASLPLYHISRIIYTVGMLLLR---LRYVTMTVAAFRHLQSMTAQALPLVKKISK 639

>Scas_585.4
          Length = 918

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 27  ISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVS 71
           +SAKL E + +L   +Q V   +NK  +GS++   VE + +  VS
Sbjct: 722 VSAKLNEWDDVLIACKQLVNIRRNKSGEGSIDLPIVEKLIELLVS 766

>KLLA0D12320g complement(1048556..1049308) similar to sgd|S0004191
          Saccharomyces cerevisiae YLR201c, hypothetical start
          Length = 250

 Score = 27.7 bits (60), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 27 ISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVEN-INKKAVSYTNNISALTKSINE 85
          +  +L+  N L   L + +K L   Y   SV  K + N +NK    Y  N  A+ +S+NE
Sbjct: 4  VFTRLYHPNNLEHALPKIIKPL--TYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNE 61

Query: 86 L 86
          L
Sbjct: 62 L 62

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.126    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,415,755
Number of extensions: 298351
Number of successful extensions: 1601
Number of sequences better than 10.0: 188
Number of HSP's gapped: 1573
Number of HSP's successfully gapped: 202
Length of query: 279
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 179
Effective length of database: 13,134,309
Effective search space: 2351041311
Effective search space used: 2351041311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)