Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1710.124024012391e-175
Kwal_55.215593512309261e-126
Scas_615.113492408941e-121
ACR091W3282328831e-120
YDR267C3302348831e-120
CAGL0M08646g3372378761e-118
KLLA0E21879g3332368661e-117
Scas_652.163452442032e-18
KLLA0F06754g3442541901e-16
YGL100W (SEH1)3492421857e-16
Kwal_14.16113342501795e-15
CAGL0J10340g3382431786e-15
Kwal_23.53514742471752e-14
YLR208W (SEC13)2972511713e-14
AFL038C3302481724e-14
AEL246C8152251735e-14
Kwal_56.2452612102601692e-13
YCR072C5151381682e-13
Scas_631.174742311663e-13
CAGL0I03454g3032571626e-13
KLLA0C08547g5151381646e-13
Scas_720.955151381646e-13
ACR199C2952491617e-13
Sklu_2173.25151381621e-12
KLLA0E23529g8262271621e-12
CAGL0J03476g5171391612e-12
Scas_674.202972011573e-12
CAGL0I03718g12012231594e-12
Kwal_56.245962942481564e-12
Sklu_2431.127492231568e-12
AER263C5131381541e-11
CAGL0G09845g5002281523e-11
CAGL0J08778g2982471503e-11
AFR199C3341821485e-11
YDL145C (COP1)12012601481e-10
ADR077C12042521471e-10
Kwal_23.63245141381452e-10
Scas_624.1112052041443e-10
KLLA0F04884g12122521434e-10
Scas_721.328222221425e-10
AEL269C4552261415e-10
YPR178W (PRP4)4652421416e-10
KLLA0C16643g3022561397e-10
YBR198C (TAF5)7982221417e-10
Scas_721.115*3182021399e-10
YPL151C (PRP46)4512661391e-09
Kwal_27.120537552221381e-09
Scas_592.4*3182021362e-09
Kwal_23.64297502251355e-09
AGL234W6291641346e-09
CAGL0M05335g8062231337e-09
CAGL0E00561g8361821338e-09
Scas_630.66211651311e-08
KLLA0E04741g4592211301e-08
AGR180W8062501292e-08
KLLA0E12287g3261921282e-08
CAGL0C03608g6432351283e-08
Kwal_55.220674511231274e-08
YCR084C (TUP1)7131641265e-08
KLLA0F10263g6821641266e-08
AGL024W7561431266e-08
KLLA0F11231g4342371256e-08
Sklu_2416.54592051248e-08
YNL006W (LST8)3031221238e-08
CAGL0M04081g4552181249e-08
ACR097W4672421231e-07
ADL184W4492081231e-07
CAGL0E02805g8402021231e-07
YMR116C (ASC1)3192031212e-07
Kwal_47.174658002111222e-07
Scas_629.126711661222e-07
KLLA0A04928g8612051213e-07
YNL317W (PFS2)4652051203e-07
KLLA0D16390g9361351213e-07
KLLA0E07073g4522051194e-07
Kwal_23.62409132731186e-07
YCR057C (PWP2)9232171186e-07
Sklu_2114.211401281178e-07
YFL009W (CDC4)7791381178e-07
CAGL0C01441g10052391178e-07
Scas_673.114342131169e-07
Scas_720.83d9151651161e-06
Scas_679.288152371161e-06
Scas_704.406081291151e-06
Sklu_2160.37602561151e-06
AGL196C9351271151e-06
Scas_585.84602031142e-06
Kwal_27.122393161371122e-06
Scas_465.410022511133e-06
CAGL0C00737g8161301133e-06
Scas_702.168162611133e-06
KLLA0E18986g9901891133e-06
AFL014C5571821123e-06
AER114W6331471123e-06
Scas_680.113471391105e-06
KLLA0B01958g8901871106e-06
CAGL0K00957g7931441098e-06
CAGL0K09284g9112161081e-05
AAR057W9221841081e-05
Scas_713.50983821081e-05
AFL118W8321001081e-05
YLR222C (UTP13)8172391081e-05
YBR175W (SWD3)3151421061e-05
Kwal_56.239209371351081e-05
Scas_558.37252331072e-05
Kwal_23.57696271531062e-05
ADL082C5691291062e-05
Kwal_56.241637291001062e-05
YLR129W (DIP2)943811062e-05
Kwal_27.115858232391062e-05
CAGL0J03344g5431291062e-05
ACR137W4252251052e-05
YGR200C (ELP2)7881341052e-05
Scas_442.2*7951521052e-05
AFL056C9761941052e-05
CAGL0M04279g940811053e-05
Scas_695.153271291033e-05
YPL183C10132491043e-05
CAGL0H03729g3031201034e-05
Scas_605.184242321034e-05
KLLA0D04840g3031201024e-05
YGL137W (SEC27)8891321034e-05
Kwal_26.87764332281034e-05
Sklu_2291.49972301034e-05
Sklu_2442.23031221024e-05
AGR168W8252041035e-05
CAGL0L00781g6731291026e-05
KLLA0D02530g7071411027e-05
YBL008W (HIR1)8401351027e-05
CAGL0L02629g795721027e-05
CAGL0D02090g2771761008e-05
KLLA0F10791g5451971019e-05
CAGL0L02761g4192341001e-04
YIL046W (MET30)6401291001e-04
Kwal_26.8628422232991e-04
Sklu_2420.2441229991e-04
Kwal_23.5035744116991e-04
KLLA0C08976g911285992e-04
Kwal_0.212303122972e-04
Kwal_27.11126996245982e-04
Kwal_56.236851102139973e-04
KLLA0F15598g47879963e-04
CAGL0M02277g427232963e-04
Kwal_33.15136473108963e-04
KLLA0B14410g706171964e-04
KLLA0D07546g64770955e-04
CAGL0M06193g316126945e-04
YOR212W (STE4)423227946e-04
YLR429W (CRN1)65199946e-04
Sklu_1963.2314136936e-04
Kwal_26.757021894927e-04
CAGL0H08932g902240948e-04
YKL213C (DOA1)715199938e-04
Kwal_33.1497181892939e-04
AAL009C303119920.001
CAGL0K03861g513188920.001
Scas_707.22730149920.001
CAGL0J06512g54576920.001
Sklu_2435.13575239920.001
KLLA0F13244g814243920.001
Scas_719.5262895920.001
Kwal_56.23035424200910.001
Scas_693.221145126920.001
KLLA0E21263g429144910.001
Scas_721.7325143900.002
ADR242C521182900.002
CAGL0L04950g80589900.002
Scas_571.460195890.002
AGR207C320149880.002
Scas_720.4575560890.003
Scas_718.6*546142890.003
AER337W445109880.003
Scas_603.5589130870.004
CAGL0L06952g34779870.004
KLLA0F27511g623128870.005
Kwal_47.17827523196860.006
ACL034W55093850.007
YDR128W1148128850.008
ACL116W804170850.008
CAGL0J04818g65494850.009
AAL157C47979840.009
Kwal_26.765574385850.009
Kwal_27.1038553673840.010
Sklu_2438.457352840.011
Kwal_23.596255252840.011
Kwal_34.15818349196830.012
Sklu_2364.4555168840.012
KLLA0E03982g37276830.012
ADR176W46184830.012
Kwal_33.1547578358840.012
Kwal_26.8975445108830.013
Kwal_27.1258650935830.014
YDR364C (CDC40)45587830.015
CAGL0K07095g371149820.016
YER082C (UTP7)554120830.016
Scas_711.1169562830.016
Scas_700.27*433184820.016
YLL011W (SOF1)48981820.016
CAGL0G00704g44048820.018
KLLA0C07425g44486820.020
KLLA0F17237g523196810.022
KLLA0E24508g327149810.023
KLLA0E11297g51283810.027
Kwal_33.15591714274800.031
YMR049C (ERB1)80795800.032
YMR131C (RRB1)511183800.033
Scas_684.7511183800.036
Scas_659.947581800.037
AAR102C591127800.037
CAGL0L09647g42980790.038
KLLA0F22000g793194800.038
KLLA0E07942g390164790.044
AGL190W37076780.047
CAGL0A02772g44187790.047
ACR017W423200780.049
Scas_706.24460159790.049
Scas_542.5327222780.049
ABR101C82789790.050
Kwal_55.2145050387780.053
Kwal_47.1757243440780.053
Scas_705.2571131780.055
YBR234C (ARC40)384137770.074
Scas_712.3439991770.078
YMR146C (TIF34)347115770.079
AER280C51074760.091
Scas_649.1080646770.093
Scas_670.21595164760.095
Sklu_2406.11426234760.097
CAGL0G04345g711217760.098
KLLA0F26653g79191760.10
KLLA0E11143g493179760.11
Scas_692.29456227760.11
CAGL0L03201g57995760.11
Kwal_56.244781296126760.12
Scas_692.2548851750.13
Scas_512.3534147750.13
Scas_701.451276179750.14
KLLA0F19734g1133146750.15
KLLA0C09262g55852750.16
Sklu_675.1308115740.16
KLLA0D06787g436155740.16
YKR036C (CAF4)659265750.16
KLLA0E24354g39285740.17
YPR137W (RRP9)573129740.18
Kwal_55.21144570127740.18
Kwal_47.17567590233740.18
KLLA0B11077g567130740.18
YDR142C (PEX7)37589730.20
Scas_701.22550107740.21
Sklu_2233.280934740.21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1710.1
         (240 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1710.1 YDR267C, Contig c1710 17-739                              481   e-175
Kwal_55.21559                                                         361   e-126
Scas_615.11                                                           348   e-121
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   344   e-120
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   344   e-120
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   342   e-118
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   338   e-117
Scas_652.16                                                            83   2e-18
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    78   1e-16
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    76   7e-16
Kwal_14.1611                                                           74   5e-15
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    73   6e-15
Kwal_23.5351                                                           72   2e-14
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    70   3e-14
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    71   4e-14
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    71   5e-14
Kwal_56.24526                                                          70   2e-13
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    69   2e-13
Scas_631.17                                                            69   3e-13
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    67   6e-13
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    68   6e-13
Scas_720.95                                                            68   6e-13
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    67   7e-13
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            67   1e-12
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    67   1e-12
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    67   2e-12
Scas_674.20                                                            65   3e-12
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    66   4e-12
Kwal_56.24596                                                          65   4e-12
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      65   8e-12
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    64   1e-11
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    63   3e-11
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    62   3e-11
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    62   5e-11
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    62   1e-10
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    61   1e-10
Kwal_23.6324                                                           60   2e-10
Scas_624.11                                                            60   3e-10
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    60   4e-10
Scas_721.32                                                            59   5e-10
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    59   5e-10
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    59   6e-10
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    58   7e-10
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    59   7e-10
Scas_721.115*                                                          58   9e-10
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    58   1e-09
Kwal_27.12053                                                          58   1e-09
Scas_592.4*                                                            57   2e-09
Kwal_23.6429                                                           57   5e-09
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    56   6e-09
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    56   7e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    56   8e-09
Scas_630.6                                                             55   1e-08
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    55   1e-08
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    54   2e-08
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    54   2e-08
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    54   3e-08
Kwal_55.22067                                                          54   4e-08
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    53   5e-08
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    53   6e-08
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    53   6e-08
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    53   6e-08
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           52   8e-08
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    52   8e-08
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    52   9e-08
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    52   1e-07
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    52   1e-07
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    52   1e-07
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    51   2e-07
Kwal_47.17465                                                          52   2e-07
Scas_629.12                                                            52   2e-07
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    51   3e-07
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    51   3e-07
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    51   3e-07
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    50   4e-07
Kwal_23.6240                                                           50   6e-07
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    50   6e-07
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          50   8e-07
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    50   8e-07
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    50   8e-07
Scas_673.11                                                            49   9e-07
Scas_720.83d                                                           49   1e-06
Scas_679.28                                                            49   1e-06
Scas_704.40                                                            49   1e-06
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         49   1e-06
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    49   1e-06
Scas_585.8                                                             49   2e-06
Kwal_27.12239                                                          48   2e-06
Scas_465.4                                                             48   3e-06
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    48   3e-06
Scas_702.16                                                            48   3e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    48   3e-06
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    48   3e-06
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    48   3e-06
Scas_680.11                                                            47   5e-06
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    47   6e-06
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    47   8e-06
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    46   1e-05
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    46   1e-05
Scas_713.50                                                            46   1e-05
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    46   1e-05
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    46   1e-05
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    45   1e-05
Kwal_56.23920                                                          46   1e-05
Scas_558.3                                                             46   2e-05
Kwal_23.5769                                                           45   2e-05
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    45   2e-05
Kwal_56.24163                                                          45   2e-05
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    45   2e-05
Kwal_27.11585                                                          45   2e-05
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    45   2e-05
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    45   2e-05
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    45   2e-05
Scas_442.2*                                                            45   2e-05
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    45   2e-05
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    45   3e-05
Scas_695.15                                                            44   3e-05
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    45   3e-05
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    44   4e-05
Scas_605.18                                                            44   4e-05
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    44   4e-05
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    44   4e-05
Kwal_26.8776                                                           44   4e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         44   4e-05
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            44   4e-05
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    44   5e-05
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    44   6e-05
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    44   7e-05
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    44   7e-05
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    44   7e-05
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    43   8e-05
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    44   9e-05
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    43   1e-04
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    43   1e-04
Kwal_26.8628                                                           43   1e-04
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            43   1e-04
Kwal_23.5035                                                           43   1e-04
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    43   2e-04
Kwal_0.212                                                             42   2e-04
Kwal_27.11126                                                          42   2e-04
Kwal_56.23685                                                          42   3e-04
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    42   3e-04
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    42   3e-04
Kwal_33.15136                                                          42   3e-04
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    42   4e-04
KLLA0D07546g complement(647984..649927) some similarities with s...    41   5e-04
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    41   5e-04
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    41   6e-04
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    41   6e-04
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         40   6e-04
Kwal_26.7570                                                           40   7e-04
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    41   8e-04
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    40   8e-04
Kwal_33.14971                                                          40   9e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    40   0.001
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    40   0.001
Scas_707.22                                                            40   0.001
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    40   0.001
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         40   0.001
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    40   0.001
Scas_719.52                                                            40   0.001
Kwal_56.23035                                                          40   0.001
Scas_693.22                                                            40   0.001
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    40   0.001
Scas_721.7                                                             39   0.002
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    39   0.002
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    39   0.002
Scas_571.4                                                             39   0.002
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    39   0.002
Scas_720.45                                                            39   0.003
Scas_718.6*                                                            39   0.003
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    39   0.003
Scas_603.5                                                             38   0.004
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    38   0.004
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    38   0.005
Kwal_47.17827                                                          38   0.006
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    37   0.007
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    37   0.008
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    37   0.008
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    37   0.009
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    37   0.009
Kwal_26.7655                                                           37   0.009
Kwal_27.10385                                                          37   0.010
Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement         37   0.011
Kwal_23.5962                                                           37   0.011
Kwal_34.15818                                                          37   0.012
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         37   0.012
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    37   0.012
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    37   0.012
Kwal_33.15475                                                          37   0.012
Kwal_26.8975                                                           37   0.013
Kwal_27.12586                                                          37   0.014
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    37   0.015
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    36   0.016
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    37   0.016
Scas_711.11                                                            37   0.016
Scas_700.27*                                                           36   0.016
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    36   0.016
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    36   0.018
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    36   0.020
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    36   0.022
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    36   0.023
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    36   0.027
Kwal_33.15591                                                          35   0.031
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    35   0.032
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    35   0.033
Scas_684.7                                                             35   0.036
Scas_659.9                                                             35   0.037
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    35   0.037
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    35   0.038
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    35   0.038
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    35   0.044
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    35   0.047
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    35   0.047
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    35   0.049
Scas_706.24                                                            35   0.049
Scas_542.5                                                             35   0.049
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    35   0.050
Kwal_55.21450                                                          35   0.053
Kwal_47.17572                                                          35   0.053
Scas_705.2                                                             35   0.055
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    34   0.074
Scas_712.34                                                            34   0.078
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    34   0.079
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    34   0.091
Scas_649.10                                                            34   0.093
Scas_670.21                                                            34   0.095
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      34   0.097
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    34   0.098
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    34   0.10 
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    34   0.11 
Scas_692.29                                                            34   0.11 
CAGL0L03201g complement(366795..368534) some similarities with s...    34   0.11 
Kwal_56.24478                                                          34   0.12 
Scas_692.25                                                            33   0.13 
Scas_512.3                                                             33   0.13 
Scas_701.45                                                            33   0.14 
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    33   0.15 
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    33   0.16 
Sklu_675.1 YMR146C, Contig c675 761-1687                               33   0.16 
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    33   0.16 
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    33   0.16 
KLLA0E24354g complement(2163651..2164829) similar to sgd|S000602...    33   0.17 
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    33   0.18 
Kwal_55.21144                                                          33   0.18 
Kwal_47.17567                                                          33   0.18 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    33   0.18 
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    33   0.20 
Scas_701.22                                                            33   0.21 
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         33   0.21 
Kwal_14.906                                                            33   0.23 
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    32   0.24 
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            33   0.24 
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            33   0.24 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         33   0.24 
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    33   0.25 
Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement       33   0.27 
Scas_658.1                                                             33   0.27 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    32   0.27 
Scas_693.36                                                            32   0.27 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    32   0.30 
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          33   0.30 
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    32   0.31 
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        32   0.32 
Kwal_55.22076                                                          32   0.32 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    32   0.34 
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    32   0.36 
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    32   0.36 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            32   0.42 
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    32   0.42 
Scas_657.13                                                            32   0.42 
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    32   0.42 
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    32   0.44 
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    32   0.47 
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    32   0.47 
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    32   0.47 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    32   0.49 
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    32   0.51 
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    32   0.53 
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    31   0.69 
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    32   0.72 
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    31   0.78 
Sklu_1513.2 YGL190C, Contig c1513 930-2276                             31   0.80 
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    31   0.83 
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    31   0.84 
Scas_700.36                                                            31   0.86 
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         31   0.92 
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    31   0.93 
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    31   0.96 
Kwal_14.1710                                                           31   1.0  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    31   1.0  
Scas_652.7                                                             30   1.2  
KLLA0E15972g 1419922..1420941 weakly similar to sp|P50079 Saccha...    30   1.3  
Kwal_56.22861                                                          30   1.3  
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            30   1.3  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    30   1.3  
Kwal_47.19083                                                          30   1.4  
Sklu_2226.6 YNL035C, Contig c2226 6858-8054 reverse complement         30   1.5  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    30   1.5  
Kwal_56.23895                                                          30   1.5  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    30   1.5  
CAGL0M02563g complement(295156..296529) weakly similar to sp|Q03...    30   1.7  
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    30   1.7  
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    30   1.8  
KLLA0F10615g 978492..979604 similar to sp|P38328 Saccharomyces c...    30   1.8  
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    30   1.9  
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            30   2.0  
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          30   2.0  
ADR331C [2072] [Homologous to ScYHR186C - SH] (1285564..1290252)...    30   2.1  
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    30   2.2  
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    30   2.3  
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    30   2.4  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    30   2.4  
CAGL0M13915g complement(1376303..1377406) similar to sp|Q04867 S...    30   2.4  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    30   2.4  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    30   2.5  
Kwal_26.7738                                                           30   2.5  
Scas_670.22                                                            30   2.6  
Kwal_27.12667                                                          30   2.6  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    30   2.7  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         30   2.8  
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    30   2.8  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    29   2.9  
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    29   2.9  
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    29   3.2  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    29   3.3  
Kwal_47.17093                                                          29   3.5  
Scas_607.8                                                             29   3.5  
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    29   3.5  
Scas_642.1                                                             29   3.9  
Scas_589.13                                                            29   3.9  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    29   4.2  
KLLA0B07535g complement(654189..656828) similar to sp|P34110 Sac...    29   4.3  
YGL190C (CDC55) [1803] chr7 complement(145813..147393) Protein s...    29   4.3  
Scas_469.3                                                             29   4.3  
Scas_655.4                                                             29   4.6  
Kwal_26.8700                                                           28   5.0  
Kwal_26.8953                                                           28   5.2  
YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein a...    28   5.4  
Kwal_14.884                                                            28   5.4  
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    28   5.5  
Scas_617.6                                                             28   5.6  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    28   5.6  
ADL054W [1687] [Homologous to ScYER124C (DSE1) - SH] complement(...    28   5.8  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    28   5.9  
Kwal_56.22345                                                          28   6.1  
Kwal_33.13148                                                          28   6.2  
AFR195W [3387] [Homologous to ScYGL190C (CDC55) - SH] complement...    28   6.3  
Scas_627.9                                                             28   6.3  
Kwal_27.11550                                                          28   6.4  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    28   7.5  
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    28   7.7  
Scas_710.33                                                            28   8.1  
KLLA0F09053g 842591..843949 similar to sp|Q00362 Saccharomyces c...    28   8.3  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          28   9.0  
Kwal_26.8604                                                           28   9.8  
CAGL0J03806g 361174..362436 similar to sp|Q12363 Saccharomyces c...    28   10.0 

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  481 bits (1239), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/240 (100%), Positives = 240/240 (100%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV
Sbjct: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
           LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS
Sbjct: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTG 180
           ESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTG
Sbjct: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTG 180

Query: 181 SDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWKNE 240
           SDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWKNE
Sbjct: 181 SDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWKNE 240

>Kwal_55.21559
          Length = 351

 Score =  361 bits (926), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/230 (73%), Positives = 200/230 (86%)

Query: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           ETELLAI+EGHENEVK+VSWSHSGYYLA+CSRDKSVWIWEADE GEE+EC+SVLQEH+QD
Sbjct: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177

Query: 68  VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC 127
           VKHVVWHS + LLASSSYDDTIR+WK+  DDW+CAAVLNGH+GTVWCSDFEKSESSLRL 
Sbjct: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLA 237

Query: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAI 187
           S SDD+TVR+W Y+E+ E+ E VWA +++LP+ HSRAVYSVSWS  G IAS GSDGLL +
Sbjct: 238 SCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLVV 297

Query: 188 YQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           Y+E ++G+WE++ Q   AHG+YE NVVKW  +D   LL+TGGDDGC NIW
Sbjct: 298 YKEVKKGEWEVVVQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 86/178 (48%), Gaps = 21/178 (11%)

Query: 34  LATCSRDKSVWIWEADEYGEEFECISVLQE--HSQDVKHVVWHSVLSLLASSSYDDTIRI 91
           +AT S D+ + +   +    +F+ +  L +  H + V+ V +    S+LA+ S+D TI I
Sbjct: 46  MATSSSDRKIKL--VNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISI 103

Query: 92  W-----KDFDDDW---QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIED 143
           W      D  DD+   +  A++ GHE  V    +  S S   L S S D +V IW+  E 
Sbjct: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSW--SHSGYYLASCSRDKSVWIWEADEL 161

Query: 144 NEDDEQVWALQSVLPSAHSRAVYSVSW-SPTGLIASTGSDGLLAIYQEKEEGKWEIIA 200
            E+ E +  LQ      H++ V  V W S   L+AS+  D  + +++E  +  WE  A
Sbjct: 162 GEEYECLSVLQE-----HAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD-DWECAA 213

>Scas_615.11
          Length = 349

 Score =  348 bits (894), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 198/240 (82%), Gaps = 6/240 (2%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           + +E +LLAI+EGHENEVK ++WSH G  L++CSRDKSVWIWE D+ GEE+ECISVLQEH
Sbjct: 107 NSLEMDLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEH 166

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES-- 122
           SQDVKHVVWH  L LLASSSYDDTIR+WKD+DDDW+CAAVLNGHEGTVWCSDFEK ++  
Sbjct: 167 SQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGE 226

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSD 182
           S+RLCSGSDD+TVR+W+YI+D+ED +Q W  +++LP  H R +YSVSWS  GLIASTGSD
Sbjct: 227 SIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSD 286

Query: 183 GLLAIYQEKEEG----KWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
           G LA+Y+E   G     WE+IA+ EL HGVYE N+VKW  I+G  +L TGGDDGCVN+W 
Sbjct: 287 GTLAVYKEVSNGDDEHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLWN 346

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 115/255 (45%), Gaps = 35/255 (13%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE-EFECISVLQE-- 63
           M  +L   ++   +++ S+ +SH    LAT S D+ + I         +   + VL +  
Sbjct: 1   MGIKLAKSLKLQNDKLWSLDYSHG--LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTV 58

Query: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDD-----------------DWQCAAVLN 106
           H + ++ V W    +LLA+ S+D T+ IW   DD                 +    A++ 
Sbjct: 59  HKKAIRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIE 118

Query: 107 GHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVY 166
           GHE  V       S     L S S D +V IW+  +D E+ E +  LQ      HS+ V 
Sbjct: 119 GHENEV--KGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQE-----HSQDVK 171

Query: 167 SVSWSP-TGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHG-VYETNVVKWTQIDGETL 224
            V W P   L+AS+  D  + ++++ ++  WE  A      G V+ ++  K    +GE++
Sbjct: 172 HVVWHPELPLLASSSYDDTIRLWKDYDD-DWECAAVLNGHEGTVWCSDFEKGK--NGESI 228

Query: 225 -LVTGGDDGCVNIWK 238
            L +G DD  V +W+
Sbjct: 229 RLCSGSDDSTVRVWR 243

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  344 bits (883), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/232 (70%), Positives = 198/232 (85%), Gaps = 1/232 (0%)

Query: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           ETELLA++EGHENEVKSV+WSH G YLATCSRDKSVWIWEADE  EEFEC SVLQEHSQD
Sbjct: 93  ETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQD 152

Query: 68  VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC 127
           VKH+VWH+   LLASSSYDDT+RIW + DDDW+CAAVL+GH GTVWCSDFE++E+ +RLC
Sbjct: 153 VKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLC 212

Query: 128 SGSDDTTVRIWKYIEDNED-DEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186
           SGSDDTTVRIW+ + D+ D  ++ W  ++VLP+ H+RAVYSVSWS  GLIAS GSDG+LA
Sbjct: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLA 272

Query: 187 IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
           +Y+E + G+WE++A+ + AH VYE NVVKW  +DG  LLVTGGDDGCVN+W+
Sbjct: 273 VYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNVWE 324

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  344 bits (883), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 159/234 (67%), Positives = 195/234 (83%), Gaps = 1/234 (0%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
            E +LLAI+EGHENEVK V+WS+ GYYLATCSRDKSVWIWE DE GEE+ECISVLQEHSQ
Sbjct: 95  FEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQ 154

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
           DVKHV+WH   +LLASSSYDDT+RIWKD+DDDW+C AVLNGHEGTVW SDF+K+E   RL
Sbjct: 155 DVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRL 214

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186
           CSGSDD+TVR+WKY+ D+EDD+Q W  +++LP  H R VY+V+W   GLIAS G+DG+LA
Sbjct: 215 CSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLA 274

Query: 187 IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWKNE 240
           +Y+E  +G+W++ A+  L HGVYE NVVKW +++G+T+L TGGDDG VN W  E
Sbjct: 275 VYEEV-DGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDGIVNFWSLE 327

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 105/225 (46%), Gaps = 28/225 (12%)

Query: 26  SWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE--HSQDVKHVVWHSVLSLLASS 83
           S+  S   LAT S D+ + +       ++F  I VL E  H + ++ V W    SLLA+ 
Sbjct: 19  SFDFSQGILATGSTDRKIKLVSVKY--DDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG 76

Query: 84  SYDDTIRIW-----KDFDDDWQCAAVLNGHE----GTVWCSDFEKSESSLRLCSGSDDTT 134
           S+D T+ IW      D   +    A++ GHE    G  W +D         L + S D +
Sbjct: 77  SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND------GYYLATCSRDKS 130

Query: 135 VRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT-GLIASTGSDGLLAIYQEKEE 193
           V IW+  E  E+ E +  LQ      HS+ V  V W P+  L+AS+  D  + I+++ ++
Sbjct: 131 VWIWETDESGEEYECISVLQE-----HSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDD 185

Query: 194 GKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
             WE +A      G   ++   + + +G   L +G DD  V +WK
Sbjct: 186 -DWECVAVLNGHEGTVWSS--DFDKTEGVFRLCSGSDDSTVRVWK 227

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 71/147 (48%), Gaps = 10/147 (6%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSG--YYLATCSRDKSVWIWEA----DEYGEE 54
           +W + + + E +A++ GHE  V S  +  +   + L + S D +V +W+     ++  +E
Sbjct: 179 IWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQE 238

Query: 55  FECISVLQE-HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW 113
           + C ++L + H + V +V W     L+AS   D  + ++++ D +W+  A      G   
Sbjct: 239 WVCEAILPDVHKRQVYNVAW-GFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYE 297

Query: 114 CSDFEKSESSLR--LCSGSDDTTVRIW 138
            +  +  E + +  L +G DD  V  W
Sbjct: 298 INVVKWLELNGKTILATGGDDGIVNFW 324

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  342 bits (876), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/237 (67%), Positives = 194/237 (81%), Gaps = 4/237 (1%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           +++E ELLAI+EGHENEVK +SWS  G  LATCSRDKSVWIWE DE GEE+ECISVLQEH
Sbjct: 97  AKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEH 156

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSL 124
           SQDVKHVVWH+  +LLASSSYDDT+RIWKD+DDDW+CAAVL GHEGT+WCSDF K E  +
Sbjct: 157 SQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPI 216

Query: 125 RLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGL 184
           RLCSGSDD+TVR+WKYI D+EDD+Q W  +S LP+AH   +Y V+WSP+G IAS G+DG+
Sbjct: 217 RLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGV 276

Query: 185 LAIYQEK----EEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           LA+Y+EK    E  +WEI A ++ AH VYE N VKW  IDG+ +L+T GDDG VN+W
Sbjct: 277 LAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLW 333

 Score = 58.2 bits (139), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 110/243 (45%), Gaps = 23/243 (9%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE--H 64
           M  +L   ++ H ++V S+ +      LAT S D+++ + +     E    + VL +  H
Sbjct: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENL--LDVLDDTVH 58

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDD--------WQCAAVLNGHEGTVWCSD 116
            + V+ V W     LLA+ S+D TI IW   D D         +  A++ GHE  V    
Sbjct: 59  KKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV--KG 116

Query: 117 FEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW-SPTGL 175
              S+    L + S D +V IW+  E  E+ E +  LQ      HS+ V  V W +   L
Sbjct: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQE-----HSQDVKHVVWHTKHNL 171

Query: 176 IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVN 235
           +AS+  D  + I+++ ++  WE  A      G    +   +++ +    L +G DD  V 
Sbjct: 172 LASSSYDDTVRIWKDYDD-DWECAAVLTGHEGTIWCS--DFSKEEDPIRLCSGSDDSTVR 228

Query: 236 IWK 238
           +WK
Sbjct: 229 VWK 231

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  338 bits (866), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/236 (71%), Positives = 194/236 (82%), Gaps = 3/236 (1%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           +++ETELLAI+EGHENE+K V+WSH G  LATCSRDKSVWIWEADE GEEFECISVLQEH
Sbjct: 95  NDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEH 154

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSL 124
           SQDVKHV+WH  L LLASSSYDDT+RIWKD DDDW+C AVLNGHEGTVW SDFEKS S++
Sbjct: 155 SQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNV 214

Query: 125 RLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGL 184
           RLCSGSDD TVRIW   +DN + EQ W  +S+LP AH+RAVYSV+WSP G IASTGSDG 
Sbjct: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGR 274

Query: 185 LAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE--TLLVTGGDDGCVNIWK 238
           L IY+E E+G W +   HEL HGVYETN+VKW +   +   LL+T GDDG VN+WK
Sbjct: 275 LVIYKESEDG-WIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVWK 329

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 79/157 (50%), Gaps = 18/157 (11%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSW--SHSGYYLATCSRDKSVWIW----EADEYGEE 54
           +W + + + E  A++ GHE  V S  +  S+S   L + S D +V IW    +  EY +E
Sbjct: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240

Query: 55  FECISVLQE-HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGT-- 111
           +   S+L + H++ V  V W S    +AS+  D  + I+K+ +D W    +   HE T  
Sbjct: 241 WIQESILPKAHTRAVYSVNW-SPKGYIASTGSDGRLVIYKESEDGWIVECI---HELTHG 296

Query: 112 VWCSDFEK-----SESSLRLCSGSDDTTVRIWKYIED 143
           V+ ++  K     S+  + L +  DD  V +WK+ E+
Sbjct: 297 VYETNMVKWVEYGSKDVILLITAGDDGHVNVWKFDEN 333

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 25/124 (20%)

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGL 184
           + +GS D  +++        D      ++ +  +AH + V SV+W P   I + GS D  
Sbjct: 28  MATGSTDRKIKL-------VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDST 80

Query: 185 LAIYQEKEEGK----------WEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCV 234
           ++I+ + ++G             II  HE      E   V W+  DGE LL T   D  V
Sbjct: 81  VSIWGKDDDGYNDENDLETELLAIIEGHE-----NEIKCVAWSH-DGE-LLATCSRDKSV 133

Query: 235 NIWK 238
            IW+
Sbjct: 134 WIWE 137

>Scas_652.16
          Length = 345

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 117/244 (47%), Gaps = 28/244 (11%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GHE+ +  V +   G ++ATCS D+ + +++ D+   E+E     + H   +  V W S 
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 77  L--SLLASSSYDDTIRIWKDFDDD-------WQCAAVLNGHEGTVWCSDFEKSESSLRLC 127
               ++ S+SYD T+++W++  D        W     LN  +G+++   F      L+L 
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLA 129

Query: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQS------VLPSAHSRAVYSVSW-----SPTGLI 176
              +D T+RI++ +E +  D + W L S      V P+ H ++ + ++W     SP  L+
Sbjct: 130 CIGNDATLRIYEALEPS--DLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLV 187

Query: 177 ASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE--TLLVTGGDDGCV 234
            ST      +IYQ  ++GK  I+A+     G+     + W    G    L+ TG  DG +
Sbjct: 188 VSTLDQA--SIYQRGKDGKLYIVAKLNGHKGLIRD--ISWAPSIGRWYHLIATGCKDGKL 243

Query: 235 NIWK 238
            I++
Sbjct: 244 RIFR 247

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           S +  ELL+  + H  E+ SVSW+ +G  L++   D  V +W++  Y  EF+C+SV+  +
Sbjct: 286 SSVSVELLSEHDDHNAEIWSVSWNLTGTILSSAGDDGKVRLWKS-TYSNEFKCMSVITSN 344

Query: 65  S 65
           S
Sbjct: 345 S 345

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/138 (18%), Positives = 60/138 (43%), Gaps = 40/138 (28%)

Query: 11  LLAIVEGHENEVKSVSWSHS----GYYLATCSRDKSVWIWEA--------------DEYG 52
           ++A + GH+  ++ +SW+ S     + +AT  +D  + I+                D Y 
Sbjct: 207 IVAKLNGHKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNSSKDAINDSYD 266

Query: 53  EE---------------------FECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRI 91
           +E                      E +S   +H+ ++  V W+   ++L+S+  D  +R+
Sbjct: 267 DEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNLTGTILSSAGDDGKVRL 326

Query: 92  WKD-FDDDWQCAAVLNGH 108
           WK  + ++++C +V+  +
Sbjct: 327 WKSTYSNEFKCMSVITSN 344

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 77.8 bits (190), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 117/254 (46%), Gaps = 36/254 (14%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           +   + GH + V  +S+   G  +ATCS D+ + +++ D+   E+E     + H   +  
Sbjct: 1   MKPFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVS 60

Query: 71  VVWHS--VLSLLASSSYDDTIRIWKDFDD-------DWQCAAVLNGHEGTVWCSDFEKSE 121
           + W +     ++AS SYD TI++W++  D        WQ    LN   G ++   F  S 
Sbjct: 61  LDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSH 120

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVL------PSAHSRAVYSVSWSPT-- 173
             LRL +  +D  +R++  +E +  D + W L S +      P++H ++ + +SW P+  
Sbjct: 121 LGLRLAALGNDGKLRLYDALESS--DLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRF 178

Query: 174 ---GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHG------VYETNVVKWTQIDGETL 224
               L+ S        IYQ  ++GK  + A H   H        +  +V +W Q     L
Sbjct: 179 STERLVISAMDQA--TIYQRNKQGKL-VPAGHLKGHTGLIRSIAWAPSVGRWYQ-----L 230

Query: 225 LVTGGDDGCVNIWK 238
           + TG  DG + I+K
Sbjct: 231 IATGCKDGKLRIFK 244

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           + +  EL++    H+ EV SVSW+ +G  L++   D  + +W+A  Y  EF C+SV+Q
Sbjct: 285 ANLHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKA-SYSNEFRCMSVVQ 341

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 56  ECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWK-DFDDDWQCAAVLNG 107
           E IS   +H  +V  V W+   ++L+S+  D  IR+WK  + ++++C +V+  
Sbjct: 290 ELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKASYSNEFRCMSVVQA 342

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 75.9 bits (185), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 114/242 (47%), Gaps = 24/242 (9%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH++ V  V +   G ++ATCS D+ + +++ D+    +E     + H   +  + W S 
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 77  L--SLLASSSYDDTIRIWKDFDDDWQCAA-------VLNGHEGTVWCSDFEKSESSLRLC 127
               ++AS+SYD T+++W++  D  +C+         LN  +G+++   F  +   L+L 
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLA 126

Query: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQ------SVLPSAHSRAVYSVSWSPTGLIASTGS 181
              +D  +R++  +E +  D + W L       S+ P+ H ++ + +SW P+       +
Sbjct: 127 CLGNDGILRLYDALEPS--DLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLA 184

Query: 182 DGLL---AIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE--TLLVTGGDDGCVNI 236
              L    IYQ  ++GK  + A+      +  +  + W    G    L+ TG  DG + I
Sbjct: 185 VSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRS--ISWAPSIGRWYQLIATGCKDGRIRI 242

Query: 237 WK 238
           +K
Sbjct: 243 FK 244

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
           S ++ ELL+  + H  EV SVSW+ +G  L++   D  V +W+A  Y  EF+C+SV+
Sbjct: 290 SNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKA-TYSNEFKCMSVI 345

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 54  EFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWK-DFDDDWQCAAVLNGHE 109
           + E +S   +H+ +V  V W+   ++L+S+  D  +R+WK  + ++++C +V+   +
Sbjct: 293 QVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ 349

>Kwal_14.1611
          Length = 334

 Score = 73.6 bits (179), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 115/250 (46%), Gaps = 28/250 (11%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           +   + GHE+ V  +S+   G ++ATCS D+ + ++       E++     + H   V  
Sbjct: 1   MKPFITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVG 60

Query: 71  VVWHSV--LSLLASSSYDDTIRIWKDFDDDWQCAA-------VLNGHEGTVWCSDFEKSE 121
           + W S     ++AS SYD  + +W++  D  +C+         LN   G ++   F    
Sbjct: 61  LDWASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGH 120

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQS---VLPS---AHSRAVYSVSW----- 170
             L+L +  +D  +RI++ +E +  D + W L S   VLPS   +H ++ + ++W     
Sbjct: 121 LGLKLGAIGNDGILRIYEAMEPS--DLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRF 178

Query: 171 SPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE--TLLVTG 228
           SP  LI       L  IYQ+ + GK  + A+ E   G+  +  V W    G    L+ T 
Sbjct: 179 SPEKLIVCALDQAL--IYQKDKAGKLYVAAKLEGHAGLIRS--VSWAPSVGRWYQLIATA 234

Query: 229 GDDGCVNIWK 238
             DG V I+K
Sbjct: 235 CKDGKVRIFK 244

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           S ++ EL++  + H  EV SVSW+ +G  L++   D  V +W+A  Y  EF+C+SV+   
Sbjct: 274 SSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKA-SYSSEFKCMSVISAQ 332

Query: 65  SQ 66
            +
Sbjct: 333 QK 334

 Score = 35.0 bits (79), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 57/128 (44%), Gaps = 31/128 (24%)

Query: 13  AIVEGHENEVKSVSWSHSG----YYLATCSRDKSVWIWEADEYGEE-------------- 54
           A +EGH   ++SVSW+ S       +AT  +D  V I++  E  ++              
Sbjct: 206 AKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQVEEES 265

Query: 55  ------------FECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWK-DFDDDWQC 101
                        E +S   +H  +V  V W+   ++L+S+  D  +R+WK  +  +++C
Sbjct: 266 ENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKASYSSEFKC 325

Query: 102 AAVLNGHE 109
            +V++  +
Sbjct: 326 MSVISAQQ 333

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 24/134 (17%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESS--LRLCSGSDDTTVRI 137
           L   + D  +   KD       AA L GH G +    +  S       + +   D  VRI
Sbjct: 183 LIVCALDQALIYQKDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRI 242

Query: 138 WKYIEDNEDDEQVWALQSV----------LPSA-----------HSRAVYSVSWSPTG-L 175
           +K +E  +DD+   ++  V          +PS+           H   V+SVSW+ TG +
Sbjct: 243 FKLMETAQDDQDAMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTI 302

Query: 176 IASTGSDGLLAIYQ 189
           ++S G DG + +++
Sbjct: 303 LSSAGDDGKVRLWK 316

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 73.2 bits (178), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 114/243 (46%), Gaps = 26/243 (10%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GHE+ V  V++   G  +ATCS D+ + +++ D+    +E     + H   +  + W S 
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 77  --LSLLASSSYDDTIRIWKDFDDDWQCAA-------VLNGHEGTVWCSDFEKSESSLRLC 127
               ++AS+SYD TI+IW++  +  +C+         LN  +G+++C  F  S   LR+ 
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIA 126

Query: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQS------VLPSAHSRAVYSVSWSPTGL----IA 177
           S  +D  +R++  ++ +  + + W + +      V P+ + ++ + +SW  T      IA
Sbjct: 127 SIGNDGIMRMYDALDPS--NLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEKIA 184

Query: 178 STGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGET--LLVTGGDDGCVN 235
               D    IYQ  ++G +      +L         + W  + G    L+ TG  DG V 
Sbjct: 185 VCALDQAY-IYQRGKDGHF--YQAGKLPGHTSLIRSISWAPLIGRPYHLIATGCKDGRVR 241

Query: 236 IWK 238
           I++
Sbjct: 242 IFR 244

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 4   NSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE 63
           N+++E ELL+  + H+ EV SVSW+ +G  L++   D  V +W++  Y  E++C+S++  
Sbjct: 276 NTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKS-TYSNEYKCMSIITS 334

Query: 64  HSQDV 68
             QD+
Sbjct: 335 -KQDI 338

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 58/129 (44%), Gaps = 34/129 (26%)

Query: 15  VEGHENEVKSVSWS----HSGYYLATCSRDKSVWIW---------------EADEYGEEF 55
           + GH + ++S+SW+       + +AT  +D  V I+               ++D+Y  E 
Sbjct: 208 LPGHTSLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMED 267

Query: 56  ECISVLQ--------------EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKD-FDDDWQ 100
           + I   Q              +H  +V  V W+   ++L+S+  D  +R+WK  + ++++
Sbjct: 268 QGIKQRQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEYK 327

Query: 101 CAAVLNGHE 109
           C +++   +
Sbjct: 328 CMSIITSKQ 336

>Kwal_23.5351
          Length = 474

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 106/247 (42%), Gaps = 39/247 (15%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
            H++++  V+WS     LAT   D  V IW             VL+ H   V  V +H  
Sbjct: 223 AHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPS 282

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
              +AS+S+D T R+W D + + +   +  GH   V+C DF+  + SL LCS   D+   
Sbjct: 283 DRFVASASFDMTWRLW-DVERETEL-QLQEGHAKEVYCLDFQ-CDGSL-LCSAGLDSVGH 338

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQ------ 189
           +W    D      +  L+      H++ +Y VSWSP G   +TGS DG + ++       
Sbjct: 339 VW----DMRTGRSLMVLE-----GHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANK 389

Query: 190 ----------------EKEEGKWEIIAQHELAHGVYETNV-VKWTQIDGET--LLVTGGD 230
                           EKE G + + + ++   GV+ T   +K   + G T  +L     
Sbjct: 390 PSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDIS 449

Query: 231 DGCVNIW 237
            G  N+W
Sbjct: 450 RGGANLW 456

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 116/251 (46%), Gaps = 34/251 (13%)

Query: 10  ELLAIVEGHENEVKSVSWSHS--GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +L+  + GHE  V  V W+H   G  LA+CS D  V IW+  E    +  I+V   HS  
Sbjct: 44  KLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK--EENGRWSQIAVHAVHSAS 101

Query: 68  VKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV----WCS------ 115
           V  V W  H    LL  +S D  + + +  ++      +++ H   V    W        
Sbjct: 102 VNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEED 161

Query: 116 -DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG 174
            +   ++ S +  +G  D  V+IWKY      D Q + L+S L   HS  V  V+WSPT 
Sbjct: 162 GEHNGTKESRKFVTGGADNLVKIWKY----NSDAQTYVLESTL-EGHSDWVRDVAWSPTV 216

Query: 175 L----IASTGSDGLLAIY-QEKEEGKWE--IIAQHELAHGVYETNVVKWTQIDGETLLVT 227
           L    +AS   D    I+ Q+ E+G W+  ++ + +    ++  +   W+ + G  L ++
Sbjct: 217 LLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRAS---WS-LSGNVLALS 272

Query: 228 GGDDGCVNIWK 238
           GGD+  V +WK
Sbjct: 273 GGDNK-VTLWK 282

 Score = 60.8 bits (146), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 73/167 (43%), Gaps = 11/167 (6%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++ I   H   +      + G  LATCS DK++ I+E +  GE  + I  L  H   V  
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWR 58

Query: 71  VVW-HSVL-SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCS 128
           V W H    ++LAS SYD  + IWK+ +  W   AV   H  +V    +   E    L  
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLV 118

Query: 129 GSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL 175
            S D  V + ++ E+            ++  AH+  V S SW+P  +
Sbjct: 119 ASSDGKVSVVEFKENG-------TTSPIIIDAHAIGVNSASWAPATI 158

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 84/195 (43%), Gaps = 24/195 (12%)

Query: 58  ISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
           + +   H++ +   V       LA+ S D TI+I++   +  +    L GHEG VW  D+
Sbjct: 2   VVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDW 61

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP---TG 174
              +    L S S D  V IWK      ++   W+ Q  + + HS +V SV W+P     
Sbjct: 62  AHPKFGTILASCSYDGKVLIWK------EENGRWS-QIAVHAVHSASVNSVQWAPHEYGP 114

Query: 175 LIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI----DGE-------T 223
           L+    SDG +++ + KE G    I     A GV   N   W       DGE        
Sbjct: 115 LLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGV---NSASWAPATIEEDGEHNGTKESR 171

Query: 224 LLVTGGDDGCVNIWK 238
             VTGG D  V IWK
Sbjct: 172 KFVTGGADNLVKIWK 186

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 70.9 bits (172), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 108/248 (43%), Gaps = 24/248 (9%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           +     GHE+ V  + +   G ++ATCS D+ + ++  D+   E+      + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 71  VVWHSV--LSLLASSSYDDTIRIWKDFDD-------DWQCAAVLNGHEGTVWCSDFEKSE 121
           + W S     +LAS SY+ TI++W++  D        W     LN   G ++   F    
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQS------VLPSAHSRAVYSVSWSPTGL 175
             LRL +  +D  +RI+  +E +  D + W L S        P++H ++ +S+ W P+  
Sbjct: 121 LGLRLGAIGNDGVLRIYDALEPS--DLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRF 178

Query: 176 IASTGSDGLL---AIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE--TLLVTGGD 230
            A       L    +Y+  + GK    A+     G+  +  V W    G    L+ TG  
Sbjct: 179 SAERLVVCALDQAFVYERNKAGKLFQAARLPGHQGLIRS--VSWAPSFGRWHQLIATGSK 236

Query: 231 DGCVNIWK 238
           DG V I++
Sbjct: 237 DGRVRIFQ 244

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 26/119 (21%)

Query: 13  AIVEGHENEVKSVSWSHS----GYYLATCSRDKSVWIWEADEY----------------- 51
           A + GH+  ++SVSW+ S       +AT S+D  V I++  E                  
Sbjct: 206 ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDA 265

Query: 52  -GEEFECISVLQEHSQ---DVKHVVWHSVLSLLASSSYDDTIRIWK-DFDDDWQCAAVL 105
                  + +L EH+    +V  V W+   ++L+SS  D  +R+WK  F ++++C +V+
Sbjct: 266 GPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVI 324

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
           +  +LL+    H+ EV SVSW+ +G  L++   D  V +W++  +  EF+C+SV+
Sbjct: 271 ISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKS-SFSNEFKCMSVI 324

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 68/174 (39%), Gaps = 35/174 (20%)

Query: 3   WNSEMETELLAIVEG-HENEVKSVSWSHSGY---YLATCSRDKSVWIWEADEYGEEFECI 58
           W    E ++LA     H     S+ W  S +    L  C+ D++ +++E ++ G+ F+  
Sbjct: 148 WTLTSEVKVLATPPASHLQSDFSLDWCPSRFSAERLVVCALDQA-FVYERNKAGKLFQA- 205

Query: 59  SVLQEHSQDVKHVVWHSVLS----LLASSSYDDTIRIWKDFDD----------------- 97
           + L  H   ++ V W         L+A+ S D  +RI++  +                  
Sbjct: 206 ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDA 265

Query: 98  ------DWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNE 145
                   Q  +    H+G VW   +  + + L   S  DD  VR+WK    NE
Sbjct: 266 GPAPHISVQLLSEHADHKGEVWSVSWNLTGTIL--SSSGDDGKVRLWKSSFSNE 317

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 69/225 (30%), Positives = 102/225 (45%), Gaps = 30/225 (13%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V SVS+S    YL + S DK+V +W  D Y     C+   + H+  V  V +  +
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTY----TCLVSYKGHNHPVWDVKFSPL 595

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
               A+ S+D T R+W    D      +  GH   V C  F  + +   + +GS D T R
Sbjct: 596 GHYFATGSHDQTARLWS--CDHIYPLRIFAGHLNDVDCVTFHPNGT--YVLTGSSDKTCR 651

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGK 195
           +W    D +  + V      L   H+ +V SV+ SP G   +TGS DG++ ++   + G 
Sbjct: 652 MW----DIQTGDSV-----RLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVW---DIGT 699

Query: 196 WEIIAQHELAHG---VYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            + I Q    HG   VY  +  K   I     LV+GG D  V +W
Sbjct: 700 GKRIKQMR-GHGKSAVYSLSFNKEGNI-----LVSGGADQSVRVW 738

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ +  T L++  +GH + V  V +S  G+Y AT S D++  +W  D        + +  
Sbjct: 569 WSLDTYTCLVS-YKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCD----HIYPLRIFA 623

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H  DV  V +H   + + + S D T R+W     D     +  GH  +V       S  
Sbjct: 624 GHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD--SVRLFLGHTASV--VSVAVSPD 679

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR-AVYSVSWSPTG-LIASTG 180
              L +GS+D  + +W  I   +  +Q+          H + AVYS+S++  G ++ S G
Sbjct: 680 GRWLTTGSEDGVIIVWD-IGTGKRIKQM--------RGHGKSAVYSLSFNKEGNILVSGG 730

Query: 181 SDGLLAIYQEKE 192
           +D  + ++  K+
Sbjct: 731 ADQSVRVWDLKK 742

>Kwal_56.24526
          Length = 1210

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 111/260 (42%), Gaps = 42/260 (16%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+  M T LL   E HE  V+ + +  +     +   D ++ +W  D      +C+  L 
Sbjct: 38  WDYRMGT-LLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTK----KCLFTLN 92

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA---AVLNGHEGTVWCSDFEK 119
            H   V+ V +H  L  + S+S D TIRIW     +WQ     A L GH   V C+DF  
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIW-----NWQNRKEIACLTGHNHFVMCADFHP 147

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNED---------DEQVWALQSVLPS----------- 159
           +E    + S S D TVR+W      +          ++Q+ A Q++L             
Sbjct: 148 TED--LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFIL 205

Query: 160 -AHSRAVYSVSWSPT-GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWT 217
             HSR V   S+ PT  LI S G D  + +++      WE+    +   G +  NV    
Sbjct: 206 EGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEV----DTCRG-HTNNVDSVI 260

Query: 218 QIDGETLLVTGGDDGCVNIW 237
               + L+++ G+D  V +W
Sbjct: 261 FHPHQNLIISVGEDKTVRVW 280

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN    T+ +A + GH+  V  V++S  G Y+ + S D S+ +W+    G + + IS  +
Sbjct: 386 WNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFISTFR 441

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   V  V W S   LL S S D T+++W       + +  L GH+  V+  D+  S  
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR--KLSVDLPGHKDEVYTVDW--SVD 497

Query: 123 SLRLCSGSDDTTVRIWKY 140
             R+CSG  D  VR+W +
Sbjct: 498 GKRVCSGGKDKMVRLWTH 515

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 70/144 (48%), Gaps = 18/144 (12%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECIS-VL 61
           W+ + +T +  + +GH N V  VSWS  G  +AT S D ++ +W+     +  +C+   L
Sbjct: 171 WDCDTQTPMHTL-KGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDP----KSGQCLGDAL 225

Query: 62  QEHSQ-------DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
           + HS+       +  H+V       LASSS D TI+IW        C   ++GH  +V C
Sbjct: 226 RGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSR--VCQYTMSGHTNSVSC 283

Query: 115 SDFEKSESSLRLCSGSDDTTVRIW 138
             +        L SGS D TVR+W
Sbjct: 284 VKWGGQG---LLYSGSHDRTVRVW 304

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 79/190 (41%), Gaps = 26/190 (13%)

Query: 15  VEGHENEVKSVSWS-HSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           + GH + +   +++ H+   + T + D +  IW+ D        +  L+ H   V  V W
Sbjct: 139 IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTP----MHTLKGHYNWVLCVSW 194

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAA-VLNGHEGTVWCSDFE-------KSESSLR 125
                ++A+ S D+TIR+W       QC    L GH  + W +          K  S  R
Sbjct: 195 SPDGEVIATGSMDNTIRLWDP--KSGQCLGDALRGH--SKWITSLSWEPIHLVKPGSKPR 250

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLL 185
           L S S D T++IW         + V  +     S H+ +V  V W   GL+ S   D  +
Sbjct: 251 LASSSKDGTIKIW---------DTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTV 301

Query: 186 AIYQEKEEGK 195
            ++    +G+
Sbjct: 302 RVWDINSQGR 311

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 72/169 (42%), Gaps = 30/169 (17%)

Query: 78  SLLASSSYDDTIRIWKDFDDDWQCAA-VLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
           S + + + D+T RIW   D D Q     L GH   V C  +  S     + +GS D T+R
Sbjct: 157 SRMVTGAGDNTARIW---DCDTQTPMHTLKGHYNWVLCVSW--SPDGEVIATGSMDNTIR 211

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLI--------ASTGSDGLLAIY 188
           +W       D +    L   L   HS+ + S+SW P  L+        AS+  DG + I+
Sbjct: 212 LW-------DPKSGQCLGDAL-RGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

Query: 189 QEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
                     + Q+ ++      + VKW    G+ LL +G  D  V +W
Sbjct: 264 DTVSR-----VCQYTMSGHTNSVSCVKW---GGQGLLYSGSHDRTVRVW 304

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 18/143 (12%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
           + ++ + GH  T+ CS F    SS R+ +G+ D T RIW    D +    +  L+     
Sbjct: 134 RSSSAIAGHGSTILCSAFAPHTSS-RMVTGAGDNTARIW----DCDTQTPMHTLK----- 183

Query: 160 AHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNV----V 214
            H   V  VSWSP G + +TGS D  + ++  K     + +      H  + T++    +
Sbjct: 184 GHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG---QCLGDALRGHSKWITSLSWEPI 240

Query: 215 KWTQIDGETLLVTGGDDGCVNIW 237
              +   +  L +   DG + IW
Sbjct: 241 HLVKPGSKPRLASSSKDGTIKIW 263

>Scas_631.17
          Length = 474

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 109/231 (47%), Gaps = 24/231 (10%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
            I  GH+ ++  ++W+ +  +L + + D  V I   D   +  + ++ LQ H+  V +V 
Sbjct: 223 GIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVD 282

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           +H     +AS+S+D T R+W D + + +      GH   V+   F+ ++ +L LCSG  D
Sbjct: 283 FHPSGRFVASASFDMTWRLW-DIESETEL-QFQEGHGKEVYSLSFQ-NDGAL-LCSGGLD 338

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIYQEK 191
               +W    D    + +  LQ      H++ +YSV WSP G  IA+ G DG++ I    
Sbjct: 339 NAAIVW----DVRTGKSIMNLQ-----GHAKPIYSVDWSPDGYHIATGGGDGVINI---- 385

Query: 192 EEGKWEIIAQHELAHGVYETNVVKWTQIDGET--LLVTGGDDGCVNIWKNE 240
               W+I    E    +   N+V   +    T   LV+ G D  + I+ ++
Sbjct: 386 ----WDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 77/181 (42%), Gaps = 23/181 (12%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           L  ++GH   V +V +  SG ++A+ S D +  +W+ +   E    +   + H ++V  +
Sbjct: 268 LTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETE----LQFQEGHGKEVYSL 323

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLN--GHEGTVWCSDFEKSESSLRLCSG 129
            + +  +LL S   D+   +W    D     +++N  GH   ++  D+  S     + +G
Sbjct: 324 SFQNDGALLCSGGLDNAAIVW----DVRTGKSIMNLQGHAKPIYSVDW--SPDGYHIATG 377

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP-TG-LIASTGSDGLLAI 187
             D  + IW   +  E    +         AH+  V  V +   TG  + S G D  + I
Sbjct: 378 GGDGVINIWDIRKTTETTRLL---------AHNNIVTGVRFQKSTGHCLVSCGYDKQIRI 428

Query: 188 Y 188
           Y
Sbjct: 429 Y 429

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 111/257 (43%), Gaps = 37/257 (14%)

Query: 9   TELLAIVEGHENEVKSVSWSHSGY---YLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           + LL  + GHE  V    W H       LATC  D  V IW+   +G + + I     HS
Sbjct: 45  SSLLETLVGHEGPVWYADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHS 104

Query: 66  QDVKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVL-NGHEGTV----WCS--- 115
             V  V W  H    +L   S D  I + +  D       +L N H+  V    W     
Sbjct: 105 ASVNCVKWAPHEYGLILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMK 164

Query: 116 -----DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW 170
                D +++ +  +  SG +D  V+IWK+    +DD++ + +   L   H  AV +V W
Sbjct: 165 TDSSDDGDETTAVKQFISGGNDNLVKIWKF----DDDQETYVVADTL-EGHKDAVTAVDW 219

Query: 171 SPTGL----IASTGSDGLLAIYQEKEEGK---WEIIAQHELAHGVYETNV--VKWTQIDG 221
           SPT L    +AS  +D    ++ +    K   W+ I+ +E   G +E  +  V W+ + G
Sbjct: 220 SPTTLLQSYVASVSNDKQCLVWTQDHSSKKNDWKKISVNE---GKFEQKLGSVSWS-LSG 275

Query: 222 ETLLVTGGDDGCVNIWK 238
             LL    DD  V IWK
Sbjct: 276 -NLLAVSDDDKNVTIWK 291

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 80/177 (45%), Gaps = 13/177 (7%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++ I   HE  +   + ++ G  LATCS DK+V I+E ++       +  L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 71  VVW-HSVL--SLLASSSYDDTIRIWKD--FDDDWQCAAVLNGHEGTVWCSDFEKSESSLR 125
             W H  L  +LLA+  YD  + IWK+       Q       H  +V C  +   E  L 
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLI 120

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSD 182
           L  GS D  + + +       D Q+ A   +L +AH   V S+SW+P  L+ +  SD
Sbjct: 121 LLCGSADGKISVVEL-----KDGQI-ASTKILDNAHKFGVNSISWAP--LMKTDSSD 169

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 3   WNSEMETELLA-IVEGHENEVKSVSWSHSGY---YLATCSRDKSVWIWEADEYGE--EFE 56
           ++ + ET ++A  +EGH++ V +V WS +     Y+A+ S DK   +W  D   +  +++
Sbjct: 194 FDDDQETYVVADTLEGHKDAVTAVDWSPTTLLQSYVASVSNDKQCLVWTQDHSSKKNDWK 253

Query: 57  CISVLQ-EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDD 97
            ISV + +  Q +  V W    +LLA S  D  + IWK+  D
Sbjct: 254 KISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGD 295

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 67.8 bits (164), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN    T+ +  + GH+  V  V++S  G Y+ + S D S+ +W+    G + + +S  +
Sbjct: 386 WNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFLSTFR 441

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   V  V W S   LL S S D T+++W       + +  L GH+  V+  D+  S  
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWD--VKTRKLSVDLPGHQDEVYTVDW--SVD 497

Query: 123 SLRLCSGSDDTTVRIWKY 140
             R+CSG  D  VRIW +
Sbjct: 498 GKRVCSGGKDKMVRIWTH 515

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 22/146 (15%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE---YGEEFECIS 59
           W+ + +T +  + +GH N V   SWS  G  +AT S D ++ +WE+ +   YG+      
Sbjct: 171 WDCDTQTRMCTL-QGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGD------ 223

Query: 60  VLQEHSQDVKHVVWHSV-------LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV 112
            L+ HS+ +  + W  +          LA++S D TI+IW        C   L GH  +V
Sbjct: 224 ALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRR--VCLLTLCGHTSSV 281

Query: 113 WCSDFEKSESSLRLCSGSDDTTVRIW 138
            C  +        L SGS D T+R W
Sbjct: 282 SCVKWGGKNV---LYSGSHDKTIRCW 304

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 83/205 (40%), Gaps = 28/205 (13%)

Query: 48  ADEYGEEFECISVLQ-----EHSQDVKHVVWHSVLSLLASSSYDD-----TIRIWKDFDD 97
           AD     F C+   +     E   D++  ++ S+L     ++ D      T R       
Sbjct: 72  ADPVPYTFSCLVSNKKKDADEEMVDIRDNLYQSILKPGLKTTEDFLTLVYTPRAIFKVKP 131

Query: 98  DWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVL 157
             + ++ + GH  T+ CS F  + SS R+ +G+ D T  IW    D +   ++  LQ   
Sbjct: 132 VTRSSSAIAGHGSTILCSAFAPNTSS-RMVTGAGDNTACIW----DCDTQTRMCTLQ--- 183

Query: 158 PSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNV--- 213
              H   V   SWSP G + +TGS D  + ++   E  K +        H  + T++   
Sbjct: 184 --GHHNWVLCCSWSPDGELIATGSMDNTIRLW---ESSKGKPYGDALRGHSKWITSLSWE 238

Query: 214 -VKWTQIDGETLLVTGGDDGCVNIW 237
            +   +   +  L T   DG + IW
Sbjct: 239 PIHLVKPGDKPRLATASKDGTIKIW 263

>Scas_720.95
          Length = 515

 Score = 67.8 bits (164), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN     + +A + GH+  V  V++S  G Y+ + S D S+ +W+    G + + IS  +
Sbjct: 386 WNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFISTFR 441

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   V  V W +   LL S S D T+++W       + +  L GH+  V+  D+  S  
Sbjct: 442 GHVASVYQVAWSADCRLLVSCSKDTTLKVWD--VRTRKLSVDLPGHKDEVYTVDW--SVD 497

Query: 123 SLRLCSGSDDTTVRIWKY 140
             R+CSG  D  VRIW +
Sbjct: 498 GKRVCSGGKDKMVRIWTH 515

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 33/242 (13%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ + +T   A + GH N V  VS+  +G  +AT S D ++ +W++ + G+       L+
Sbjct: 171 WDCDTQTPK-ATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKD-GKPLG--DALR 226

Query: 63  EHSQDVKHVVWHSV-------LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
            H + +  + W  +          LAS+S D TIRIW D      C   ++GH  +V C 
Sbjct: 227 GHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIW-DITRR-VCLYTMSGHTNSVSCI 284

Query: 116 DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL 175
            +        + SGS D TVR+W   + N D + +  L+S     H+  V  +S S    
Sbjct: 285 KWSGQGI---IYSGSHDKTVRVW---DMNADGKCINILKS-----HAHWVNHLSLSTDYA 333

Query: 176 IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVN 235
           +     D   A     ++ + + +A        YE  V K  ++  E L+VT  DD  + 
Sbjct: 334 LRVGAFDHTGAQPASAKDARDKALAN-------YEKVVKKNGKL--EELMVTASDDFTMF 384

Query: 236 IW 237
           +W
Sbjct: 385 LW 386

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 10/82 (12%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
           + ++ + GH  T+ CS F  + SS R+ +G+ D T RIW        D      ++ L +
Sbjct: 134 RSSSAIAGHGSTILCSAFAPNTSS-RMVTGAGDNTARIW--------DCDTQTPKATL-T 183

Query: 160 AHSRAVYSVSWSPTGLIASTGS 181
            H   V  VS+ P G + +TGS
Sbjct: 184 GHFNWVLCVSYCPNGEVIATGS 205

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 66.6 bits (161), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 114/249 (45%), Gaps = 32/249 (12%)

Query: 10  ELLAIVEGHENEVKSVSWSHS--GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +L+  + GHE  V  V W+H   G  LA+CS D  V IW+  E    +  I+  + HS  
Sbjct: 44  KLVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK--EENGRWSQIAAYEVHSAS 101

Query: 68  VKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGH----EGTVWCS-----D 116
           V  V W  H    LL  SS D    + +  ++      +++ H        W       D
Sbjct: 102 VNSVKWAPHEYGPLLLCSSSDGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPATIEDD 161

Query: 117 FEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL- 175
            ++S+   R+ +G  D  V+IWKY      +   + L+  L +AH+  V  V+WSP+ L 
Sbjct: 162 GQQSQHLRRIATGGADNLVKIWKY----NPEANTYLLEDTL-AAHADWVRDVAWSPSVLP 216

Query: 176 ---IASTGSDGLLAIY-QEKEEGKW--EIIAQHELAHGVYETNVVKWTQIDGETLLVTGG 229
              +A+   D    I+ QE  +G W   ++ + +    ++  +   W+ + G  L ++GG
Sbjct: 217 RAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRAS---WS-LSGNILALSGG 272

Query: 230 DDGCVNIWK 238
           D+  V +WK
Sbjct: 273 DNK-VTLWK 280

 Score = 63.9 bits (154), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 98/245 (40%), Gaps = 25/245 (10%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++ I   H   +      + G  LATCS DK++ I+E D  G+  + +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVD--GDSHKLVDSLHGHEGPVWQ 58

Query: 71  VVW-HSVLS-LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE-SSLRLC 127
           V W H     +LAS SYD  + IWK+ +  W   A    H  +V    +   E   L LC
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLC 118

Query: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL------------ 175
           S SD      +  +E  E+         ++  AH+  V +  W+P  +            
Sbjct: 119 SSSDGK----FSVVEFKENG----TTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRR 170

Query: 176 IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVN 235
           IA+ G+D L+ I++   E    ++     AH  +  +V     +     L T   D    
Sbjct: 171 IATGGADNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSVLPRAYLATVSQDRTCI 230

Query: 236 IWKNE 240
           IW  E
Sbjct: 231 IWTQE 235

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN    T+ +  + GH+  V  V++S  G ++ + S D S+ +W     G + + IS  +
Sbjct: 386 WNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWN----GRDGKFISTFR 441

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   V  V W S   LL S S D T+++W D     + A  L GH+  V+  D+  S  
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVW-DVKTK-KLAVDLPGHKDEVYTVDW--SVD 497

Query: 123 SLRLCSGSDDTTVRIWKY 140
             R+CSG  D  VR+W +
Sbjct: 498 GKRVCSGGKDKMVRLWTH 515

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (47%), Gaps = 16/143 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+   +T + + ++GH N V  VSWS  G  +AT S D ++ +WE ++ G+       L+
Sbjct: 171 WDCNTQTPM-STLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNK-GQPVG--DALR 226

Query: 63  EHSQ-------DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
            H +       +  H+V       LAS+S D TI+IW        C   L+GH  +V C 
Sbjct: 227 GHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRR--VCLITLSGHTSSVSCI 284

Query: 116 DFEKSESSLRLCSGSDDTTVRIW 138
            +        L SGS D T+R W
Sbjct: 285 KWGGQGV---LYSGSHDKTIRAW 304

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 78/185 (42%), Gaps = 23/185 (12%)

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDD-----TIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
           E   D+K  +++S+L     ++ D      T R         + ++ + GH  T+ CS F
Sbjct: 92  EQMIDIKDNLYNSILKPGLKTTEDFITLVYTPRAVFKVKPVTRSSSAIAGHGSTILCSAF 151

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIA 177
               SS R+ +G+ D T RIW        D       S L   H   V  VSWSP G + 
Sbjct: 152 APHTSS-RMITGAGDNTARIW--------DCNTQTPMSTL-KGHFNWVLCVSWSPDGELI 201

Query: 178 STGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNV----VKWTQIDGETLLVTGGDDG 232
           +TGS D  + ++   E  K + +      HG + T++    +   +   +  L +   DG
Sbjct: 202 ATGSMDNTIRLW---EGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDG 258

Query: 233 CVNIW 237
            + IW
Sbjct: 259 TIKIW 263

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 24/189 (12%)

Query: 15  VEGHENEVKSVSWS-HSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           + GH + +   +++ H+   + T + D +  IW+ +        +S L+ H   V  V W
Sbjct: 139 IAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTP----MSTLKGHFNWVLCVSW 194

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFE-------KSESSLRL 126
                L+A+ S D+TIR+W+  +        L GH    W +          K     RL
Sbjct: 195 SPDGELIATGSMDNTIRLWEG-NKGQPVGDALRGHGK--WITSLSWEPIHLVKPGQKPRL 251

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186
            S S D T++IW       D  +   L ++  S H+ +V  + W   G++ S   D  + 
Sbjct: 252 ASASKDGTIKIW-------DTTRRVCLITL--SGHTSSVSCIKWGGQGVLYSGSHDKTIR 302

Query: 187 IYQEKEEGK 195
            +     GK
Sbjct: 303 AWDMNLGGK 311

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 66/227 (29%), Positives = 103/227 (45%), Gaps = 26/227 (11%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           A + GH   V SV++S    YL + S DK+V +W  D     F C+   + H+  V +V 
Sbjct: 547 ATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLD----TFTCLVCYKGHNHPVWYVK 602

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           +  +     ++S+D T R+W    D      + +GH   V CS F    +   + +GS D
Sbjct: 603 FSPLGHYFITASHDQTARLWS--CDHIYPLRIFSGHLNDVDCSTFHP--NGCYVFTGSSD 658

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEK 191
            T R+W    D +  + V      L   H+  V ++  SP G   +TGS DG + ++   
Sbjct: 659 KTCRMW----DIQTGDSV-----RLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVW--- 706

Query: 192 EEGKWEIIAQHELAHGVYETNVVKWTQIDGE-TLLVTGGDDGCVNIW 237
           + G  + I Q +  HG    N +     + E   LVTGG D  V +W
Sbjct: 707 DIGTGKRIKQMK-GHG---KNPIYSITFNKEGNCLVTGGADQSVRVW 749

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 53/127 (41%), Gaps = 8/127 (6%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           L   +GH + V  V +S  G+Y  T S D++  +W  D        + +   H  DV   
Sbjct: 588 LVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCD----HIYPLRIFSGHLNDVDCS 643

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
            +H     + + S D T R+W     D     +  GH   V  +  E S     L +GS+
Sbjct: 644 TFHPNGCYVFTGSSDKTCRMWDIQTGD--SVRLFLGHTSPV--TALEVSPDGRWLTTGSE 699

Query: 132 DTTVRIW 138
           D T+ +W
Sbjct: 700 DGTIIVW 706

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 71/139 (51%), Gaps = 10/139 (7%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN    T+ ++ + GH+  V  V++S  G Y+ + S D S+ +W+    G+E   +S  +
Sbjct: 388 WNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD----GKEGTFLSTFR 443

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAV-LNGHEGTVWCSDFEKSE 121
            H   V  V W S   LL S S D T+++W   D   +  +V L GH+  V+  D+  S 
Sbjct: 444 GHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKTRKLSVDLPGHQDEVYTVDW--SV 498

Query: 122 SSLRLCSGSDDTTVRIWKY 140
              R+CSG  D  +R+W +
Sbjct: 499 DGKRVCSGGKDKMMRLWTH 517

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (46%), Gaps = 16/150 (10%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ + +T  + +  GH N V  VSWS  G  +AT S D ++ +W+A E G+       L+
Sbjct: 173 WDCDTQTPKVTL-NGHRNWVLCVSWSADGEVIATGSMDNTIRLWDA-ESGKPLG--DALR 228

Query: 63  EHSQDVKHVVWHSV-------LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
            HS+ +  + W  +          LAS+S D TIRIW        C   L GH  +V C 
Sbjct: 229 GHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWD--SSRRVCLMTLGGHTNSVSCV 286

Query: 116 DFEKSESSLRLCSGSDDTTVRIWKYIEDNE 145
            +        L SGS D TVR W   ++ +
Sbjct: 287 KWGGEGI---LYSGSHDKTVRAWDMKQNGK 313

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 78/189 (41%), Gaps = 24/189 (12%)

Query: 15  VEGHENEVKSVSWS-HSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           + GH   +   +++ H+   + T   D +  IW+ D    +      L  H   V  V W
Sbjct: 141 IAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKV----TLNGHRNWVLCVSW 196

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFE-------KSESSLRL 126
            +   ++A+ S D+TIR+W D +        L GH  + W +          +  S  RL
Sbjct: 197 SADGEVIATGSMDNTIRLW-DAESGKPLGDALRGH--SKWITSLTWEPIHLVEPGSKPRL 253

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186
            S S D T+RIW       D  +   L ++    H+ +V  V W   G++ S   D  + 
Sbjct: 254 ASASKDGTIRIW-------DSSRRVCLMTL--GGHTNSVSCVKWGGEGILYSGSHDKTVR 304

Query: 187 IYQEKEEGK 195
            +  K+ GK
Sbjct: 305 AWDMKQNGK 313

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 84/212 (39%), Gaps = 43/212 (20%)

Query: 49  DEYGEEFECI------SVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA 102
           D     F C       +V   H+ D+   ++ S+L     +S +D I +      D+Q  
Sbjct: 74  DPVPYTFSCTVKNTKNAVTTTHTVDIVDNIYSSLLKP-GHNSTEDIITL------DFQPR 126

Query: 103 AVLN------------GHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQV 150
           AV              GH  T+ CS F    SS R+ +G  D T RIW      + D Q 
Sbjct: 127 AVFKVKPITRSSSAIAGHGATILCSAFAPHTSS-RVVTGGGDNTARIW------DCDTQT 179

Query: 151 WALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVY 209
                V  + H   V  VSWS  G + +TGS D  + ++ + E GK   +      H  +
Sbjct: 180 ---PKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLW-DAESGK--PLGDALRGHSKW 233

Query: 210 ETNV----VKWTQIDGETLLVTGGDDGCVNIW 237
            T++    +   +   +  L +   DG + IW
Sbjct: 234 ITSLTWEPIHLVEPGSKPRLASASKDGTIRIW 265

>Scas_674.20
          Length = 297

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 89/201 (44%), Gaps = 25/201 (12%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++AI   H + +      + G  LATCS DK++ I+E +  GE  + ++ L+ H   V  
Sbjct: 1   MVAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKEVATLEGHDGPVWR 58

Query: 71  VVW-HSVL-SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCS 128
           V W H    ++LAS SYD  + IWK+ +  W   A    H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLA 118

Query: 129 GSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL------------- 175
            S D  V + ++ E+         L  ++  AH+  V S SW+P  L             
Sbjct: 119 ASSDGKVSVVEFKENG-------TLTPIIIDAHNIGVNSASWAPATLQENKPTKSPEESR 171

Query: 176 -IASTGSDGLLAIYQEKEEGK 195
              + G+D L+ I++   E +
Sbjct: 172 RFVTGGADNLVKIWKYNNESQ 192

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 88/194 (45%), Gaps = 22/194 (11%)

Query: 58  ISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
           +++   H+  +   V       LA+ S D TI+I++   +  +  A L GH+G VW  D+
Sbjct: 2   VAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDW 61

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP---TG 174
              +    L S S D  V IWK      ++   W+ Q    + HS +V SV W+P     
Sbjct: 62  AHPKFGTILASCSYDGKVLIWK------EENGRWS-QIACHAVHSASVNSVQWAPHEYGA 114

Query: 175 LIASTGSDGLLAIYQEKEEGKWE--IIAQHEL-------AHGVYETNVVKWTQIDGET-L 224
           L+ +  SDG +++ + KE G     II  H +       A    + N  K T+   E+  
Sbjct: 115 LLLAASSDGKVSVVEFKENGTLTPIIIDAHNIGVNSASWAPATLQEN--KPTKSPEESRR 172

Query: 225 LVTGGDDGCVNIWK 238
            VTGG D  V IWK
Sbjct: 173 FVTGGADNLVKIWK 186

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 100/260 (38%), Gaps = 77/260 (29%)

Query: 12  LAIVEGHENEVKSVSWSHS--GYYLATCSRDKSVWIWEADEYGE--EFECISVLQEHSQD 67
           +A +EGH+  V  V W+H   G  LA+CS D  V IW+ +E G   +  C +V   HS  
Sbjct: 46  VATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIWK-EENGRWSQIACHAV---HSAS 101

Query: 68  VKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV----WCS------ 115
           V  V W  H   +LL ++S D  + + +  ++      +++ H   V    W        
Sbjct: 102 VNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTLTPIIIDAHNIGVNSASWAPATLQEN 161

Query: 116 -DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG 174
              +  E S R  +G  D  V+IWKY     ++ Q + L+  L   HS  V  V+WSP+ 
Sbjct: 162 KPTKSPEESRRFVTGGADNLVKIWKY----NNESQTYLLEDTL-QGHSDWVRDVAWSPSV 216

Query: 175 LIAS---------------------------------------------------TGSDG 183
           L+ S                                                   +G D 
Sbjct: 217 LLRSYIASVSQDKTCIIWTQENNDSSWKKTELQKERFPDVLWRASWSLSGNILALSGGDN 276

Query: 184 LLAIYQEKEEGKWEIIAQHE 203
            + +++E  EG WE   + E
Sbjct: 277 KVTLWKENLEGNWEPAGEVE 296

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 97/223 (43%), Gaps = 41/223 (18%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+  M T LL   EGHE  V++V +  +     +   D S+ +W      E   C+  L 
Sbjct: 38  WDYRMGT-LLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSL----ETNRCLYTLT 92

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA---AVLNGHEGTVWCSDFEK 119
            H   V+ V +HS L  + S+S D T+RIW     +WQ     A L GH   V C+ F +
Sbjct: 93  GHLDYVRTVFFHSELPWVISASDDQTVRIW-----NWQNRKELACLTGHNHFVMCAQFHQ 147

Query: 120 SESSLRLCSGSDDTTVRIWKY-----------IEDNEDDEQVWALQSVLPSA-------- 160
           +E    + S S D TVR+W             +   ED   + + Q++L  A        
Sbjct: 148 TED--LVVSASLDETVRVWDISGLRKKHSAPGVTSYED--SLASQQNLLDGAFGDCKVKF 203

Query: 161 ----HSRAVYSVSWSPT-GLIASTGSDGLLAIYQEKEEGKWEI 198
               H+R V   S+ PT  LI + G D  + +++      WE+
Sbjct: 204 ILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEV 246

>Kwal_56.24596
          Length = 294

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 115/248 (46%), Gaps = 31/248 (12%)

Query: 10  ELLAIVEGHENEVKSVSWSHS--GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +L+  + GHE  V  V W+H   G  LA+CS D  V IW+  E    +  I+V   HS  
Sbjct: 44  KLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK--EENGRWTQIAVHAVHSAS 101

Query: 68  VKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV----WCSDFEK-- 119
           V  V W  H    LL ++S D  + + +  ++      +++ H   V    W S   +  
Sbjct: 102 VNSVQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPILVDAHSIGVNTASWASAALQGG 161

Query: 120 --SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-- 175
             S+   R  +G  D  V++WK+      D   + L+  L   H+  V  V+WSP+ L  
Sbjct: 162 AVSQQMRRFVTGGADNLVKVWKF----NPDANTYLLEDTL-EGHTDWVRDVAWSPSVLLR 216

Query: 176 --IASTGSDGLLAIY-QEKEEGKWE--IIAQHELAHGVYETNVVKWTQIDGETLLVTGGD 230
             +AS   D    I+ QE  +G W+  ++ + + +  ++  +   W+ + G  L ++GGD
Sbjct: 217 SYLASVSQDRTCIIWTQENNQGPWKKTLLKEDKFSDVLWRAS---WS-LSGNILALSGGD 272

Query: 231 DGCVNIWK 238
           +  V +WK
Sbjct: 273 NK-VTLWK 279

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 90/192 (46%), Gaps = 21/192 (10%)

Query: 58  ISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
           +++   H++ +   V       LA+ S D TI+I++   +  +    L+GHEG VW  D+
Sbjct: 2   VTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDW 61

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP---TG 174
              +  + L S S D  V IWK  E+N    Q+ A+ +V    HS +V SV W+P     
Sbjct: 62  AHPKFGVILASCSYDGKVLIWK--EENGRWTQI-AVHAV----HSASVNSVQWAPHEYGP 114

Query: 175 LIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQ--IDGETL------LV 226
           L+ +  SDG +++ + KE G    I     + GV   N   W    + G  +       V
Sbjct: 115 LLLAASSDGKVSVVEFKENGTTSPILVDAHSIGV---NTASWASAALQGGAVSQQMRRFV 171

Query: 227 TGGDDGCVNIWK 238
           TGG D  V +WK
Sbjct: 172 TGGADNLVKVWK 183

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 81/192 (42%), Gaps = 22/192 (11%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++ I   H   +      + G  LATCS DK++ I+E +  GE  + +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLVETLHGHEGPVWQ 58

Query: 71  VVW-HSVLS-LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCS 128
           V W H     +LAS SYD  + IWK+ +  W   AV   H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLA 118

Query: 129 GSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-----------IA 177
            S D  V + ++ E+            +L  AHS  V + SW+   L             
Sbjct: 119 ASSDGKVSVVEFKENG-------TTSPILVDAHSIGVNTASWASAALQGGAVSQQMRRFV 171

Query: 178 STGSDGLLAIYQ 189
           + G+D L+ +++
Sbjct: 172 TGGADNLVKVWK 183

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 64.7 bits (156), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 64/223 (28%), Positives = 99/223 (44%), Gaps = 26/223 (11%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V S S+S    YL + S DK+V +W  D Y      +   + H+  V  V +  +
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSS----LVSYKGHNHPVWDVSFSPL 529

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
               A++S+D T R+W    D      +  GH   V C  F  + +   + +GS D T R
Sbjct: 530 GHYFATASHDQTARLWS--CDHIYPLRIFAGHLNDVDCVSFHPNGTY--VFTGSTDKTCR 585

Query: 137 IWKYIEDNEDDEQVWALQSV-LPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEG 194
           +W           +    SV L   H+  V S + SP G   STGS DG++ ++      
Sbjct: 586 MW----------DIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGK 635

Query: 195 KWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           + + +  H   + VY  +  K    +G T+LV+GG D  V +W
Sbjct: 636 RLKQMRGHG-KNAVYSLSYSK----EG-TVLVSGGADHSVRVW 672

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 20/191 (10%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ +  + L++  +GH + V  VS+S  G+Y AT S D++  +W  D        + +  
Sbjct: 503 WSMDTYSSLVS-YKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCD----HIYPLRIFA 557

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H  DV  V +H   + + + S D T R+W     D     +  GH   V  +    S  
Sbjct: 558 GHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGD--SVRLFLGHTAPVISTAV--SPD 613

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR-AVYSVSWSPTG-LIASTG 180
              L +GS+D  + +W  I   +  +Q+          H + AVYS+S+S  G ++ S G
Sbjct: 614 GRWLSTGSEDGIINVWD-IGTGKRLKQM--------RGHGKNAVYSLSYSKEGTVLVSGG 664

Query: 181 SDGLLAIYQEK 191
           +D  + ++  K
Sbjct: 665 ADHSVRVWDLK 675

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 8/138 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN    ++ +  + GH+  V  V++S  G Y+ + S D S+ +W+    G + + I+  +
Sbjct: 384 WNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRDGKFIATFR 439

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   V  V W S   LL S S D T+++W       +    L GH   V+  D+  S  
Sbjct: 440 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWD--VKTRKLTVDLPGHNDEVYTVDW--SVD 495

Query: 123 SLRLCSGSDDTTVRIWKY 140
             R+CSG  D  VR+W +
Sbjct: 496 GKRVCSGGKDKMVRLWTH 513

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (47%), Gaps = 16/143 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ + +T L  + +GH N V  V+WS  G  +AT S D ++ +W++ E G+       L+
Sbjct: 169 WDCDTQTPLCTL-KGHSNWVLCVAWSADGEVIATGSMDATIRLWDS-EKGQSLG--DALR 224

Query: 63  EHSQ-------DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
            H++       +  H+V       LAS+S D TI+IW        C   L+GH  +V C 
Sbjct: 225 GHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRR--VCIYTLSGHTSSVSCI 282

Query: 116 DFEKSESSLRLCSGSDDTTVRIW 138
            +        L S S D TVR W
Sbjct: 283 KWGGRNV---LYSASHDRTVRCW 302

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 10/82 (12%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
           + ++ + GH  T+ CS F    SS R+ +G+ D T RIW    D +    +  L+     
Sbjct: 132 RSSSAIAGHGATILCSAFAPHTSS-RMVTGAGDNTARIW----DCDTQTPLCTLK----- 181

Query: 160 AHSRAVYSVSWSPTGLIASTGS 181
            HS  V  V+WS  G + +TGS
Sbjct: 182 GHSNWVLCVAWSADGEVIATGS 203

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 104/228 (45%), Gaps = 21/228 (9%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +LLA        + +V++ ++G Y+A+ S +  V I +++      E    LQ H   V 
Sbjct: 203 DLLATQVVSTRPISTVTFCNNGNYVASGSWNGEVSIIDSNT----LEVTQTLQNHDGKVG 258

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            + W S  S+L +   D  I +    D ++  +  + GHEG +  +D +   S   + + 
Sbjct: 259 GIAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRI--TDLQVHPSGKFIGTS 316

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQ 189
           S D+T R+W    D E  +Q+     +L   HS+ +Y +++   G + ST      AI  
Sbjct: 317 SFDSTWRLW----DIEKQKQL-----LLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 190 EKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           +   GK    A  +L         + W+ IDG T L TGG DG + IW
Sbjct: 368 DLRSGK----AVSQLQGHAKTIYCMDWS-IDGHT-LATGGGDGVITIW 409

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 97/209 (46%), Gaps = 24/209 (11%)

Query: 3   WNSEMET------ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFE 56
           WN E+        E+   ++ H+ +V  ++W+ +   L T   D  + +  ++    EF 
Sbjct: 232 WNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITV--SNRSDGEFI 289

Query: 57  CISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLN-GHEGTVWCS 115
             + +  H   +  +  H     + +SS+D T R+W   D + Q   +L  GH   ++C 
Sbjct: 290 TSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLW---DIEKQKQLLLQEGHSKELYCL 346

Query: 116 DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG- 174
            F+ ++ +L   +G+D T + IW    D    + V  LQ      H++ +Y + WS  G 
Sbjct: 347 AFQ-ADGALVSTAGTDKTAI-IW----DLRSGKAVSQLQ-----GHAKTIYCMDWSIDGH 395

Query: 175 LIASTGSDGLLAIYQEKEEGKWEIIAQHE 203
            +A+ G DG++ I+  ++  K   I +H+
Sbjct: 396 TLATGGGDGVITIWDLRKSDKLTKITEHK 424

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 9/128 (7%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           ++GH   +  + WS  G+ LAT   D  + IW+      + + ++ + EH   V  + + 
Sbjct: 378 LQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDL----RKSDKLTKITEHKSIVTSLKFD 433

Query: 75  SVLS-LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
                 L SS YD +I ++    D++   + L GH   V   D +K+  +  L SG  D 
Sbjct: 434 KANDHNLISSGYDRSIFVYS--KDNYLKVSSLIGHADKVLTFDIDKNNKN--LISGGWDR 489

Query: 134 TVRIWKYI 141
           +V+ W  +
Sbjct: 490 SVKHWSTV 497

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 102/247 (41%), Gaps = 26/247 (10%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++ I   H + +      + G  LATCS DK++ I+E +  GE  + +  L  H   V  
Sbjct: 1   MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWR 58

Query: 71  VVW-HSVL-SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCS 128
           V W H    ++LAS SYD  + IWK+ +D W   AV   H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLA 118

Query: 129 GSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL------------- 175
            S D  V + ++ E+      ++        AH+  V + SW+P  +             
Sbjct: 119 ASSDGKVSVVEFKENGTATPLIF-------DAHAIGVNAASWAPATVEGGNNPGEAPKEV 171

Query: 176 --IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGC 233
               + G+D L+ I++   E +  ++      H  +  +V     +   + + +   D  
Sbjct: 172 RRFVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSVLLRSYIASVSQDRT 231

Query: 234 VNIWKNE 240
            NIW  E
Sbjct: 232 CNIWTQE 238

 Score = 60.8 bits (146), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 111/252 (44%), Gaps = 35/252 (13%)

Query: 10  ELLAIVEGHENEVKSVSWSHS--GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +L+  + GHE  V  V W+H   G  LA+CS D  V IW+  E  + +  I+V   H+  
Sbjct: 44  KLVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWK--EENDRWSQIAVHAVHTAS 101

Query: 68  VKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF-------- 117
           V  V W  H   +LL ++S D  + + +  ++      + + H   V  + +        
Sbjct: 102 VNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTATPLIFDAHAIGVNAASWAPATVEGG 161

Query: 118 ----EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT 173
               E  +   R  +G  D  V+IW+Y      + Q + ++  L   HS  V  V+WSP+
Sbjct: 162 NNPGEAPKEVRRFVTGGADNLVKIWRY----NPETQSYLVEDTL-EGHSDWVRDVAWSPS 216

Query: 174 GL----IASTGSDGLLAIY-QEKEEGKW--EIIAQHELAHGVYETNVVKWTQIDGETLLV 226
            L    IAS   D    I+ QE   G W    +   E    ++  +   W+ + G  L +
Sbjct: 217 VLLRSYIASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRAS---WS-LSGNILAI 272

Query: 227 TGGDDGCVNIWK 238
           +GGD+  V +WK
Sbjct: 273 SGGDNK-VTLWK 283

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 85/182 (46%), Gaps = 20/182 (10%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + V+  + +H G Y  + S DK++ +W+     +  +CI     H  DV  V    
Sbjct: 78  KGHSHIVQDCTVTHDGKYALSASWDKTLRLWDL----QSGKCIKRFVGHKSDVMSVSIDP 133

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE---GTVWCSDFEKSESSLRLCSGSDD 132
             + + S+S D T+++W    D   C   L GH      V  +  EKS+ ++ + S   D
Sbjct: 134 RATQIVSASRDKTVKVWNTVGD---CVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMD 190

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAIYQEK 191
             V++W        D Q + +++     H+  V +V+ SP G + AS G DG + ++   
Sbjct: 191 KVVKVW--------DLQSFTIEADF-IGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

Query: 192 EE 193
           E+
Sbjct: 242 EK 243

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 110/260 (42%), Gaps = 42/260 (16%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+  M T LL   E HE  V+ + +  +     +   D ++ +W  D      +C+  L 
Sbjct: 38  WDYRMGT-LLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTN----KCLYTLT 92

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA---AVLNGHEGTVWCSDFEK 119
            H   V+ V +H  L  + S+S D TIRIW     +WQ     A L GH   V C+ F  
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIW-----NWQNRKEIACLTGHNHFVMCAQFHP 147

Query: 120 SESSLRLCSGSDDTTVRIW---------KYIEDNEDDEQVWALQSVLPSA---------- 160
           ++    + S S D T+RIW              +  +EQ+ A Q++L  +          
Sbjct: 148 TDD--LIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFIL 205

Query: 161 --HSRAVYSVSWSPT-GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWT 217
             H+R V   S+ PT  LI S   D  + +++      WE+    +   G +  NV    
Sbjct: 206 EGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEV----DTCRG-HTNNVDSVI 260

Query: 218 QIDGETLLVTGGDDGCVNIW 237
               + L+++ G+D  + +W
Sbjct: 261 FHPHQNLIISVGEDKTLRVW 280

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 103/252 (40%), Gaps = 41/252 (16%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           LL   E HE  V+ V +  +     +   D S+ +W    +    +C+  L  H   V+ 
Sbjct: 45  LLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTH----KCLFTLNGHLDYVRT 100

Query: 71  VVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA---AVLNGHEGTVWCSDFEKSESSLRLC 127
           V +H+ L  + S+S D TIRIW     +WQ     A L GH   V C+ F  +E    + 
Sbjct: 101 VFFHTELPWIISASDDQTIRIW-----NWQNRREIACLTGHNHFVMCAQFHPTED--LVV 153

Query: 128 SGSDDTTVRIW---------KYIEDNEDDEQVWALQSVLPS------------AHSRAVY 166
           S S D TVRIW                 +EQ+   Q++                H+R V 
Sbjct: 154 SASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVN 213

Query: 167 SVSWSPT-GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLL 225
             S+ PT  LI S   D  + +++      WE+    +   G +  NV        + L+
Sbjct: 214 WASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEV----DTCRG-HTNNVDSVIFHPFQNLI 268

Query: 226 VTGGDDGCVNIW 237
           ++ G+D  + +W
Sbjct: 269 ISVGEDSTIRVW 280

>Kwal_23.6324
          Length = 514

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 8/138 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+    ++ +  + GH+  V  V++S  G Y+ + S D S+ +W+    G     I+  +
Sbjct: 385 WDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRNGTFIATFR 440

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   V  V W S   LL S S D T+++W       + +  L GH   V+  D+  S  
Sbjct: 441 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK--KLSVDLPGHNDEVYTVDW--SVD 496

Query: 123 SLRLCSGSDDTTVRIWKY 140
             R+CS   D  VRIW +
Sbjct: 497 GKRVCSAGKDKMVRIWTH 514

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 22/146 (15%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE---YGEEFECIS 59
           W+    T +  + +GH N V  V+W   G  +AT S D ++ +W++++   YGE      
Sbjct: 170 WDCNTNTPMYTL-KGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGE------ 222

Query: 60  VLQEHSQ-------DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV 112
            L+ H++       +  H+V       LAS+S D TI+IW        C   L+GH  +V
Sbjct: 223 ALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRR--VCVLTLSGHTNSV 280

Query: 113 WCSDFEKSESSLRLCSGSDDTTVRIW 138
            C  +        L SGS D T+R W
Sbjct: 281 SCVKWGGRGI---LYSGSHDKTIRAW 303

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 76/189 (40%), Gaps = 24/189 (12%)

Query: 15  VEGHENEVKSVSWS-HSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           + GH + +   +++ H+   + T S D +  IW+ +     +     L+ H   V  V W
Sbjct: 138 IAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMY----TLKGHFNWVLCVAW 193

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFE-------KSESSLRL 126
                L+A+ S D+TIR+W D +        L GH    W +          K+    RL
Sbjct: 194 CPDGELIATGSMDNTIRLW-DSNKGESYGEALRGHAK--WITSLTWEPMHLVKAGDQPRL 250

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186
            S S D T++IW    D      V  L     S H+ +V  V W   G++ S   D  + 
Sbjct: 251 ASASKDGTIKIW----DTTRRVCVLTL-----SGHTNSVSCVKWGGRGILYSGSHDKTIR 301

Query: 187 IYQEKEEGK 195
            +     GK
Sbjct: 302 AWDMAAGGK 310

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 64/143 (44%), Gaps = 18/143 (12%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
           + ++ + GH  T+ CS F    +S R+ +GS D T RIW    D   +  ++ L+     
Sbjct: 133 RSSSAIAGHGSTILCSAFA-PHTSGRMVTGSGDNTARIW----DCNTNTPMYTLK----- 182

Query: 160 AHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNV----V 214
            H   V  V+W P G + +TGS D  + ++   +  K E   +    H  + T++    +
Sbjct: 183 GHFNWVLCVAWCPDGELIATGSMDNTIRLW---DSNKGESYGEALRGHAKWITSLTWEPM 239

Query: 215 KWTQIDGETLLVTGGDDGCVNIW 237
              +   +  L +   DG + IW
Sbjct: 240 HLVKAGDQPRLASASKDGTIKIW 262

>Scas_624.11
          Length = 1205

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 88/204 (43%), Gaps = 36/204 (17%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+  M T LL   E HE  V+SV +  +     +   D ++ +W      E  +C+  L 
Sbjct: 38  WDYRMGT-LLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSL----ETNKCLYTLN 92

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA---AVLNGHEGTVWCSDFEK 119
            H   ++ V +H  L  + S+S D TIRIW     +WQ     A L GH   V C+ F  
Sbjct: 93  GHLDYIRTVFFHKELPWIISASDDQTIRIW-----NWQNRKEIACLTGHNHFVMCAQFHP 147

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNED---------DEQVWALQSVLPS----------- 159
           ++    + S S D T+R+W      +          D+Q+ A Q++L             
Sbjct: 148 TDD--LVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFIL 205

Query: 160 -AHSRAVYSVSWSPTGLIASTGSD 182
             H+R V   S+ PT  +  +GSD
Sbjct: 206 EGHTRGVNWASFHPTLPMIVSGSD 229

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 103/252 (40%), Gaps = 41/252 (16%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           LL   E HE  V+ + +  +     +   D ++ +W      E  +C+  L  H   V+ 
Sbjct: 45  LLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSL----ESNKCLFTLDGHLDYVRT 100

Query: 71  VVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA---AVLNGHEGTVWCSDFEKSESSLRLC 127
           V +H  L  + SSS D TIRIW     +WQ     A L GH   V C+ F   E    + 
Sbjct: 101 VFFHHELPWIISSSDDQTIRIW-----NWQNRKEIACLTGHNHFVMCAQFHPVED--LVV 153

Query: 128 SGSDDTTVRIWKYIEDNED---------DEQVWALQSVLPS------------AHSRAVY 166
           S S D TVR+W      +          +EQ+   Q++L               H+R V 
Sbjct: 154 SASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVN 213

Query: 167 SVSWSPT-GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLL 225
             S+ PT  LI S   D  + +++      WE+    +   G +  NV        + L+
Sbjct: 214 WASFHPTLPLIVSGSDDRQVKLWRMSATKAWEV----DTCRG-HTNNVDSVIFHPQQNLI 268

Query: 226 VTGGDDGCVNIW 237
           ++ G+D  V +W
Sbjct: 269 ISVGEDKTVRVW 280

>Scas_721.32
          Length = 822

 Score = 59.3 bits (142), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 95/222 (42%), Gaps = 24/222 (10%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V S S+S    YL + S DK+V +W  D Y      +   + H+  V  V +  +
Sbjct: 547 GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTY----TSLVSYKGHNHPVWDVQFSPL 602

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
               A++S+D T R+W    D      +  GH   V C  F    +   + +GS D T R
Sbjct: 603 GHYFATASHDQTARLWS--CDHIYPLRIFAGHLSDVDCVSFHP--NGCYVFTGSSDKTCR 658

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGK 195
           +W    D    + V      L   H+  V   + SP G   +TGS DG++ ++      +
Sbjct: 659 MW----DISTGDSV-----RLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKR 709

Query: 196 WEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            +++  H   + ++  +  K   +     LV+GG D  V +W
Sbjct: 710 LKVMRGHG-KNAIHSLSYCKEGNV-----LVSGGADHSVRVW 745

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 18/191 (9%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+++  T L++  +GH + V  V +S  G+Y AT S D++  +W  D        + +  
Sbjct: 576 WSTDTYTSLVS-YKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCD----HIYPLRIFA 630

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H  DV  V +H     + + S D T R+W     D     +  GH   V C+    S  
Sbjct: 631 GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD--SVRLFLGHTAPVLCTAV--SPD 686

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGS 181
              L +GS+D  + +W        D        V+      A++S+S+   G ++ S G+
Sbjct: 687 GRWLATGSEDGIINLW--------DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGA 738

Query: 182 DGLLAIYQEKE 192
           D  + ++  K+
Sbjct: 739 DHSVRVWDLKK 749

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 58.9 bits (141), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 25/226 (11%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           +I   HE ++  + W   G +L +   D  V +W  D     FE    L+ H+  V  V 
Sbjct: 209 SIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLW--DMTSNSFE---ELRGHAGRVSRVK 263

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
            H    L AS+S+D T  +W D +   +   +  GH   V+   F+ S+ +L L S   D
Sbjct: 264 VHPSGRLAASASFDLTWILW-DLERKVEL-QLQEGHSKAVYTIAFQ-SDGAL-LASAGLD 319

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIYQEK 191
               IW    D    E +  L+      H+ A+  V WSP G  +A+ G+DG + ++  +
Sbjct: 320 AVCAIW----DLRSGEPIMKLE-----GHAGAISGVDWSPNGYQLATAGADGTVRVWDIR 370

Query: 192 EEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
             G    +  H++A        VK+ + +G T LV+ G D  VNI+
Sbjct: 371 NVGTESALLAHQVA-----ALDVKFKKNNG-TFLVSCGHDRLVNIF 410

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           E +  +EGH   +  V WS +GY LAT   D +V +W+    G E   ++  Q  + DVK
Sbjct: 331 EPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVAALDVK 389

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
               +   + L S  +D  + I+    D+WQ  A L GH   V+  D  +  S+  + SG
Sbjct: 390 FKKNNG--TFLVSCGHDRLVNIFN--ADNWQKLASLEGHTDRVFTVDITEDGST--IYSG 443

Query: 130 SDDTTVRIW 138
             D +++ W
Sbjct: 444 GKDRSLKQW 452

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 95/227 (41%), Gaps = 30/227 (13%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           + GH   V  V    SG   A+ S D +  +W+ +   E    + + + HS+ V  + + 
Sbjct: 252 LRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVE----LQLQEGHSKAVYTIAFQ 307

Query: 75  SVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTT 134
           S  +LLAS+  D    IW D     +    L GH G +   D+  S +  +L +   D T
Sbjct: 308 SDGALLASAGLDAVCAIW-DL-RSGEPIMKLEGHAGAISGVDW--SPNGYQLATAGADGT 363

Query: 135 VRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG--LIASTGSDGLLAIYQEKE 192
           VR+W       D   V    ++L  AH  A   V +       + S G D L+ I+    
Sbjct: 364 VRVW-------DIRNVGTESALL--AHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNAD- 413

Query: 193 EGKWEIIAQHELAH--GVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
              W+ +A  E  H   V+  ++ +    DG T + +GG D  +  W
Sbjct: 414 --NWQKLASLE-GHTDRVFTVDITE----DGST-IYSGGKDRSLKQW 452

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 20/184 (10%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           + W+ E + EL  + EGH   V ++++   G  LA+   D    IW+        E I  
Sbjct: 281 ILWDLERKVEL-QLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL----RSGEPIMK 335

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
           L+ H+  +  V W      LA++  D T+R+W D  +    +A+L  H+       F+K+
Sbjct: 336 LEGHAGAISGVDWSPNGYQLATAGADGTVRVW-DIRNVGTESALL-AHQVAALDVKFKKN 393

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDD-EQVWALQSVLPSAHSRAVYSVSWSPTG-LIAS 178
             +  L S   D  V I+     N D+ +++ +L+      H+  V++V  +  G  I S
Sbjct: 394 NGTF-LVSCGHDRLVNIF-----NADNWQKLASLE-----GHTDRVFTVDITEDGSTIYS 442

Query: 179 TGSD 182
            G D
Sbjct: 443 GGKD 446

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 100/242 (41%), Gaps = 67/242 (27%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
           + N E    LL  + GHE  +  V +  SG ++ + S D +  +W+A  + E        
Sbjct: 248 YSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQE-------- 299

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
                            LL    +D  +     F   +QC   L                
Sbjct: 300 -----------------LLLQEGHDKGV-----FSLSFQCDGSL---------------- 321

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTG 180
               +CSG  D+   +W    D     +V  L     + HS+ +Y+V+WSP G  +A+ G
Sbjct: 322 ----VCSGGMDSLSMLW----DIRSGSKVMTL-----AGHSKPIYTVAWSPNGYQVATGG 368

Query: 181 SDGLLAI--YQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
            DG++ +   ++++EG+   I    LAH    T  V++++ DG   LV+ G D  +N++ 
Sbjct: 369 GDGIINVWDIRKRDEGQLNQI----LAHRNIVTQ-VRFSKEDGGKKLVSCGYDNLINVYS 423

Query: 239 NE 240
           ++
Sbjct: 424 SD 425

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 58.2 bits (139), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 113/256 (44%), Gaps = 39/256 (15%)

Query: 10  ELLAIVEGHENEVKSVSWSHS--GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +L+  ++GHE  V  V W+H   G  LA+CS D  V IW+  E    +  I+  + HS  
Sbjct: 44  KLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK--EVNGRWSQIAAHEVHSAS 101

Query: 68  VKHVVW--HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGH----EGTVWCSDFEKSE 121
           V  + W  H    LL ++S D  + + +  ++      +++ H        W     + +
Sbjct: 102 VNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQ 161

Query: 122 SS------------LRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVS 169
           S+             R  +G  D  V+IWKY      D   + L+  L   HS  V  V+
Sbjct: 162 SNQGTSGSASPQQVRRFVTGGADNLVKIWKY----NSDAATYLLEHTL-EGHSDWVRDVA 216

Query: 170 WSPTGL----IASTGSDGLLAIY-QEKEEGKWE--IIAQHELAHGVYETNVVKWTQIDGE 222
           WSPT L    +AS   D    I+ Q+ +E  W+  ++ + +    ++  +   W+ + G 
Sbjct: 217 WSPTVLSRSYLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRAS---WS-LSGN 272

Query: 223 TLLVTGGDDGCVNIWK 238
            L ++ GD+  V +WK
Sbjct: 273 ILALSCGDN-TVTLWK 287

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 87/232 (37%), Gaps = 45/232 (19%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++ I   H   +      + G  LATCS D +V I+E +  GE  + +  LQ H   V  
Sbjct: 1   MVTINNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVE--GETHKLVDTLQGHEGPVWQ 58

Query: 71  VVW-HSVLS-LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCS 128
           V W H     +LAS SYD  + IWK+ +  W   A    H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLA 118

Query: 129 GSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL--IASTGSDGLLA 186
            S D  V + ++ E+            ++  AHS    +  W+P  L   ++ G+ G  +
Sbjct: 119 ASSDGKVSVVEFKENG-------TTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSAS 171

Query: 187 IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
             Q +                                  VTGG D  V IWK
Sbjct: 172 PQQVRR--------------------------------FVTGGADNLVKIWK 191

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 95/222 (42%), Gaps = 24/222 (10%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V S S+S    YL + S DK+V +W  D +      +   + H+  V  V +  +
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTH----TALVSYKGHNHPVWDVSFSPL 578

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
               A++S+D T R+W    D      +  GH   V C  F    +   + +GS D T R
Sbjct: 579 GHYFATASHDQTARLWS--CDHIYPLRIFAGHLNDVDCVSFHP--NGCYVFTGSSDKTCR 634

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGK 195
           +W    D    + V      L   H+  V S++  P G   STGS DG++ ++      +
Sbjct: 635 MW----DVSTGDSV-----RLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKR 685

Query: 196 WEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            + +  H   + +Y  +  K   +     L++GG D  V +W
Sbjct: 686 LKQMRGHG-KNAIYSLSYSKEGNV-----LISGGADHTVRVW 721

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 87/196 (44%), Gaps = 28/196 (14%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ +  T L++  +GH + V  VS+S  G+Y AT S D++  +W  D        + +  
Sbjct: 552 WSMDTHTALVS-YKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCD----HIYPLRIFA 606

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW----CSDFE 118
            H  DV  V +H     + + S D T R+W     D     +  GH   V     C D  
Sbjct: 607 GHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD--SVRLFLGHTAPVISIAVCPD-- 662

Query: 119 KSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR-AVYSVSWSPTG-LI 176
                  L +GS+D  + +W  I   +  +Q+          H + A+YS+S+S  G ++
Sbjct: 663 ----GRWLSTGSEDGIINVWD-IGTGKRLKQM--------RGHGKNAIYSLSYSKEGNVL 709

Query: 177 ASTGSDGLLAIYQEKE 192
            S G+D  + ++  K+
Sbjct: 710 ISGGADHTVRVWDLKK 725

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 62/141 (43%), Gaps = 28/141 (19%)

Query: 57  CISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWK----------------DFDDDWQ 100
           C+   Q  ++D+  + +     + A+   D  I+IW                 D D+D  
Sbjct: 458 CMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPT 517

Query: 101 CAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSA 160
           C  ++ GH GTV+ + F  S  +  L SGS+D TVR+W         +   AL S     
Sbjct: 518 CKTLV-GHSGTVYSTSF--SPDNKYLLSGSEDKTVRLWSM-------DTHTALVSY--KG 565

Query: 161 HSRAVYSVSWSPTGLIASTGS 181
           H+  V+ VS+SP G   +T S
Sbjct: 566 HNHPVWDVSFSPLGHYFATAS 586

>Scas_721.115*
          Length = 318

 Score = 58.2 bits (139), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 92/202 (45%), Gaps = 21/202 (10%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + V+  + +  G Y  + S DK++ +W+    GE ++       H  DV  V    
Sbjct: 62  KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVAIDR 117

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE---GTVWCSDFEKSESSLRLCSGSDD 132
             S++ S S D TI++W       QC A L GH      V  +  ++++ S+ + S  +D
Sbjct: 118 KASMIISGSRDKTIKVWT---IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGND 174

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAIYQEK 191
             V+ W   +   + + V          H+  V +V+ SP G LIAS G DG + ++   
Sbjct: 175 KMVKAWNLNQFQIEADFV---------GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 192 E-EGKWEIIAQHELAHGVYETN 212
           E +  + + AQ E+    +  N
Sbjct: 226 EKKAMYTLSAQDEVFALAFSPN 247

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 111/266 (41%), Gaps = 44/266 (16%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L   + GH   V+ V+ S    YL + S DK+V  W+     E+ + I     H   V+
Sbjct: 173 KLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDL----EKNQIIRDYYGHLSGVR 228

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAV-LNGHEGTVWCSDFEKSESSLRLCS 128
            V  H  L L+A++  D  I++W   D   +   + L GH+G +  +  + +    ++ S
Sbjct: 229 TVSIHPTLDLIATAGRDSVIKLW---DMRTRIPVITLVGHKGPI--NQVQCTPVDPQVVS 283

Query: 129 GSDDTTVRIWKYIEDN----------------------------EDDEQVWALQ--SVLP 158
            S D TVR+W  +                                DD + W L   S+L 
Sbjct: 284 SSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLT 343

Query: 159 SAHSRA---VYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVK 215
           +  S     + ++S +   ++ + G +G+L+ Y  K   K++ +A  E+   +     V 
Sbjct: 344 NFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVL 403

Query: 216 WTQIDGETL-LVTGGDDGCVNIWKNE 240
            +  D   L L+TG  D  + IWK +
Sbjct: 404 CSTFDKTGLRLITGEADKSIKIWKQD 429

 Score = 32.0 bits (71), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 68/185 (36%), Gaps = 56/185 (30%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+      ++ +V GH+  +  V  +     + + S D +V +W+        + + VL 
Sbjct: 251 WDMRTRIPVITLV-GHKGPINQVQCTPVDPQVVSSSTDATVRLWDV----VAGKTMKVLT 305

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIW--------KDFD--------------DDWQ 100
            H + V+    H     +AS+  DD IR W         +F+              DD  
Sbjct: 306 HHKRSVRATALHPKEFSVASACTDD-IRSWGLAEGSLLTNFESEKTGIINTLSINQDDVL 364

Query: 101 CAAVLNG--------------------------HEGTVWCSDFEKSESSLRLCSGSDDTT 134
            A   NG                           E +V CS F+K+   LRL +G  D +
Sbjct: 365 FAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKT--GLRLITGEADKS 422

Query: 135 VRIWK 139
           ++IWK
Sbjct: 423 IKIWK 427

 Score = 31.6 bits (70), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 71/173 (41%), Gaps = 42/173 (24%)

Query: 99  WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW-------------------- 138
           W+ + V+NGH G V C   +  ++     +GS+DTT+++W                    
Sbjct: 129 WKLSRVINGHLGWVRCVAIDPVDNEW-FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRD 187

Query: 139 -------KYIEDNEDDEQV--WALQS--VLPS--AHSRAVYSVSWSPT-GLIASTGSDGL 184
                   Y+    +D+ V  W L+   ++     H   V +VS  PT  LIA+ G D +
Sbjct: 188 VAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSV 247

Query: 185 LAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           + ++  +       +  H+        N V+ T +D +  +V+   D  V +W
Sbjct: 248 IKLWDMRTRIPVITLVGHK-----GPINQVQCTPVDPQ--VVSSSTDATVRLW 293

>Kwal_27.12053
          Length = 755

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 93/222 (41%), Gaps = 24/222 (10%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V S S+S    YL + S DK+V +W  D Y      +   + H+  +  V +  +
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTY----TSLVNYKGHNHPIWDVAFSPL 535

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
               A++S+D T R+W    D      +  GH   V    F  + +   + +GS D T R
Sbjct: 536 GHYFATASHDQTARLWS--CDHIYPLRIFAGHLNDVDTVSFHPNGT--YVFTGSSDKTCR 591

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGK 195
           +W     +            L   H+  V S + SP G   STGS DG++ ++      +
Sbjct: 592 MWDITSGD---------SVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKR 642

Query: 196 WEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            + +  H   + VY  +  K   +     L++GG D  V +W
Sbjct: 643 LKQMRGHG-KNAVYSLSYSKEGHV-----LISGGADHSVRVW 678

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 88/192 (45%), Gaps = 20/192 (10%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+++  T L+   +GH + +  V++S  G+Y AT S D++  +W  D        + +  
Sbjct: 509 WSTDTYTSLVN-YKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCD----HIYPLRIFA 563

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H  DV  V +H   + + + S D T R+W     D     +  GH   V  +    S  
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGD--SVRLFLGHTAPV--TSTAVSPD 619

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR-AVYSVSWSPTG-LIASTG 180
              L +GS+D  + +W  I   +  +Q+          H + AVYS+S+S  G ++ S G
Sbjct: 620 GRWLSTGSEDGVINVWD-IGTGKRLKQM--------RGHGKNAVYSLSYSKEGHVLISGG 670

Query: 181 SDGLLAIYQEKE 192
           +D  + ++  K+
Sbjct: 671 ADHSVRVWDVKK 682

>Scas_592.4*
          Length = 318

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 92/202 (45%), Gaps = 21/202 (10%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + V+  + +  G Y  + S DK++ +W+    GE ++       H  DV  V    
Sbjct: 62  KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVAIDR 117

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE---GTVWCSDFEKSESSLRLCSGSDD 132
             S++ S S D TI++W       QC A L GH      V  +  ++++ ++ + S  +D
Sbjct: 118 KASMIISGSRDKTIKVWT---IKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGND 174

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAIYQEK 191
             V+ W   +   + + V          H+  V +V+ SP G LIAS G DG + ++   
Sbjct: 175 KMVKAWNLNQFQIEADFV---------GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 192 E-EGKWEIIAQHELAHGVYETN 212
           E +  + + AQ E+    +  N
Sbjct: 226 EKKAMYTLSAQDEVFSLAFSPN 247

 Score = 34.7 bits (78), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 71/176 (40%), Gaps = 34/176 (19%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+++V SV+       + + SRDK++ +W       + +C++ L  H+       W S 
Sbjct: 105 GHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-----KGQCLATLLGHND------WVSQ 153

Query: 77  LSLLASSSYDDTIRIWKDFDD---------DWQCAAVLNGHEGTVWCSDFEKSESSLRLC 127
           + +  +   DD + +    +D          +Q  A   GH G V  +    S     + 
Sbjct: 154 VRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNV--NAVTASPDGTLIA 211

Query: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG--LIASTGS 181
           S   D  + +W   E           +++   +    V+S+++SP    L A+T S
Sbjct: 212 SAGKDGEIMLWNLAEK----------KAMYTLSAQDEVFSLAFSPNRYWLAAATAS 257

>Kwal_23.6429
          Length = 750

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 63/225 (28%), Positives = 101/225 (44%), Gaps = 22/225 (9%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++SV +S  G +LAT + DK + IW+          +  LQ H QD+  + +      L 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATR----RIVMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYI 141
           S S D T+RIW D     QC+  L+  +G    +     +  L + +GS D TVRIW   
Sbjct: 529 SGSGDRTVRIW-DLRTG-QCSLTLSIEDGVTTVA-VSPGDGKL-IAAGSLDRTVRIW--- 581

Query: 142 EDNEDDEQVWALQS--VLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKE------ 192
            D+E    V  L S   L + H  +VYSV ++  G    +GS D  + ++  +       
Sbjct: 582 -DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTA 640

Query: 193 EGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           EGK    A  E+ +  ++  V+       +  +++G  D  V  W
Sbjct: 641 EGKANTAAS-EVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFW 684

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/136 (25%), Positives = 61/136 (44%), Gaps = 17/136 (12%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           ++  ++GHE ++ S+ +  SG  L + S D++V IW+        +C   L         
Sbjct: 504 IVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTV 559

Query: 71  VVWHSVLSLLASSSYDDTIRIW--------KDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            V      L+A+ S D T+RIW        +  D + +      GH+ +V+   F +   
Sbjct: 560 AVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELG---TGHKDSVYSVVFTRDGH 616

Query: 123 SLRLCSGSDDTTVRIW 138
              + SGS D +V++W
Sbjct: 617 G--VVSGSLDRSVKLW 630

 Score = 31.2 bits (69), Expect = 0.72,   Method: Composition-based stats.
 Identities = 35/144 (24%), Positives = 56/144 (38%), Gaps = 14/144 (9%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIW---EADEYGEEFECISVLQE-----HSQDV 68
           GH++ V SV ++  G+ + + S D+SV +W    A+    E +  +   E     H   V
Sbjct: 601 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFV 660

Query: 69  KHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW----CSDFEKSESSL 124
             V        + S S D  +  W     +     +L GH  +V      +D        
Sbjct: 661 LSVATTQNDEFILSGSKDRGVLFWDTPSGN--PLLMLQGHRNSVISVAVANDHPLGPEYG 718

Query: 125 RLCSGSDDTTVRIWKYIEDNEDDE 148
              +GS D   RIWKY +   + E
Sbjct: 719 VFATGSGDCKARIWKYSKQTSNAE 742

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 79/164 (48%), Gaps = 18/164 (10%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++SV +S  G YLAT + DK + IW+        + +  LQ H QD+  + +      L 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTK----KILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEG--TVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           S S D T+RIW D     QC+  L+  +G  TV  S  +       + +GS D TVR+W 
Sbjct: 411 SGSGDRTVRIW-DL-RTGQCSLTLSIEDGVTTVAVSPGDGK----YIAAGSLDRTVRVW- 463

Query: 140 YIEDNEDDEQVWALQS--VLPSAHSRAVYSVSWSPTGLIASTGS 181
              D+E    V  L S   L + H  +VYSV ++  G    +GS
Sbjct: 464 ---DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGS 504

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 62/137 (45%), Gaps = 17/137 (12%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           ++L  ++GHE ++ S+ +  +G  L + S D++V IW+        +C   L        
Sbjct: 385 KILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTT 440

Query: 70  HVVWHSVLSLLASSSYDDTIRIW--------KDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
             V       +A+ S D T+R+W        +  D + + +    GH+ +V+   F +  
Sbjct: 441 VAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELS---TGHKDSVYSVVFTRDG 497

Query: 122 SSLRLCSGSDDTTVRIW 138
               + SGS D +V++W
Sbjct: 498 QG--VISGSLDRSVKLW 512

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 4/91 (4%)

Query: 48  ADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNG 107
           AD  GE    I         ++ V +      LA+ + D  IRIW D     +    L G
Sbjct: 335 ADNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIW-DLTTK-KILMTLQG 392

Query: 108 HEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           HE  ++  D+  +    +L SGS D TVRIW
Sbjct: 393 HEQDIYSLDYFPAGD--KLVSGSGDRTVRIW 421

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 53/145 (36%), Gaps = 9/145 (6%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEE---FECISVLQEHSQDVKHVVW 73
           GH++ V SV ++  G  + + S D+SV +W+      +     C      H   V  V  
Sbjct: 483 GHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT 542

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW----CSDFEKSESSLRLCSG 129
                 + S S D  +  W     +     +L GH  +V      + F          +G
Sbjct: 543 TQDDEYILSGSKDRGVLFWDTASGNPLL--MLQGHRNSVISVAVVNGFPLGPDVGVFATG 600

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQ 154
           S D   RIWKY + +        LQ
Sbjct: 601 SGDCKARIWKYTKKSNPTATGAKLQ 625

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 63/223 (28%), Positives = 95/223 (42%), Gaps = 26/223 (11%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V S S+S    YL + S DK+V +W  D +      +   + H+  V  V +  +
Sbjct: 531 GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTH----TALVNYKGHNHPVWDVKFSPL 586

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
               AS+S+D T R+W    D      +  GH   V    F    +   + +GS D T R
Sbjct: 587 GHYFASASHDQTARLWA--CDHIYPLRIFAGHTNDVDTVSFHP--NGCYVFTGSSDKTCR 642

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGK 195
           +W    D    + V      L   H+  V S   SP G   +TGS DG++ ++   + G 
Sbjct: 643 MW----DVSTGDSV-----RLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLW---DIGT 690

Query: 196 WEIIAQHELAHGVYETNVVKWTQIDGE-TLLVTGGDDGCVNIW 237
            + I Q    HG    N V     + E  +L++GG D  V +W
Sbjct: 691 GKRIKQMR-GHG---KNAVHSLSFNKEGNVLISGGADHSVRVW 729

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 9/136 (6%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ +  T L+   +GH + V  V +S  G+Y A+ S D++  +W  D        + +  
Sbjct: 560 WSMDTHTALVN-YKGHNHPVWDVKFSPLGHYFASASHDQTARLWACD----HIYPLRIFA 614

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H+ DV  V +H     + + S D T R+W     D     +  GH   V  +  + S  
Sbjct: 615 GHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGD--SVRLFLGHTAPVLST--QVSPD 670

Query: 123 SLRLCSGSDDTTVRIW 138
              L +GS+D  + +W
Sbjct: 671 GRWLATGSEDGVICLW 686

 Score = 36.6 bits (83), Expect = 0.014,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 7/127 (5%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           L I  GH N+V +VS+  +G Y+ T S DK+  +W+        + + +   H+  V   
Sbjct: 610 LRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV----STGDSVRLFLGHTAPVLST 665

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
                   LA+ S D  I +W D     +   +    +  V    F K  +   L SG  
Sbjct: 666 QVSPDGRWLATGSEDGVICLW-DIGTGKRIKQMRGHGKNAVHSLSFNKEGNV--LISGGA 722

Query: 132 DTTVRIW 138
           D +VR+W
Sbjct: 723 DHSVRVW 729

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 4   NSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE 63
           N+E ET   A  + +   ++SV +S  G +LAT + DK + IW+     E+ + + VL+ 
Sbjct: 543 NAEAETSAGATTDLY---IRSVCFSPDGKFLATGAEDKLIRIWDI----EQKKIVMVLKG 595

Query: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEG--TVWCSDFEKSE 121
           H QD+  + +      L S S D T+RIW D     QC   L+  +G  TV  S  +   
Sbjct: 596 HEQDIYSLDYFPSGDKLVSGSGDRTVRIW-DLKTG-QCTLTLSIEDGVTTVAVSPGDGK- 652

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQS--VLPSAHSRAVYSVSWSPTGLIAST 179
               + +GS D  VR+W    D++    V  L S   L + H  +VYSV ++  G    +
Sbjct: 653 ---FIAAGSLDRAVRVW----DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVS 705

Query: 180 GS 181
           GS
Sbjct: 706 GS 707

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 103/251 (41%), Gaps = 29/251 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ E + +++ +++GHE ++ S+ +  SG  L + S D++V IW+     +  +C   L 
Sbjct: 582 WDIE-QKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL----KTGQCTLTLS 636

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLN------GHEGTVWCSD 116
                    V       +A+ S D  +R+W D D  +    + +      GH+ +V+   
Sbjct: 637 IEDGVTTVAVSPGDGKFIAAGSLDRAVRVW-DSDTGFLVERLDSENELGTGHKDSVYSVV 695

Query: 117 FEKSESSLRLCSGSDDTTVRIWKYI---EDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT 173
           F +  +   + SGS D +V++W       +N D +       V  + H   V SV+ +  
Sbjct: 696 FTRDGNG--VVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTED 753

Query: 174 GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETL------LVT 227
                +GS     ++ +K  G   ++ Q       +  +V+      G  L        T
Sbjct: 754 DEYILSGSKDRGVLFWDKVSGNPLLMLQG------HRNSVISVAVNHGHPLGPNYHIFAT 807

Query: 228 GGDDGCVNIWK 238
           G  D    IWK
Sbjct: 808 GSGDCKARIWK 818

 Score = 32.0 bits (71), Expect = 0.43,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 50/138 (36%), Gaps = 14/138 (10%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWE--------ADEYGEEFECISVLQEHSQDV 68
           GH++ V SV ++  G  + + S D+SV +W         AD       C      H   V
Sbjct: 686 GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFV 745

Query: 69  KHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE----SSL 124
             V        + S S D  +  W     +     +L GH  +V             +  
Sbjct: 746 LSVATTEDDEYILSGSKDRGVLFWDKVSGN--PLLMLQGHRNSVISVAVNHGHPLGPNYH 803

Query: 125 RLCSGSDDTTVRIWKYIE 142
              +GS D   RIWKYI+
Sbjct: 804 IFATGSGDCKARIWKYIK 821

>Scas_630.6
          Length = 621

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 80/165 (48%), Gaps = 20/165 (12%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++S+ +S  G +LAT + DK + IW      +E + + VL+ H QD+  + +      L 
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNI----KERKIVMVLKGHEQDIYSLDYFPDGQKLV 399

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK-- 139
           S S D +IRIW D     QC+  L+  +G    +    +E  L + +GS D +VRIW   
Sbjct: 400 SGSGDRSIRIW-DL-KTGQCSLTLSIEDGVTTVA-VSPNEGKL-IAAGSLDRSVRIWDSS 455

Query: 140 ---YIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS 181
               +E  + D +         + H  +VYSV+++  G    +GS
Sbjct: 456 TGFLVERLDSDNESG-------NGHQDSVYSVAFTKDGQHVVSGS 493

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 69/144 (47%), Gaps = 18/144 (12%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN + E +++ +++GHE ++ S+ +   G  L + S D+S+ IW+     +  +C   L 
Sbjct: 368 WNIK-ERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDL----KTGQCSLTLS 422

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIW--------KDFDDDWQCAAVLNGHEGTVWC 114
                    V  +   L+A+ S D ++RIW        +  D D +     NGH+ +V+ 
Sbjct: 423 IEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG---NGHQDSVYS 479

Query: 115 SDFEKSESSLRLCSGSDDTTVRIW 138
             F K      + SGS D TV++W
Sbjct: 480 VAFTKDGQ--HVVSGSLDRTVKLW 501

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 8/135 (5%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWE-ADEYGEEFECISVLQEHSQDVKHVVWHS 75
           GH++ V SV+++  G ++ + S D++V +W   D      +C      H   V  V   +
Sbjct: 472 GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSN 531

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC-----SDFEKSESSLRLCSGS 130
               + S S D  + IW    D      +L GH  +V       S+ +  ++     +GS
Sbjct: 532 DDKYIFSGSKDRGVIIWDK--DSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGS 589

Query: 131 DDTTVRIWKYIEDNE 145
            D   RIWKY +  E
Sbjct: 590 GDCKARIWKYFKMGE 604

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 68/150 (45%), Gaps = 21/150 (14%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLAT-CSRDKSVW-IWEADEYGEEFE-----C 57
           +E++ +LL  +  H++ V  V +S  G YLAT C+R   ++ +   + Y +  +      
Sbjct: 266 TELDVDLLHSLP-HDSVVCCVKFSQDGKYLATGCNRTTQIFDVATGELYVKLLDDTVNTA 324

Query: 58  ISVLQEHSQD---------VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGH 108
           I      + +         ++ + +      LA+ + D  IRIW     + +   VL GH
Sbjct: 325 IVTTTTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWN--IKERKIVMVLKGH 382

Query: 109 EGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           E  ++  D+       +L SGS D ++RIW
Sbjct: 383 EQDIYSLDY--FPDGQKLVSGSGDRSIRIW 410

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 103/221 (46%), Gaps = 26/221 (11%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLL 80
           ++  + WS     +  C+ D  + I+++   G+E   + +L ++      V  H   S +
Sbjct: 223 KISGLDWSVDSKNIFVCTHDGRIVIYDS---GDE-TTVKILYKNDARFAQVRCHPCNSFI 278

Query: 81  ASSSYDDTIRIWKDFDDDWQCAAVLN-GHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
            S+S+D T   W   D   Q   ++  GH   V+   F  ++ SL   +G D   + IW 
Sbjct: 279 GSTSFDKT---WILIDTVKQAPILIQEGHSAEVFSLSFH-NDGSLVSTAGLDAIAL-IW- 332

Query: 140 YIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEI 198
              D    + + +LQ      HS+ +YSV WS  G   ++GS DG + ++  +++G  E 
Sbjct: 333 ---DIRSGKNIMSLQ-----GHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVET 384

Query: 199 IAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWKN 239
           I    LAH    +  VK+ + +G   LV+ G D  VNI+ +
Sbjct: 385 I----LAHNSIVSQ-VKFNKQNG-GYLVSSGYDKKVNIFND 419

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           ++GH   + SV WS +GY LA+ S D ++ +W+  + G     +  +  H+  V  V ++
Sbjct: 343 LQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN----VETILAHNSIVSQVKFN 398

Query: 75  SVL-SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
                 L SS YD  + I+   D +W     L GH   V   D 
Sbjct: 399 KQNGGYLVSSGYDKKVNIFN--DGNWIKERSLEGHLDKVMSIDI 440

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           + I EGH  EV S+S+ + G  ++T   D    IW+        + I  LQ HS+ +  V
Sbjct: 298 ILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDI----RSGKNIMSLQGHSKPIYSV 353

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
            W      LAS S D TI++W D         +L  H   V    F K      + SG D
Sbjct: 354 DWSQNGYQLASGSGDGTIKVW-DIRKKGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYD 411

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 108/250 (43%), Gaps = 40/250 (16%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           E+ETE+    EGH + + S+  +  G +LAT S+D SV +W  +E    FE  +    H+
Sbjct: 372 EIETEM---YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHA 428

Query: 66  QDVKHVVWHSVLS-----LLASSSYDDTIRIWKDFDDDWQCAAVL-----------NGHE 109
             V  +   +V++      L ++S D TI+ WK  + + + A  L             HE
Sbjct: 429 GPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHE 488

Query: 110 GTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVS 169
             +       ++S     + S D T +IW     N D  +V A      + H R ++ V+
Sbjct: 489 KDINAISMSPNDSI--FATASYDKTCKIW-----NVDTGEVEATL----ANHKRGLWGVA 537

Query: 170 WSPTG-LIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQ-IDGETLLVT 227
           +     L+A+   D  + ++  +     + +  H        TN V+    I+G   LV+
Sbjct: 538 FCEYDWLLATCSGDRSINLWSLESFTVLKTLEGH--------TNAVQRVSFINGNKQLVS 589

Query: 228 GGDDGCVNIW 237
            G DG V IW
Sbjct: 590 TGADGLVKIW 599

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           +L  +EGH N V+ VS+ +    L +   D  V IW+        EC+  L  H+  +  
Sbjct: 564 VLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDC----STGECVRTLDAHNNRIWA 619

Query: 71  VVWHSVLSLLASSSYDDTIRIWKD 94
           +   +   L+ ++  D   + W+D
Sbjct: 620 LAVANDGQLIITADADGVFQFWED 643

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 80/192 (41%), Gaps = 27/192 (14%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + V+ V  S  G Y  + S DK++ +W       E   +     H+ DV  V   +
Sbjct: 63  KGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVG----HTGDVLSVAIDA 118

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS----------DFEKSESSLR 125
             S + S+S D TIR+W    D   CA VL GH  T W +          D E  +  + 
Sbjct: 119 NSSKIISASRDKTIRVWNTVGD---CAYVLLGH--TDWVTKVRVAPKNLEDGEVDDGRIT 173

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGL 184
             S   D  VR W   ED+   E  +         H+  +  V  SP G L AS G DG 
Sbjct: 174 FVSAGMDKIVRSWSLNEDSYRIEADFI-------GHNNYINVVQPSPDGSLAASAGKDGQ 226

Query: 185 LAIYQEKEEGKW 196
           + ++  K +  +
Sbjct: 227 IYVWNLKHKSAF 238

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 103/235 (43%), Gaps = 41/235 (17%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++SV +S  G +LAT + DK + IW+  +     + + VL+ H QD+  + +    + L 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQR----KIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEG--TVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           S S D TIRIW D     QC+  L+  +G  TV  S    +     + +GS D TVR+W 
Sbjct: 432 SGSGDRTIRIW-DL-HTGQCSLTLSIEDGVTTVAVSPGNGN----YVAAGSLDRTVRVWD 485

Query: 140 ----YIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-------------D 182
               ++ +  D E    +       H  +VYSV ++  G    +GS             +
Sbjct: 486 SNSGFLVERLDSEGETGV------GHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNIN 539

Query: 183 GLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           G     Q K EG  E+     + H  +   V+  T  + +  +++G  D  V  W
Sbjct: 540 GASTSPQPKTEGNCEMTY---IGHKDF---VLSVTTTENDQYILSGSKDRGVIFW 588

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 65/132 (49%), Gaps = 17/132 (12%)

Query: 18  HENEVKSVSWSHSGYYLAT-CSRDKSVWIWEADEYGEEFECISVLQEHSQD--------- 67
           H++ V  V +S++G YLAT C  +K+  I+E        E +   +  ++D         
Sbjct: 317 HDSVVCCVKFSNNGEYLATGC--NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADL 374

Query: 68  -VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
            ++ V +      LA+ + D  IRIW D     +   VL GHE  ++  D+ +S +  +L
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIW-DI-AQRKIVMVLRGHEQDIYSLDYFQSGN--KL 430

Query: 127 CSGSDDTTVRIW 138
            SGS D T+RIW
Sbjct: 431 VSGSGDRTIRIW 442

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 64/139 (46%), Gaps = 17/139 (12%)

Query: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           + +++ ++ GHE ++ S+ +  SG  L + S D+++ IW+        +C   L      
Sbjct: 404 QRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL----HTGQCSLTLSIEDGV 459

Query: 68  VKHVVWHSVLSLLASSSYDDTIRIW--------KDFDDDWQCAAVLNGHEGTVWCSDFEK 119
               V     + +A+ S D T+R+W        +  D + +      GH+ +V+   F +
Sbjct: 460 TTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGV---GHKDSVYSVVFTR 516

Query: 120 SESSLRLCSGSDDTTVRIW 138
              +  + SGS D +V++W
Sbjct: 517 DGKN--IVSGSLDRSVKLW 533

>Kwal_55.22067
          Length = 451

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           E H   ++ +S+S +     TCS D  + IW      +E    S L  H  DV+   WH 
Sbjct: 164 EAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQE----STLSGHHWDVRSCDWHP 219

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
            + L+AS S D+ +++W       QC + + G + T+  + F+ ++ ++ L   S D + 
Sbjct: 220 TMGLIASGSKDNLVKLWD--PRAGQCISTILGCKHTIISTKFQPTKGNM-LAVISKDKSC 276

Query: 136 RIW 138
           RI+
Sbjct: 277 RIF 279

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 23/198 (11%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +W  S    E  +I++ H++ V  + +SH+G +L +   D ++ IW+ +     F  + V
Sbjct: 109 LWNGSTFNFE--SIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPN-----FNMVKV 161

Query: 61  LQE-HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           L E H+Q ++ + +    S   + S D+ ++IW +F +  Q  + L+GH   V   D+  
Sbjct: 162 LDEAHTQCIRGISFSGTDSKFVTCSDDNILKIW-NFSNGQQ-ESTLSGHHWDVRSCDWHP 219

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT--GLIA 177
           +     + SGS D  V++W       D      + ++L   H+  + S  + PT   ++A
Sbjct: 220 TMG--LIASGSKDNLVKLW-------DPRAGQCISTILGCKHT--IISTKFQPTKGNMLA 268

Query: 178 STGSDGLLAIYQEKEEGK 195
               D    I+  ++  K
Sbjct: 269 VISKDKSCRIFDIRQNMK 286

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 11/90 (12%)

Query: 59  SVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW---KDFDDDWQCAAVLNGHEGTVWCS 115
           ++   H + +  + ++ V  +LAS+S D TIR W   + +D +       N  +   W  
Sbjct: 338 NIPYAHDKCITSLAYNPVGHILASASKDRTIRFWTRARPYDPNSFDDPTYNNKKVNAWYF 397

Query: 116 DF--------EKSESSLRLCSGSDDTTVRI 137
                      K+E  + L   S+D+T  I
Sbjct: 398 GINNNINAIRPKTEDGIALPPASNDSTASI 427

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 79/164 (48%), Gaps = 18/164 (10%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++SV +S  G +LAT + D+ + IW+     E  + + +LQ H QD+  + +      L 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDI----ENRKIVMILQGHEQDIYSLDYFPSGDKLV 501

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEG--TVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           S S D T+RIW D     QC+  L+  +G  TV  S  +       + +GS D  VR+W 
Sbjct: 502 SGSGDRTVRIW-DL-RTGQCSLTLSIEDGVTTVAVSPGDGK----YIAAGSLDRAVRVW- 554

Query: 140 YIEDNEDDEQVWALQSVLPS--AHSRAVYSVSWSPTGLIASTGS 181
              D+E    V  L S   S   H  +VYSV ++  G    +GS
Sbjct: 555 ---DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGS 595

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 100/241 (41%), Gaps = 22/241 (9%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +++ I++GHE ++ S+ +  SG  L + S D++V IW+        +C   L        
Sbjct: 476 KIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTT 531

Query: 70  HVVWHSVLSLLASSSYDDTIRIW--------KDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
             V       +A+ S D  +R+W        +  D + +      GH+ +V+   F +  
Sbjct: 532 VAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT---GHKDSVYSVVFTRDG 588

Query: 122 SSLRLCSGSDDTTVRIWKYIE-DNEDDEQVWALQS--VLPSAHSRAVYSVSWSPTGLIAS 178
            S  + SGS D +V++W     +N+ D +     +  V    H   V SV+ +       
Sbjct: 589 QS--VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYIL 646

Query: 179 TGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE-TLLVTGGDDGCVNIW 237
           +GS     ++ +K+ G   ++ Q    + V    V   + +  E  +  TG  D    IW
Sbjct: 647 SGSKDRGVLFWDKKSGNPLLMLQGH-RNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

Query: 238 K 238
           K
Sbjct: 706 K 706

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 80/164 (48%), Gaps = 18/164 (10%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++SV +S  G +LAT + DK + IW+     E  + +  L+ H QD+  + +    + L 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDL----ETKKIVMTLKGHEQDIYSLDYFPSGNKLV 464

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEG--TVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           S S D T+RIW D      C+  L+  +G  TV  S  E       + +GS D TVR+W 
Sbjct: 465 SGSGDRTVRIW-DL-TTGTCSLTLSIEDGVTTVAVSPGEGK----FIAAGSLDRTVRVW- 517

Query: 140 YIEDNEDDEQVWALQS--VLPSAHSRAVYSVSWSPTGLIASTGS 181
              D++    V  L S   L + H  +VYSV ++  G    +GS
Sbjct: 518 ---DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGS 558

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 14/140 (10%)

Query: 6   EMETE-LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           ++ET+ ++  ++GHE ++ S+ +  SG  L + S D++V IW+         C   L   
Sbjct: 434 DLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDL----TTGTCSLTLSIE 489

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAA------VLNGHEGTVWCSDFE 118
                  V       +A+ S D T+R+W D D  +          +  GH  +V+   F 
Sbjct: 490 DGVTTVAVSPGEGKFIAAGSLDRTVRVW-DSDTGFLVERLDSENELGTGHRDSVYSVVFT 548

Query: 119 KSESSLRLCSGSDDTTVRIW 138
           +      + SGS D +V++W
Sbjct: 549 RDGKG--VVSGSLDRSVKLW 566

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 48/135 (35%), Gaps = 9/135 (6%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEE---FECISVLQEHSQDVKHVVW 73
           GH + V SV ++  G  + + S D+SV +W  +    +    EC      H   V  V  
Sbjct: 537 GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVAT 596

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLR----LCSG 129
                 + S S D  +  W           +L GH  +V                   +G
Sbjct: 597 TQNDEYILSGSKDRGVLFWDT--KSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATG 654

Query: 130 SDDTTVRIWKYIEDN 144
           S D   RIWKY + N
Sbjct: 655 SGDCKARIWKYSKKN 669

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 14/143 (9%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW- 73
           ++GH  +V +  +   G Y+ T + DK + +++AD   E+F+   V  E        VW 
Sbjct: 362 LDGHRTKVVTC-FQFEGNYIITGADDKRINVYDADR--EQFKLELVGHEGG------VWA 412

Query: 74  --HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
             ++   +L S S D T+RIW       +C  V  GH  TV C D  +      + +GS 
Sbjct: 413 LKYAGDEILVSGSTDRTVRIWNV--KAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 132 DTTVRIWKYIEDNEDDEQVWALQ 154
           D T+ +WK  + N  D    A++
Sbjct: 471 DNTLHVWKLPDPNSPDYNPNAMR 493

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 79/194 (40%), Gaps = 36/194 (18%)

Query: 14  IVEGHENEVKSVSW-SHSGY-YLATCSRDKSVWIWEADEYG---------EEFECI---- 58
           +  GH + V+ +    H G  Y+ T SRD ++ +W+  +            +F  I    
Sbjct: 443 VFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNP 502

Query: 59  ---SVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
               VL+ H   V+ V  H   +++ S SYD  + +W       +   VL GH   ++ +
Sbjct: 503 FFVGVLRGHMASVRTVSGHG--NIVVSGSYDHNLMVWDI--AKMKLLYVLTGHTDRIYST 558

Query: 116 DFEKSESSLRLCSGSDDTTVRIWKY--IEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT 173
            ++      R  S S DTTV++W    I +N    Q+          +S +   VS S  
Sbjct: 559 LYDHKRK--RCISASMDTTVKVWDLSDINNNGPVSQI----------NSTSALKVSGSVR 606

Query: 174 GLIASTGSDGLLAI 187
            L   T   GLL +
Sbjct: 607 TLCGHTALVGLLGL 620

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 95/237 (40%), Gaps = 19/237 (8%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ E  T +     GH + V +V    S   +AT  RD  V +W+     E    I VL 
Sbjct: 192 WDLERNTAIRDF-HGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSE----IMVLP 246

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   +  V    V   + S S D T+R+W       + + VL  H   +       +E 
Sbjct: 247 GHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAG--KASKVLTHHSRNIRDLTLHPAEF 304

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSD 182
           S    S +D   VR WK  E          L +   S ++  + +VS +   ++ + G D
Sbjct: 305 SFASVSTND---VRSWKLPEGQ--------LLTNFQSQNTGILNTVSINHDNVLLAGGDD 353

Query: 183 GLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQID-GETLLVTGGDDGCVNIWK 238
           G L  Y  K   K++ +   E+A  +     +  +  D   T L+TG  D  + IWK
Sbjct: 354 GTLCFYDYKTGHKYQSMMTTEVAGSLESERSILCSTFDVTGTRLITGEGDKSIKIWK 410

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 79/198 (39%), Gaps = 44/198 (22%)

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
           H  +SL+    Y+ T      +   W+ + V+NGH G V C   +  ++     +GS+DT
Sbjct: 89  HQQISLM--ERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEW-FATGSNDT 145

Query: 134 TVRIW---------------------------KYIEDNEDDEQV--WALQSVLP----SA 160
           T++IW                            Y+    +D+ V  W L+          
Sbjct: 146 TIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHG 205

Query: 161 HSRAVYSVSWSPT-GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI 219
           H   V++V   P+  +IA+ G D ++ ++  +   +  ++  H+        N VK   +
Sbjct: 206 HLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHK-----SPINKVKCLPV 260

Query: 220 DGETLLVTGGDDGCVNIW 237
           D + +  +G  D  V +W
Sbjct: 261 DPQIISCSG--DATVRLW 276

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 85/205 (41%), Gaps = 46/205 (22%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           + H   V+ VS+S +     TCS D  + IW      +E     VL  H  DVK   WH 
Sbjct: 162 QAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVKSCDWHP 217

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
            + L+ S S D+ I++W       QC + + G + T+  + F+ ++ +L L   + D + 
Sbjct: 218 TMGLIVSGSKDNLIKLWD--PRSGQCISTILGFKHTIIKTKFQPTKGNL-LAVVAKDKSC 274

Query: 136 RIW---------KYIEDNED---------DEQVWA-------------LQSV-------- 156
           +I+         K   D  D         +E ++              LQ          
Sbjct: 275 KIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHD 334

Query: 157 LPSAHSRAVYSVSWSPTGLIASTGS 181
           +P AH + + S+S++P G I ++ S
Sbjct: 335 IPYAHDKCITSLSYNPVGHILASAS 359

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 90/198 (45%), Gaps = 23/198 (11%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +W  S    E  +I++ H++ V ++ +SH+G +L +   D  + IW+ +     F  + V
Sbjct: 107 LWNGSTFNFE--SIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN-----FNMVKV 159

Query: 61  L-QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           L Q H + V+ V +    S   + S D+ ++IW +F +  Q   VL+GH   V   D+  
Sbjct: 160 LDQAHMECVRDVSFSGTDSKFVTCSDDNILKIW-NFSNGQQ-ERVLSGHHWDVKSCDWHP 217

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT--GLIA 177
           +     + SGS D  +++W       D      + ++L   H+  +    + PT   L+A
Sbjct: 218 TMG--LIVSGSKDNLIKLW-------DPRSGQCISTILGFKHT--IIKTKFQPTKGNLLA 266

Query: 178 STGSDGLLAIYQEKEEGK 195
               D    I+  ++  K
Sbjct: 267 VVAKDKSCKIFDIRQNMK 284

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDKSVWIWEADEY--GEEFECISVLQEHSQDVKHVVWHSV 76
           +  ++S+S +  G  LA  +   + ++WE   +      + ++  + HS  +  ++  S 
Sbjct: 159 DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
           +  LA+ S D T R+W   DDD++    L+GH+  VW  D   S  S  L + S D  VR
Sbjct: 219 VKHLATCSADHTARVWS-IDDDFKLETTLDGHQRWVW--DCAFSADSAYLVTASSDHYVR 275

Query: 137 IW 138
           +W
Sbjct: 276 LW 277

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           +A  EGH   V SVS+     ++ T S D ++ +W+          I    +H+  V  V
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV-----RSPSIPRNYKHNAPVNEV 122

Query: 72  VWHSVLSLLASSSYDDTIRIW 92
           V H     L S   D  IRIW
Sbjct: 123 VIHPNQGELISCDRDGNIRIW 143

 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
             H   +  +  S    +LATCS D +  +W  D   ++F+  + L  H + V    + +
Sbjct: 204 RAHSTYITRILLSSDVKHLATCSADHTARVWSID---DDFKLETTLDGHQRWVWDCAFSA 260

Query: 76  VLSLLASSSYDDTIRIW 92
             + L ++S D  +R+W
Sbjct: 261 DSAYLVTASSDHYVRLW 277

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 89/218 (40%), Gaps = 53/218 (24%)

Query: 4   NSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE 63
           N  M  EL  I   H   ++ V++S++     TCS D  + IW      +E     VL  
Sbjct: 154 NFNMVKELDRI---HTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQE----RVLSG 206

Query: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESS 123
           H  DV+   WH  L L+ S S D+ +++W       QC + L   + TV  + F+ ++ +
Sbjct: 207 HHWDVRSCDWHPELGLIVSGSKDNLVKLWD--PRSGQCVSTLLKFKHTVLKTRFQPTKGN 264

Query: 124 LRLCSGSDDTTVRIW----------------------------------------KYIED 143
           L L + S D + R++                                        K+ + 
Sbjct: 265 L-LAAISKDKSCRVFDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDL 323

Query: 144 NEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS 181
            +D E+      ++P AH + + +++++P G I +T +
Sbjct: 324 GQDTEKPI---HIIPFAHEKCISAIAYNPVGHILATAA 358

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 84/178 (47%), Gaps = 21/178 (11%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE-HSQDVKHVV 72
           I++ H+  V ++ +SH+G ++ +   D ++ IW+ +     F  +  L   H++ ++ V 
Sbjct: 119 IMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPN-----FNMVKELDRIHTEGIRDVA 173

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           + +  S   + S D+ ++IW +F +  Q   VL+GH   V   D+   E  L + SGS D
Sbjct: 174 FSNNDSKFVTCSDDNILKIW-NFSNGQQ-ERVLSGHHWDVRSCDWH-PELGL-IVSGSKD 229

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT--GLIASTGSDGLLAIY 188
             V++W       D      + ++L   H+  V    + PT   L+A+   D    ++
Sbjct: 230 NLVKLW-------DPRSGQCVSTLLKFKHT--VLKTRFQPTKGNLLAAISKDKSCRVF 278

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/41 (24%), Positives = 24/41 (58%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIW 46
           + E  +  I   HE  + +++++  G+ LAT ++D+++  W
Sbjct: 326 DTEKPIHIIPFAHEKCISAIAYNPVGHILATAAKDRTIRFW 366

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 104/242 (42%), Gaps = 32/242 (13%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           + +  + +  ++GH N+V S  WS     + + S+D  + +W+A   G +   I +   H
Sbjct: 113 TSVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA-ATGLKSNAIPL---H 168

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDD---WQCAAVLNGHEGTVWCSDFEKSE 121
           SQ V         +L+AS+  D+   I++    D       ++  GH  T + S+ E  +
Sbjct: 169 SQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGH--TCYISEIEFLD 226

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT------GL 175
            +  + + S D T  +W   +    +E    L  VL         S+S +PT       +
Sbjct: 227 DN-SILTASGDMTCALWDITKSKRINEFADHLGDVL---------SLSAAPTETEGNGNV 276

Query: 176 IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVN 235
            AS GSDG L I+ ++       +     +  V +++V K         + TG DDGC N
Sbjct: 277 FASGGSDGYLYIWDKR-------VPTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDGCTN 329

Query: 236 IW 237
           ++
Sbjct: 330 LY 331

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 90/208 (43%), Gaps = 48/208 (23%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
             H   ++ +S+S+S     TCS D  + IW      +E     VL  H  DVK   WH 
Sbjct: 160 RAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHP 215

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
            + L+ S S D+ I++W D       + +L G + TV  + F+ ++ +L L   S D ++
Sbjct: 216 KMGLIVSGSKDNLIKLW-DPRTGRNVSTIL-GLKHTVIKTKFQPTQGNL-LAVVSKDKSI 272

Query: 136 RIW---------KYIEDNED---------DEQVWALQ----------------------S 155
           +I+         + I D+ D         +E ++++                        
Sbjct: 273 KIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACH 332

Query: 156 VLPSAHSRAVYSVSWSPTG-LIASTGSD 182
            +P AH ++V S+++SP G ++AS   D
Sbjct: 333 TIPYAHEKSVTSLAYSPVGHILASAAKD 360

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 90/198 (45%), Gaps = 23/198 (11%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +W  S    E  +I++ H++ V  + +SH+G +L +   D ++ IW+ +     F  + V
Sbjct: 105 LWNGSSFNFE--SIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPN-----FNMVKV 157

Query: 61  L-QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           L + H++ ++ + +        + S D+ ++IW +F +  Q   VL+GH   V   D+  
Sbjct: 158 LDRAHTECMRDISFSYSDQKFVTCSDDNVLKIW-NFSNGQQ-ERVLSGHHWDVKSCDWHP 215

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT--GLIA 177
                 + SGS D  +++W       D      + ++L   H+  V    + PT   L+A
Sbjct: 216 KMG--LIVSGSKDNLIKLW-------DPRTGRNVSTILGLKHT--VIKTKFQPTQGNLLA 264

Query: 178 STGSDGLLAIYQEKEEGK 195
               D  + IY  ++  +
Sbjct: 265 VVSKDKSIKIYDMRQHMR 282

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 65/162 (40%), Gaps = 14/162 (8%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+      +  I+      +K+      G  LA  S+DKS+ I++  ++  E + I    
Sbjct: 232 WDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTI---- 287

Query: 63  EHSQDVKHVVWHSVL-SLLASSSYDDTIRIWKDFDDDWQ----CAAVLNGHEGTVWCSDF 117
               D   + WH +  ++ +   Y+  I+ +    D+      C  +   HE +V  +  
Sbjct: 288 RDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSV--TSL 345

Query: 118 EKSESSLRLCSGSDDTTVRIW---KYIEDNEDDEQVWALQSV 156
             S     L S + D T+R W   + ++ N  D+  +  + V
Sbjct: 346 AYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKV 387

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 87/202 (43%), Gaps = 21/202 (10%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE------YGEEFE-----CISV 60
           LA +  H   V  V +S  G YLA+ S D+ + IW  DE      +G E E         
Sbjct: 67  LASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKR 126

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
           L  H  D++ + W    S+L +   D ++ +W     +++     + H+  V    F+ +
Sbjct: 127 LVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGL--NFERLKRFDVHQSLVKGVIFDPA 184

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDD---EQVWALQSVLPSAHSRAVYSVSWSPTG--L 175
                  + SDD T+R+++Y +  E     EQV  ++  + S  +     +SWSP G  +
Sbjct: 185 NK--YFATASDDRTMRVFRYHKTGEVSFTIEQV-IVEPFIASPLTTYFRRLSWSPDGQHI 241

Query: 176 IASTGSDGLLAIYQEKEEGKWE 197
                ++G ++       G W+
Sbjct: 242 AVPNATNGPVSSVAIINRGTWD 263

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 91/203 (44%), Gaps = 22/203 (10%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + V+  + +  G Y  + S DK++ +W+    GE ++       H  DV  V    
Sbjct: 62  KGHSHIVQDCTLTADGAYALSASWDKTLRLWDV-ATGETYQR---FVGHKSDVMSVDIDK 117

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE---GTVWCSDFEKS-ESSLRLCSGSD 131
             S++ S S D TI++W       QC A L GH      V     EK+ + S+ + S  +
Sbjct: 118 KASMIISGSRDKTIKVWT---IKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 132 DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAIYQ- 189
           D  V+ W   +   + + +          H+  + +++ SP G LIAS G DG + ++  
Sbjct: 175 DKMVKAWNLNQFQIEADFI---------GHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

Query: 190 EKEEGKWEIIAQHELAHGVYETN 212
             ++  + + AQ E+    +  N
Sbjct: 226 AAKKAMYTLSAQDEVFSLAFSPN 248

>Kwal_47.17465
          Length = 800

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 92/211 (43%), Gaps = 25/211 (11%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE------YGEEFE-- 56
           SE     LA +  H   V  V +S  G +LA+ S D+ + IWE DE      +G E +  
Sbjct: 8   SEDSKRPLASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKE 67

Query: 57  ---CISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW 113
                  L  H  D++ + W    S+L +   D ++ +W      ++     + H+  V 
Sbjct: 68  HWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN--GSTFEKIKRFDVHQSLVK 125

Query: 114 CSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVL--P---SAHSRAVYSV 168
              F+ +       + SDD TVRI++Y   ++  +  ++++ V+  P   S  +     +
Sbjct: 126 GVIFDPANKY--FATASDDRTVRIFRY---HKAGDMSFSIEHVVSEPFKGSPITTYFRRL 180

Query: 169 SWSPTG--LIASTGSDGLLAIYQEKEEGKWE 197
           SWSP G  + A   ++G ++       G W+
Sbjct: 181 SWSPDGQHIAAPNATNGPVSSVSIIARGSWD 211

>Scas_629.12
          Length = 671

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 80/166 (48%), Gaps = 22/166 (13%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           ++SV +S  G +LAT + DK + IW+     +E + + VL+ H QDV  + +      L 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDI----QERKIVMVLKGHEQDVYSLDYFPNGEKLV 445

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEG--TVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           S S D T+RIW D     QC+  L+   G  TV  S  +       + +GS D  VR+W 
Sbjct: 446 SGSGDRTVRIW-DL-RTGQCSLTLSIEYGVTTVAVSPNDGK----FIAAGSLDRAVRVWD 499

Query: 140 ----YIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS 181
               ++ +  D E      + L + H  +VYSV ++  G    +GS
Sbjct: 500 STTGFLVERLDSE------NELGTGHRDSVYSVVFTRDGNEVVSGS 539

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 103/251 (41%), Gaps = 35/251 (13%)

Query: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           E +++ +++GHE +V S+ +  +G  L + S D++V IW+        +C   L      
Sbjct: 418 ERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDL----RTGQCSLTLSIEYGV 473

Query: 68  VKHVVWHSVLSLLASSSYDDTIRIW--------KDFDDDWQCAAVLNGHEGTVWCSDFEK 119
               V  +    +A+ S D  +R+W        +  D + +      GH  +V+   F +
Sbjct: 474 TTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGT---GHRDSVYSVVFTR 530

Query: 120 SESSLRLCSGSDDTTVRIWKYI----EDNEDDEQVWALQS--VLPSAHSRAVYSVSWSPT 173
             +   + SGS D TV++W        +NE +++  A  +  V    H   V SV+ S  
Sbjct: 531 DGN--EVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQD 588

Query: 174 GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETL------LVT 227
                +GS     ++ +KE G   ++ Q       +  +V+     +G  L        T
Sbjct: 589 DKYILSGSKDRGILFWDKESGNPLLMLQG------HRNSVISVAVANGSALGPKYNVFAT 642

Query: 228 GGDDGCVNIWK 238
           G  D    IWK
Sbjct: 643 GSGDCKARIWK 653

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 61/154 (39%), Gaps = 19/154 (12%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIW----------EADEYGE-EFECISVLQEHS 65
           GH + V SV ++  G  + + S DK+V +W          E+++ G     C      H 
Sbjct: 518 GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHK 577

Query: 66  QDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLR 125
             V  V        + S S D  I  W    +      +L GH  +V         S+L 
Sbjct: 578 DFVLSVTTSQDDKYILSGSKDRGILFWDK--ESGNPLLMLQGHRNSVISVAVANG-SALG 634

Query: 126 -----LCSGSDDTTVRIWKYIEDNEDDEQVWALQ 154
                  +GS D   RIWKY + + ++E++  +Q
Sbjct: 635 PKYNVFATGSGDCKARIWKYSKISGEEEKIKEVQ 668

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 88/205 (42%), Gaps = 26/205 (12%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD------EYGEEFECI------S 59
           L+ +  H   V +V +S  G YLA+ S D+ + IWE +       +G E   I       
Sbjct: 69  LSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRR 128

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
            L  H  D++ + W    S++ S   D  I IW      ++     + H+  V    F+ 
Sbjct: 129 RLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWN--GSTFEKVKRFDVHQSHVKGVVFDP 186

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLP-----SAHSRAVYSVSWSPTG 174
           +       + SDD T+++++Y   ++  E  ++++ V+      S  +     +SWSP G
Sbjct: 187 ANK--YFATASDDRTIKMFRY---HKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDG 241

Query: 175 --LIASTGSDGLLAIYQEKEEGKWE 197
             + A    +G ++     E G WE
Sbjct: 242 QHIAAPNAMNGPVSTVAIIERGTWE 266

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 88/205 (42%), Gaps = 44/205 (21%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           I   H   ++ +++S +     TCS D  + IW      +E     VL  H  DVK   W
Sbjct: 172 IDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQE----RVLSGHHWDVKSCDW 227

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
           H  + L+AS+S D+ +++W     +  C + +   + TV  + F+ ++ +L L + S D 
Sbjct: 228 HPEMGLIASASKDNLVKLWDPRSGN--CISSILKFKHTVLKTRFQPTKGNL-LMAISKDK 284

Query: 134 TVRIW--KY-------IEDNED---------DEQVWALQS-------------------V 156
           + R++  +Y       + D  D         +E ++ L                      
Sbjct: 285 SCRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILT 344

Query: 157 LPSAHSRAVYSVSWSPTGLIASTGS 181
           +P AH + + S+S++P G I +T +
Sbjct: 345 IPYAHDKCITSLSYNPVGHIFATAA 369

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 13/135 (9%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+  V S+ +S     L T S DK++ IW  D +G   +C   +  H   +  V + + 
Sbjct: 562 GHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD-FG---DCHKSIFAHQDSIMSVRFEAD 617

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                S   D  ++ W    D + C   LNGH+  VWC     S     + S S D ++R
Sbjct: 618 THNFFSCGKDGAVKRWD--GDKFDCIQKLNGHQSEVWC--IAVSPDGRTVVSTSHDHSIR 673

Query: 137 IWKYIEDNEDDEQVW 151
           +W+     E D+QV+
Sbjct: 674 VWQ-----ETDDQVF 683

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 61/140 (43%), Gaps = 16/140 (11%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE-----------ADEYGEEFECI- 58
           LL+  E H   + S+  + +G  L T S DKS   W+            D+Y  + + + 
Sbjct: 456 LLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVH 515

Query: 59  SVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFE 118
               E + D+  V   S    LA S  D+T++++  F D  +    L GH+  V   DF 
Sbjct: 516 DTTLELTDDILAVKISSEDRYLAVSLLDNTVKVF--FFDSLKFYLSLYGHKLPVLSIDF- 572

Query: 119 KSESSLRLCSGSDDTTVRIW 138
            S  S  L + S D  ++IW
Sbjct: 573 -SVDSKMLITSSADKNIKIW 591

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 74/190 (38%), Gaps = 12/190 (6%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           +   +L    GH++ V  +     G  L + S+D  + IW  D  GE    +  L+ H  
Sbjct: 103 LSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIW--DLVGE--VGLMKLRSHKD 158

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
            +  +     +  L S + D  I++W D     QC      H G  W    ++      +
Sbjct: 159 AITGIWIDHNMDWLISVAKDGLIKVW-DLKAGGQCVETHMAHTGQCWSMAIDEEV----I 213

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAV---YSVSWSPTGLIASTGSDG 183
            + S D+  +IW+   +  + E++    +    +  R V   +  + + T       +D 
Sbjct: 214 ITTSMDSQAKIWELDLEKSNGEKISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDK 273

Query: 184 LLAIYQEKEE 193
            + I++ + E
Sbjct: 274 TIEIFRIRPE 283

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 82/205 (40%), Gaps = 46/205 (22%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           + H   V+ +S+S +     +CS D  + IW      +E     VL  H  DVK   WH 
Sbjct: 162 QAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHP 217

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
            + L+ S S D+ I+ W        C + + G + T+  + F+  + +L L   S D T 
Sbjct: 218 KMGLIVSGSKDNLIKFWD--PRSGSCVSTMLGFKHTIISTKFQPKQGNL-LSVISKDKTC 274

Query: 136 RIWKY---------IEDNED---------DEQVWALQSV--------------------- 156
           +++           + D+ D         DE V+ +                        
Sbjct: 275 KVYDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHN 334

Query: 157 LPSAHSRAVYSVSWSPTGLIASTGS 181
           +P AH + V S+++SP G I ++ S
Sbjct: 335 IPYAHEKCVTSLAYSPIGHIMASAS 359

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 105/237 (44%), Gaps = 29/237 (12%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +W  S    E  +I++ H++ V  +++SH+G ++ + S D  + IW+ +     F  + V
Sbjct: 107 LWSGSSFNFE--SIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPN-----FNMVKV 159

Query: 61  L-QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           + Q H + V+ + +        S S D+ ++IW +F +  Q   VL+GH   V   D+  
Sbjct: 160 MDQAHMECVREISFSPTDQKFVSCSDDNVLKIW-NFSNGQQ-ERVLSGHHWDVKSCDWHP 217

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT--GLIA 177
                 + SGS D  ++ W       D      + ++L   H+  + S  + P    L++
Sbjct: 218 KMG--LIVSGSKDNLIKFW-------DPRSGSCVSTMLGFKHT--IISTKFQPKQGNLLS 266

Query: 178 STGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCV 234
               D    +Y  +++ K     + ++     +   ++W  ID ET+   G  DG +
Sbjct: 267 VISKDKTCKVYDIRQQAKELFSVRDDV-----DYMTLQWHPID-ETVFTVGCYDGSI 317

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIW 46
           I   HE  V S+++S  G+ +A+ S+D+++  W
Sbjct: 335 IPYAHEKCVTSLAYSPIGHIMASASKDRTIRFW 367

>Kwal_23.6240
          Length = 913

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 103/273 (37%), Gaps = 72/273 (26%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH +   +V++S  G  + T S D  + IW+         C+   QEH+  V  + +  
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDV----VSGFCLVTFQEHTAAVSALAFAK 393

Query: 76  VLSLLASSSYDDTIRIW-----KDFDD-------DWQCAAV------------------- 104
              +L S+S D T+R W     ++F          + C A                    
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 105 -----------LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWAL 153
                      L+GHEG V C  F +  S   L S S D T+RIW     ++  E +   
Sbjct: 454 WSVQTGQLVETLDGHEGPVSCLSFSQENSV--LASASWDKTIRIWSIFGRSQQVEPLEVY 511

Query: 154 QSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIYQEKE-------EGKWEIIAQHELA 205
             VL         S+S  P G  +A+   DG +  +   E       +GK +I++   L 
Sbjct: 512 ADVL---------SLSVRPDGNEVAAATLDGQILFFDVHEGKQVNAIDGKKDILSGRHLE 562

Query: 206 HGVYETNVVK---WTQI----DGETLLVTGGDD 231
                 N  +   +T I    DG +++  G ++
Sbjct: 563 DRFTSQNSARSKHFTTIDYSFDGLSIVAAGNNN 595

 Score = 31.6 bits (70), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +L+  ++GHE  V  +S+S     LA+ S DK++ IW      ++ E + V
Sbjct: 460 QLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEV 510

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 55/141 (39%), Gaps = 16/141 (11%)

Query: 21  EVKSVSWSHSGYYLA-TCSRDKSVWIWEADEYGEEFECISVLQE-----HSQDVKHVVWH 74
            V  + +S  G   A  C R   V +W+  +  E+ +    ++      H  ++  + W 
Sbjct: 98  PVSDLKFSPDGKVFAIACGR--FVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWS 155

Query: 75  SVLSLLASSSYDDTIRIWK-DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
                L S+S D T RIW  D  +    +    GH   V  + F   +   R+ + S D 
Sbjct: 156 RDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQE--RIYTVSKDG 213

Query: 134 TVRIWKY-----IEDNEDDEQ 149
            V  W+Y      E  E DE+
Sbjct: 214 AVFQWEYTPRPGFESPEQDEE 234

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD 49
           GH + + S++WS    +L + S+D +  IW  D
Sbjct: 144 GHFSNIISLTWSRDSRFLISTSKDLTARIWSLD 176

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 84/217 (38%), Gaps = 58/217 (26%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH +   S+++S  G  + T S D  + +W+         C++  +EH+  V  V +  
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGF----CLATFEEHTSSVTAVQFAK 397

Query: 76  VLSLLASSSYDDTIRIW-----KDFDD-------DWQCAAV------------------- 104
              ++ SSS D T+R W     ++F          + C AV                   
Sbjct: 398 RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHV 457

Query: 105 -----------LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWAL 153
                      L+GHEG V C  F +  S   L S S D T+RIW     ++  E +   
Sbjct: 458 WSVQTGQLLDALSGHEGPVSCLSFSQENSV--LASASWDKTIRIWSIFGRSQQVEPIEVY 515

Query: 154 QSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIYQ 189
             VL         ++S  P G  +A +   G ++I+ 
Sbjct: 516 SDVL---------ALSMRPDGKEVAVSTLKGQISIFN 543

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +LL  + GHE  V  +S+S     LA+ S DK++ IW      ++ E I V
Sbjct: 464 QLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEV 514

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 55/125 (44%), Gaps = 9/125 (7%)

Query: 24  SVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE-----HSQDVKHVVWHSVLS 78
           +V +S  G   A  S  + + IW+  +  ++ +    ++      H QD+  + W     
Sbjct: 101 AVKFSPDGRLFALAS-GRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSR 159

Query: 79  LLASSSYDDTIRIWK-DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRI 137
            + ++S D + +IW  D ++    A   NGH   V  + F   +   ++ + S D  V +
Sbjct: 160 FILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQE--KIYTVSKDGAVFV 217

Query: 138 WKYIE 142
           W++ +
Sbjct: 218 WEFTK 222

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD 49
           GH  ++ S++WS    ++ T S+D S  IW  D
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVD 176

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (46%), Gaps = 6/128 (4%)

Query: 14  IVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           I+ GH   +  +++  H    LATCS D  V  W+       +   S  +  +  VK   
Sbjct: 109 ILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVK--- 165

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           W+   S + +SS+ D + IW D          L GHEG+V   DF K++ +  + S S+D
Sbjct: 166 WNFRNSNIMASSHSDHVCIW-DLRKGCTPLYTLQGHEGSVNNIDFNKAKET-EIMSSSND 223

Query: 133 TTVRIWKY 140
            TV+ W Y
Sbjct: 224 GTVKFWDY 231

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 64/138 (46%), Gaps = 32/138 (23%)

Query: 33  YLATCSRDKSVWIWE------ADEYGEEFE-------------CISVLQEHSQDVKHVVW 73
           Y+ T SRD ++ +W+        ++GEE +              + VL+ H   V+ V  
Sbjct: 479 YIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSG 538

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
           H   +++ S SYD+T+ +W       +C  +L+GH   ++ + ++      R  S S DT
Sbjct: 539 HG--NIVVSGSYDNTLIVWDV--AQMKCLYILSGHTDRIYSTIYDHERK--RCISASMDT 592

Query: 134 TVRIWKYIEDNEDDEQVW 151
           T+RIW       D E +W
Sbjct: 593 TIRIW-------DLENIW 603

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           +L S S D T+R+W D      C  V  GH  TV C D  + ++   + +GS D T+ +W
Sbjct: 435 ILVSGSTDRTVRVW-DIKKGC-CTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVW 492

Query: 139 K 139
           K
Sbjct: 493 K 493

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           +  + L  + GH+  V ++ ++H G  L + S D++V +W+     ++  C  V + H+ 
Sbjct: 410 INKKFLLQLSGHDGGVWALKYAHGGI-LVSGSTDRTVRVWDI----KKGCCTHVFKGHNS 464

Query: 67  DVK--HVVWHSVLSLLASSSYDDTIRIWK 93
            V+   +V +  +  + + S D+T+ +WK
Sbjct: 465 TVRCLDIVEYKNIKYIVTGSRDNTLHVWK 493

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 105/239 (43%), Gaps = 21/239 (8%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           EL+  + GHE  +  +  S     +A+CS D+S+ +W+  E G+E   +S+   H+  + 
Sbjct: 170 ELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDR-ETGKE---LSIGWSHTARIW 225

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDD-----WQCAAVLNGH-EGTVWCSDFEKSESS 123
           ++ + +    L S S D T R+W    +D      Q + +  GH    VW  D    E  
Sbjct: 226 NLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWGVDVN-DEKR 284

Query: 124 LRLCSGSDDTTVRIWKYIEDNEDDEQV-WALQSVLPSA-----HSRAVYSVSWSPTGLIA 177
           +   SG+D     I    + N  DE + + +  +  +A         +    W   GL+ 
Sbjct: 285 IIATSGNDGRINVIDLNTDTNSGDEVIGYEIADIEKAAGISFEKDEIIKGFYWFKFGLVC 344

Query: 178 STGSDGLLAIYQEKEEGKWEII----AQHELAHGVYETNVVKWTQIDGETLLVTGGDDG 232
            T    +LA   E ++ +  ++    A + + +G+YE+N+V +T    + L +    DG
Sbjct: 345 ITSQGRVLAFQTETKQWRQCLLDSRFASYSITNGIYESNIVFFTNNKCDILAMKFSIDG 403

>Scas_673.11
          Length = 434

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 97/213 (45%), Gaps = 30/213 (14%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +W +     +    +EGH   V + +++H G +L T      + + ++++ G ++   S 
Sbjct: 95  LWTSHSQPPKFAGTLEGHTESVVASAFTHDGQFLVTADMTGKIMVHKSNKSGSQWSLTST 154

Query: 61  LQEHSQDVKHVVW---HSVLS-LLASSSYDDTIRIWKDFDDDWQCAAVLNG--HEGTVWC 114
           LQE    V+ VVW   H V+S + A  + D ++  ++  D+D     +++G  H+     
Sbjct: 155 LQE----VEEVVWLKCHPVISGVFAFGATDGSVWCYQINDNDGSVEQLMSGFIHQQDCTM 210

Query: 115 SDF---EKSESSLRLCSGSDDTTVRIW---------KYIEDN-EDDEQVWALQSVLPSAH 161
            +F   ++ E+ L L + S D+++  W         K  +D  +  E  W   +V PS  
Sbjct: 211 GEFINIDQGENVLELVTCSVDSSIVGWNCFTAQPTFKITKDEIKGLEAPWVSLAVAPSKM 270

Query: 162 SRAVYSVSWSPTGLIASTGSDGLLAIYQEKEEG 194
           +          +G+IA+  ++G+LAI      G
Sbjct: 271 TNG-------NSGIIAAGANNGVLAIINCNNAG 296

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 25/60 (41%)

Query: 58  ISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
           ++   +H+  V  +  H  L L+ +   D+   +W       + A  L GH  +V  S F
Sbjct: 62  VAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLEGHTESVVASAF 121

>Scas_720.83d
          Length = 915

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 65/165 (39%), Gaps = 48/165 (29%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH +   S+++S  G  + T + D  + +W+         C++  QEH+  V  V +  
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGF----CLATFQEHTSSVTQVQFAK 395

Query: 76  VLSLLASSSYDDTIRIW-----KDFDD-------DWQCAAV------------------- 104
              +L SSS D T+R W     ++F          + C AV                   
Sbjct: 396 RGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHV 455

Query: 105 -----------LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
                      L+GHEG V C  F +  S   L S S D TVR+W
Sbjct: 456 WSVQTGQLLDTLSGHEGPVSCLAFSQENSV--LASASWDKTVRVW 498

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 46/130 (35%), Gaps = 40/130 (30%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE----------EFECISV- 60
           LA  + H + V  V ++  G  L + S D +V  W+   Y            +F C++V 
Sbjct: 378 LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVD 437

Query: 61  -----------------------------LQEHSQDVKHVVWHSVLSLLASSSYDDTIRI 91
                                        L  H   V  + +    S+LAS+S+D T+R+
Sbjct: 438 PSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRV 497

Query: 92  WKDFDDDWQC 101
           W  F    Q 
Sbjct: 498 WSIFGRSQQV 507

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +LL  + GHE  V  +++S     LA+ S DK+V +W      ++ E   V
Sbjct: 462 QLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIFGRSQQVEPFDV 512

>Scas_679.28
          Length = 815

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 104/237 (43%), Gaps = 34/237 (14%)

Query: 17  GHENEVKSVSWSH---SGY--YLATCSRDKSVWIWEADEYG----EEFECISV----LQE 63
           GH   V +V   +    GY  +L T S D ++  W+  +      E+ + + V     + 
Sbjct: 430 GHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRA 489

Query: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESS 123
           H +D+  +      S+ A++SYD T +IW D ++  +  A L+ H+  +W   F + +  
Sbjct: 490 HEKDINALAISPNDSIFATASYDKTCKIW-DLEN-GELTATLSNHKRGLWDVAFCQYDKL 547

Query: 124 LRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSD 182
           +  CSG  D T++IW            +++   L   H+ AV    +    L + S+G+D
Sbjct: 548 IATCSG--DKTIKIWSL--------DTFSVMKTL-EGHTNAVQRCMFINKQLQLVSSGAD 596

Query: 183 GLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWKN 239
           GL+ I+        + +  H+         +   T+I+   ++V+   DG    WK+
Sbjct: 597 GLIKIWDCSTGDCLKTLDGHD-------NRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 100/239 (41%), Gaps = 36/239 (15%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           EGHE+ + S+  +  G ++AT S+D +  +W+ +    +F+       HS  V  V   +
Sbjct: 383 EGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPN 442

Query: 76  VL-----SLLASSSYDDTIRIWK------DFDDDWQCAAV----LNGHEGTVWCSDFEKS 120
           V+       L ++S D TI+ WK        ++D Q   V       HE  +       +
Sbjct: 443 VMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPN 502

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP-TGLIAST 179
           +S     + S D T +IW    D E+ E    L     S H R ++ V++     LIA+ 
Sbjct: 503 DSI--FATASYDKTCKIW----DLENGELTATL-----SNHKRGLWDVAFCQYDKLIATC 551

Query: 180 GSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQ-IDGETLLVTGGDDGCVNIW 237
             D  + I+        + +  H        TN V+    I+ +  LV+ G DG + IW
Sbjct: 552 SGDKTIKIWSLDTFSVMKTLEGH--------TNAVQRCMFINKQLQLVSSGADGLIKIW 602

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           EL A +  H+  +  V++      +ATCS DK++ IW  D     F  +  L+ H+  V+
Sbjct: 524 ELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLD----TFSVMKTLEGHTNAVQ 579

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW 113
             ++ +    L SS  D  I+IW     D  C   L+GH+  +W
Sbjct: 580 RCMFINKQLQLVSSGADGLIKIWDCSTGD--CLKTLDGHDNRIW 621

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 62/137 (45%), Gaps = 4/137 (2%)

Query: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +  L +I    E E+ ++  +    YL+  S+++ + I++ D+  ++   I    + S  
Sbjct: 49  QRRLHSIANDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSP 108

Query: 68  VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSL--R 125
              +   S  +L+A    D +I +  D ++ +   + L GH  T+    F    +S    
Sbjct: 109 CYIMDCDSTSTLVALGGTDGSITVV-DIENGFITHS-LKGHGATISALKFFGQANSNVWL 166

Query: 126 LCSGSDDTTVRIWKYIE 142
           LCSG  +  V++W  ++
Sbjct: 167 LCSGDTNGMVKVWDLVK 183

>Scas_704.40
          Length = 608

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 13/129 (10%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L+  + GH + VK++ +  +   L T S DK++ +W      +  ECIS  + H+  V 
Sbjct: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNY----KTGECISTYRGHTDSVM 337

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V   +   ++ S S D T++IW     + +    L GH  T W +  +    S    SG
Sbjct: 338 SV--DAFKKIIVSGSADKTVKIWHV---ESRTCYTLRGH--TEWVNCVKLHPKSFTCFSG 390

Query: 130 SDDTTVRIW 138
           SDDTT+R+W
Sbjct: 391 SDDTTIRMW 399

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LL + SYD T+ IW    +  +    L+GH   V    F+++    +L +GS D T+R+W
Sbjct: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRVW 318

Query: 139 KY 140
            Y
Sbjct: 319 NY 320

 Score = 31.2 bits (69), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           L S S D+TI++W       QC     GH   VW    + +  + R+ SGS D +++IW
Sbjct: 480 LLSCSLDNTIKLWDV--QTGQCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIW 532

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 113/256 (44%), Gaps = 40/256 (15%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVL 61
           WN E    L    EGHE+ V  V+++       A+   D +V IW     G++    ++ 
Sbjct: 6   WNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIW---SLGQQSPNFTMT 62

Query: 62  QEHSQDVKHVVWHSV--LSLLASSSYDDTIRIWKDFDDDWQ---CAAVLNGHEGTVWCSD 116
              ++ V  V ++ +     L +SS D +++IW     D+Q   C A L GH   V  + 
Sbjct: 63  AHETRGVNFVDYYPLQDKPYLITSSDDRSVKIW-----DYQTKSCVATLEGHMANVSYAI 117

Query: 117 FEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-- 174
           F  S     + SGS+D TV+IW        +   + L+  L     R+ + V+  PTG  
Sbjct: 118 FHPSLPI--IISGSEDGTVKIW--------NANTYKLEKTLNLGLERS-WCVAAHPTGKR 166

Query: 175 -LIASTGSDGLLAIYQEKEEGKWEIIA---------QHELAHGVYETNVVKWTQI--DGE 222
             +AS   +G   +    +E +  +           ++ +A  V+ T V++ T+   DGE
Sbjct: 167 NYVASGFDNGFNVLSMGNDEPRLSLDPVGKLVWCGGKNAVATDVF-TAVIRGTEQVEDGE 225

Query: 223 TLLVTGGDDGCVNIWK 238
           T+ +   + G V+++ 
Sbjct: 226 TIPLQTKELGTVDVYP 241

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/155 (18%), Positives = 65/155 (41%), Gaps = 24/155 (15%)

Query: 88  TIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDD 147
           TI++W +++ +W       GHE  V C  F   + +    S   D TV+IW   + + + 
Sbjct: 2   TIKLW-NWEKNWALEQTFEGHEHFVMCVAFNPKDPN-TFASACLDHTVKIWSLGQQSPN- 58

Query: 148 EQVWALQSVLPSAHSRAVYSVSWSP---TGLIASTGSDGLLAIYQEKEEGKWEIIAQH-- 202
                    + +  +R V  V + P      + ++  D  + I+  + +     +  H  
Sbjct: 59  -------FTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMA 111

Query: 203 ELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            +++ ++  ++          ++++G +DG V IW
Sbjct: 112 NVSYAIFHPSL---------PIIISGSEDGTVKIW 137

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 8/127 (6%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+  V S+  SH    + T S DK++ IW  D +G   +C   L  H   + +V +   
Sbjct: 565 GHKLPVLSMDISHDSKLIITSSADKNIKIWGLD-FG---DCHKSLFAHQDSIMNVKFLPE 620

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                S S D T++ W    + + C   L GH+G VW      S     + S S D ++R
Sbjct: 621 SHNFFSCSKDGTVKYWD--GNSFDCIQKLYGHQGEVWA--LAVSSDGQAVVSVSHDRSIR 676

Query: 137 IWKYIED 143
           +W+  ED
Sbjct: 677 VWEETED 683

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 16/142 (11%)

Query: 9   TELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE--------ADEYGEEFECISV 60
           T L  I E H   + S+  +  G  L T S DK+V  W+        A    +    + +
Sbjct: 457 TMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516

Query: 61  LQEHSQDVKHVVWHSVLS----LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSD 116
           + + + D+   +W   +S     LA S  D+T++++  F D  +    L GH+  V   D
Sbjct: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSMD 574

Query: 117 FEKSESSLRLCSGSDDTTVRIW 138
              S  S  + + S D  ++IW
Sbjct: 575 I--SHDSKLIITSSADKNIKIW 594

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVL---NGHEGTVWCSDFEK 119
           E   +  ++ +H    +LA    D TI+IW     D Q   VL   + H   +    F++
Sbjct: 73  EKPAEATYLQYHEETFILAVGYADGTIKIW-----DMQTQTVLIVFHSHSSAITILRFDQ 127

Query: 120 SESSLRLCSGSDDTTVRIWKYI 141
           + +  RL SGS D T+ +W  +
Sbjct: 128 TGT--RLISGSRDATIILWDLV 147

>Scas_585.8
          Length = 460

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 84/203 (41%), Gaps = 44/203 (21%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
             H   ++ +S+S++     TCS D  + IW       E      L  H  D+K   WH 
Sbjct: 170 NAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDIKSCDWHP 225

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
            + L+ S+S D+ +++W       QC + +   + TV  + F+ +  +L L + S D + 
Sbjct: 226 EMGLIVSASKDNLVKLWD--PRSGQCISTIIKFKHTVLKTRFQPTRGNL-LAAISKDKSC 282

Query: 136 RIWKY---------IED---------NEDDEQVWALQS-------------------VLP 158
           R++           + D         N  +E ++ + +                   V+P
Sbjct: 283 RVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIP 342

Query: 159 SAHSRAVYSVSWSPTGLIASTGS 181
            AH + V S++++P G I ++ S
Sbjct: 343 YAHDKCVTSMAYNPAGNILASAS 365

>Kwal_27.12239
          Length = 316

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 21/137 (15%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V SV ++  G  L +CS D+S+ IW+          +  L  HS+ V  +     
Sbjct: 97  GHTAPVTSVKYTMKGNLLCSCSMDESIKIWDI----LSGTLLRTLSAHSEPVVSIDLPPF 152

Query: 77  -LSLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLR 125
             S+L+S SYD  IRI+            +D DWQ         G V  S  + S +   
Sbjct: 153 DPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQ------SENGVVPISQVKFSRNGKY 206

Query: 126 LCSGSDDTTVRIWKYIE 142
           L   S D  ++IW ++ 
Sbjct: 207 LLVKSLDGILKIWDFVR 223

>Scas_465.4
          Length = 1002

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 113/251 (45%), Gaps = 27/251 (10%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           + W+  +ET+L  +V GHE  +   + S +G Y+ +CS D+S+ +W   + GEE  C   
Sbjct: 162 LIWDLFLETKLYNLV-GHEGSIFYATISDNGRYITSCSDDRSIKLWNL-QTGEEL-CTG- 217

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE-------GTVW 113
              H+  + ++ + +  + L S S D+T R+W    D+      L   +         VW
Sbjct: 218 -WGHTARIWNLKFFNNDTQLISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVHLIKNVW 276

Query: 114 CSDFEKSESSLRLCSGSDDTTVRIWKYIEDNED---DEQVWALQ-----SVLPSAHSRAV 165
             D +  E  +   +  +D  +++ K I+D +     E  ++L+     SV+  +    +
Sbjct: 277 GVDIQ--EKDMVAVTSGNDGRLKLTK-IQDTKTMNAQEVSFSLEDISTHSVIKFSKGEII 333

Query: 166 YSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQ----HELAHGVYETNVVKWTQIDG 221
                   GLIA T    ++  ++     K  ++++    + + HG+ E N+V ++    
Sbjct: 334 KGFQKFEFGLIAITSLGKIIQYFECDNLWKLLLVSENLVSYSVTHGIMEHNIVTFSNNKS 393

Query: 222 ETLLVTGGDDG 232
           + LL+    DG
Sbjct: 394 DALLLKLSQDG 404

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 8/130 (6%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           E +A +  H+  +  VS+  S  ++ATCS DK+V IW      E F  +  L+ H+  V+
Sbjct: 528 EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSL----ESFTVLKTLEGHTNAVQ 583

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
              + +    L S+  D  I++W     D  C   L+GH   +W       E    + S 
Sbjct: 584 RCSFMNKQKQLVSAGADGLIKVWDIASGD--CIKNLDGHSNRIWA--LSVLEDGDLIISA 639

Query: 130 SDDTTVRIWK 139
             D+  + WK
Sbjct: 640 DADSVFQFWK 649

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 88/232 (37%), Gaps = 69/232 (29%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           + EGH + + S++ +  G +LAT S+DK+  +W  +   + F   +    H+  V  V  
Sbjct: 385 LYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCL 444

Query: 74  HSVL-----SLLASSSYDDTIRIW---------------------------KDFD----- 96
            +V+       + ++S D T++ W                           KD +     
Sbjct: 445 PNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMA 504

Query: 97  --------------------DDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                               D  +  A L  H+  +W   F +SE  +  CSG  D TV+
Sbjct: 505 PNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSG--DKTVK 562

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW-SPTGLIASTGSDGLLAI 187
           IW         E    L+++    H+ AV   S+ +    + S G+DGL+ +
Sbjct: 563 IWSL-------ESFTVLKTL--EGHTNAVQRCSFMNKQKQLVSAGADGLIKV 605

>Scas_702.16
          Length = 816

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 61/261 (23%), Positives = 101/261 (38%), Gaps = 39/261 (14%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE-------YGEEFE-----CIS 59
           LA +  H   V  + +S +G YLA+ S D+ + IW  DE       +G E E        
Sbjct: 72  LASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRK 131

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
            L  H  D++ + W    SLL S   D  + IW      ++     + H+  V    F+ 
Sbjct: 132 RLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGI--TFEKLKRFDVHQSHVKGVIFDP 189

Query: 120 SESSLRLCSGSDDTTVRIWKY--IEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG--L 175
           +       + SDD T++I++Y  I D     +    +    S  +     +SWSP G  +
Sbjct: 190 ANK--YFATASDDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHI 247

Query: 176 IASTGSDGLLAIYQEKEEGKWE---IIAQHELAHGVYETNVVKWTQIDG----------- 221
            A   ++G ++       G W+    +  H+    V   N   +   DG           
Sbjct: 248 AAPNATNGPVSSVAIINRGTWDSNISLIGHDAPTEVVRFNPRLFEVNDGMTPAKRKQDSG 307

Query: 222 -----ETLLVTGGDDGCVNIW 237
                E+++ T G D  V +W
Sbjct: 308 PNDSMESIIATAGQDKTVVVW 328

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 84/189 (44%), Gaps = 13/189 (6%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           + GHE  +  V+ S++G  LA+CS D+S+ IW+        + +S    H+  + ++ + 
Sbjct: 177 LRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDM----VSGKLLSRAWGHTARIWNLKFF 232

Query: 75  SVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGH-EGTVWCSDFEKSESSLRLCSGSDDT 133
           +  + L S S D T R+W   +D+     +   H    VW  D E  E++L   SG +D 
Sbjct: 233 NDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVE--ETNLIAISGGNDG 290

Query: 134 TVRIWKYIEDNEDDEQVWALQSV------LPSAHSRAVYSVSWSPTGLIASTGSDGLLAI 187
            +++ + +  N       +L+S+           +  V    W   GL+  T    +L  
Sbjct: 291 RLKVTELVPHNRSCNIELSLESISEQCDGFIHKANEIVKGFHWFDFGLVLITSEGNILEY 350

Query: 188 YQEKEEGKW 196
            Q  EE K+
Sbjct: 351 LQNIEEWKF 359

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 70/149 (46%), Gaps = 21/149 (14%)

Query: 43  VWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA 102
           + +WE D   +    I  L+ H   + +V   +   LLAS S D +I IW     D    
Sbjct: 163 IIVWELDSKKK----IHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIW-----DMVSG 213

Query: 103 AVLN---GHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
            +L+   GH   +W   F   ++  +L S S+D T R+W Y    ++DE    ++ +  S
Sbjct: 214 KLLSRAWGHTARIWNLKFFNDDT--QLISVSEDCTCRVWNY----KNDE--LTIKDIFES 265

Query: 160 AHSRAVYSVSWSPTGLIA-STGSDGLLAI 187
             ++ V+ V    T LIA S G+DG L +
Sbjct: 266 HLTKNVWGVDVEETNLIAISGGNDGRLKV 294

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 21/182 (11%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           E H +EV  + +   G  LA+   D +V IW+      + E + V + H+  VK + WH 
Sbjct: 344 EKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDT----RQDEPLWVKRNHNAAVKAITWHP 399

Query: 76  -VLSLLAS--SSYDDTIRIWKDFDDDWQCAAVLNGHEGTV--WCSDFEKSESSLRLCS-- 128
            V++LLA+   S D  I  W +     +  ++  G + +   W   +E S  +  + +  
Sbjct: 400 DVVNLLATGGGSLDRHIHFW-NTTTGARIGSINTGSQVSSLHWGQSYEDSHMNREIVATG 458

Query: 129 GSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAI 187
           GS D ++ I+ Y      D +V   +  +  AH   + S   SP G  IA+ G D  L  
Sbjct: 459 GSPDNSISIYNY------DSKVKVAE--ITQAHESRIVSSQLSPDGTTIATVGGDENLKF 510

Query: 188 YQ 189
           Y+
Sbjct: 511 YR 512

 Score = 32.0 bits (71), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 75/185 (40%), Gaps = 30/185 (16%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E   E+  + E     + SV WS+   +++    D +  IW+ +         S L 
Sbjct: 248 WNGET-GEVSLLTEFETETITSVVWSNDDCHISIGKDDGNTEIWDVETMSHVRTMRSSLG 306

Query: 63  EH--SQDVKHVVWHSVLSLLASSSYD---DTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
               SQD     W   +  + + S +   + +R+       W+       H   V    F
Sbjct: 307 VRICSQD-----WLDTVVCIGAKSGEIQVNDVRVKDHIVSTWE------KHTSEVCGIKF 355

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--TGL 175
              +  L+L SG +D TV IW    D   DE +W  ++     H+ AV +++W P    L
Sbjct: 356 R--QDGLQLASGGNDNTVMIW----DTRQDEPLWVKRN-----HNAAVKAITWHPDVVNL 404

Query: 176 IASTG 180
           +A+ G
Sbjct: 405 LATGG 409

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (44%), Gaps = 12/147 (8%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E  T    IV  H + V S+S+S+ G YLAT  RDK + +W+      + E +S   
Sbjct: 168 WNVEQGTN--PIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDI----RKGEVVSEGM 221

Query: 63  EHS-QDVKHVVWHSVLSLLASSSY----DDTIRIWKDFD-DDWQCAAVLNGHEGTVWCSD 116
            HS    + VVW      LA++ +    D  I +W  F+ +  Q     N  + +     
Sbjct: 222 GHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMP 281

Query: 117 FEKSESSLRLCSGSDDTTVRIWKYIED 143
           F    + +   +G  D  +R +++ +D
Sbjct: 282 FYDDSNKILYVAGKGDGNIRYYEFQDD 308

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 14/95 (14%)

Query: 12  LAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWE----------ADEYG--EEFECI 58
           + +  GH  +V    +       L + S D  + +WE           DE G  E    +
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPV 133

Query: 59  SVLQEHSQDVKHVVWHSVLS-LLASSSYDDTIRIW 92
             L  H + V HV++H     +LASSS D T+R+W
Sbjct: 134 KFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW 168

 Score = 34.3 bits (77), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 13/111 (11%)

Query: 103 AVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK----YIEDNEDDEQVWALQSVLP 158
            +  GH   V  +DF+  +  + L SGSDD  + +W+    Y   N  DE    ++ V P
Sbjct: 75  PLFRGHTAQVLDTDFDPFDERM-LVSGSDDGRIGVWEIPATYSFHNAQDED-GNVEHVAP 132

Query: 159 ----SAHSRAVYSVSWSPT--GLIASTGSDGLLAIYQEKEEGKWEIIAQHE 203
               + H R V  V + PT  G++AS+  D  + ++   E+G   I+  H 
Sbjct: 133 VKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNV-EQGTNPIVLTHP 182

>Scas_680.11
          Length = 347

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 65/139 (46%), Gaps = 20/139 (14%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           VL  H + +  V ++    LL S S D+   +W  +  + +    LNGH GT+W  D +K
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVW--YSVNGERLGTLNGHAGTIWSIDVDK 62

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIAST 179
              +    +GS D ++++WK     E  E V++  S +P      V +VS+SP G   + 
Sbjct: 63  --FTEYCVTGSADYSIKMWKV----ETGENVYSWDSPVP------VKNVSFSPCGNYVAA 110

Query: 180 GSD------GLLAIYQEKE 192
             D      G + IYQ K 
Sbjct: 111 VLDNVMKYPGSINIYQLKR 129

 Score = 31.2 bits (69), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 14 IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
          ++ GHE  +  V ++  G  L +CS+D    +W    Y    E +  L  H+  +  +  
Sbjct: 5  VLMGHERPLTQVKYNREGDLLFSCSKDNFASVW----YSVNGERLGTLNGHAGTIWSIDV 60

Query: 74 HSVLSLLASSSYDDTIRIWK 93
                  + S D +I++WK
Sbjct: 61 DKFTEYCVTGSADYSIKMWK 80

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/187 (18%), Positives = 79/187 (42%), Gaps = 24/187 (12%)

Query: 56  ECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
           E ++  + H   ++ +  H     + + S D TI++W +++ +W C     GHE  V   
Sbjct: 88  EKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLW-NWEKNWGCQQTFTGHEHFVMSV 146

Query: 116 DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--- 172
            F   + + +  SG  D T+++W   +D             L +  ++ V  V + P   
Sbjct: 147 AFNPKDPN-QFASGCLDHTIKVWSIGQD--------VPNFTLKAHETKGVNYVDYYPLQD 197

Query: 173 TGLIASTGSDGLLAIYQEKEEGKWEIIAQH--ELAHGVYETNVVKWTQIDGETLLVTGGD 230
              + +T  DG + ++  + +     +  H   +++ V+   +          ++++G +
Sbjct: 198 KPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTL---------PIIISGSE 248

Query: 231 DGCVNIW 237
           DG + IW
Sbjct: 249 DGTLKIW 255

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           YL T S D ++ +W+          ++ L+ H  +V + V+H  L ++ S S D T++IW
Sbjct: 200 YLITTSDDGTIKVWDYQTKSN----VATLEGHMANVSYAVFHPTLPIIISGSEDGTLKIW 255

Query: 93  KDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
               + ++    LN      WC     S     + SG D+
Sbjct: 256 N--ANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDN 293

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 70/174 (40%), Gaps = 15/174 (8%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           E H + ++S++   +  ++ T S D ++ +W    + + + C      H   V  V ++ 
Sbjct: 94  EAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWN---WEKNWGCQQTFTGHEHFVMSVAFNP 150

Query: 76  V-LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGT-VWCSDFEKSESSLRLCSGSDDT 133
              +  AS   D TI++W    D       L  HE   V   D+   +    L + SDD 
Sbjct: 151 KDPNQFASGCLDHTIKVWSIGQDVPNF--TLKAHETKGVNYVDYYPLQDKPYLITTSDDG 208

Query: 134 TVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAI 187
           T+++W Y        Q  +  + L    +   Y+V      +I S   DG L I
Sbjct: 209 TIKVWDY--------QTKSNVATLEGHMANVSYAVFHPTLPIIISGSEDGTLKI 254

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 65/144 (45%), Gaps = 10/144 (6%)

Query: 89  IRIWKDFDDDWQ-CAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDD 147
           I +W   D D +   A L GHE  V C  F      L   S S+D  V++WKY     + 
Sbjct: 37  IALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDIL--VSASEDHHVKLWKY--KAPES 92

Query: 148 EQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHE--LA 205
           E++  +Q++  + +S  + S+  +  GLI    + GL++I+  + EG    I  HE  L 
Sbjct: 93  EELECIQTI--THYSHTIVSIE-TLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLP 149

Query: 206 HGVYETNVVKWTQIDGETLLVTGG 229
             V+         +  + LL  GG
Sbjct: 150 RNVFPLCFSLSNVVGNKYLLAIGG 173

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 85/197 (43%), Gaps = 33/197 (16%)

Query: 11  LLAIVEGHENEVKSVSWSHS----GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           L A +EGHE+ VKS+ + H      Y L + S+D+ + IW            + L + S+
Sbjct: 196 LAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIR--------TNDLIDDSE 247

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
           D +     + L+LL+S  +     I +D        A++ GH+   W S  +  ES L+L
Sbjct: 248 DDE-----TKLTLLSSKQHK--FHISEDLRIGINFEALIIGHDD--WVSSLQWHESKLQL 298

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-----IASTGS 181
            + + DT V IW    + ++   VW   S L    S+   + + S  G          G+
Sbjct: 299 LASTADTAVMIW----EPDESSGVWVCSSRLGEMSSKGASTATGSSGGFWSCLWFEENGA 354

Query: 182 DGLLAIYQEKEEGKWEI 198
           D +L      + G W I
Sbjct: 355 DYILT---NGKTGSWRI 368

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSV--WIWEADEYGEEFECISVLQEHSQDV 68
           + A ++GHE EV  V +      L + S D  V  W ++A E  EE ECI  +  +S  +
Sbjct: 50  IYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPE-SEELECIQTITHYSHTI 108

Query: 69  KHVVWHSVLSLLASSSYDDTIRIW 92
             V   ++  L+   S    + IW
Sbjct: 109 --VSIETLAGLIVIGSAGGLVSIW 130

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 85/216 (39%), Gaps = 58/216 (26%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH +   S+++S  G  + T + D  + +W+       F C++  +EH+  V  V +  
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDV---ASGF-CLATFEEHTSAVTAVQFAK 393

Query: 76  VLSLLASSSYDDTIRIW-----KDF-------DDDWQCAAV------------------- 104
              +L S+S D T+R W     ++F          + C AV                   
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 105 -----------LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWAL 153
                      L+GHEG V C  F  S  +  L S S D T+RIW     ++  E +   
Sbjct: 454 WSVQTGQLLDTLSGHEGPVSCLAF--SMENAVLASASWDKTIRIWSIFGRSQQVEPLEVF 511

Query: 154 QSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIY 188
             +L         +++ +P G  +A +   G L I+
Sbjct: 512 ADIL---------AITITPDGKHVAVSTLKGQLTIF 538

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 9/124 (7%)

Query: 24  SVSWSHSGYYLATCSRDKSVWIWEADEYGEE-----FECISVLQEHSQDVKHVVWHSVLS 78
           SV +S  G Y A  +  + + IW+  +  ++     F    V   H QD+    W     
Sbjct: 101 SVKFSPDGRYFA-LAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSR 159

Query: 79  LLASSSYDDTIRIWK-DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRI 137
            L ++S D T R+W  + +D    A  L GH   V  + F  ++   ++ + S D  V  
Sbjct: 160 FLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQE--KIYTISKDGAVFT 217

Query: 138 WKYI 141
           W+YI
Sbjct: 218 WEYI 221

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE-----H 64
           +LL  + GHE  V  +++S     LA+ S DK++ IW      ++ E + V  +      
Sbjct: 460 QLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIFGRSQQVEPLEVFADILAITI 519

Query: 65  SQDVKHV 71
           + D KHV
Sbjct: 520 TPDGKHV 526

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH  ++ S +WSH   +L T S+D +  +W  +   +E    + L  H   V    ++S 
Sbjct: 144 GHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKEL-VATTLAGHRDYVLGAYFNST 202

Query: 77  LSLLASSSYDDTIRIW 92
              + + S D  +  W
Sbjct: 203 QEKIYTISKDGAVFTW 218

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 70/184 (38%), Gaps = 48/184 (26%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + + ++++S  G  + T + D  + IW+         C++  +EH+  V  V +  
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIWDI----VSGFCLATFEEHTSSVTSVQFAK 408

Query: 76  VLSLLASSSYDDTIRIWK-----------------------DFDDDWQCAA--------- 103
              ++ SSS D T++ W                        D   +  CA          
Sbjct: 409 NGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQV 468

Query: 104 ----------VLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWAL 153
                      L+GHEG V C  F +  S   L S S D T+R+W     ++  E + A 
Sbjct: 469 WSVQTGQLLDTLSGHEGPVSCLSFSRENSI--LASASWDKTIRVWSIFGRSQQVEPIEAY 526

Query: 154 QSVL 157
             VL
Sbjct: 527 SDVL 530

 Score = 31.6 bits (70), Expect = 0.61,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIW 46
           +LL  + GHE  V  +S+S     LA+ S DK++ +W
Sbjct: 475 QLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVW 511

>Scas_713.50
          Length = 983

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 4/82 (4%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
            H++ + +V +    +   +CS+D  +  W+    G++FECI  L  H  +V  +   + 
Sbjct: 651 AHQDSIMNVKFVPESHNFFSCSKDGIIKYWD----GDKFECIQKLAAHQSEVWALAIAND 706

Query: 77  LSLLASSSYDDTIRIWKDFDDD 98
            S + SSS+D +IRIW++ +D+
Sbjct: 707 ASFVVSSSHDHSIRIWEETEDE 728

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 8/127 (6%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+  V S+  S     + T S DK++ IW  D +G+   C   L  H   + +V +   
Sbjct: 609 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLD-FGD---CHKSLFAHQDSIMNVKFVPE 664

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                S S D  I+ W    D ++C   L  H+  VW        S +   S S D ++R
Sbjct: 665 SHNFFSCSKDGIIKYWDG--DKFECIQKLAAHQSEVWALAIANDASFV--VSSSHDHSIR 720

Query: 137 IWKYIED 143
           IW+  ED
Sbjct: 721 IWEETED 727

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
           H   +LLA    D  +++W  +     C   LNGH   +    F+ S +  RL SGS D+
Sbjct: 115 HKETNLLAVGYNDGVVKVWDLYSKTVLCN--LNGHSSAITALKFDTSGT--RLISGSRDS 170

Query: 134 TVRIWKYIED 143
            + +W  + +
Sbjct: 171 NIIVWDLVSE 180

 Score = 34.3 bits (77), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 16/142 (11%)

Query: 9   TELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD-----EYGEEFECISVLQE 63
           T++  I E H+  + S+  +  G  L T S DKSV  W          G   + +  L  
Sbjct: 501 TQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGL 560

Query: 64  H-------SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSD 116
           H       S D+  V        LA S  D+T++++  F D  +    L GH+  V   D
Sbjct: 561 HHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSID 618

Query: 117 FEKSESSLRLCSGSDDTTVRIW 138
              S  S  + + S D  ++IW
Sbjct: 619 I--SFDSKMIITSSADKNIKIW 638

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 57/139 (41%), Gaps = 21/139 (15%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE-ADEYGEEFECISVLQEHSQDVK 69
           +L  + GH + + ++ +  SG  L + SRD ++ +W+   E G     +  L+ H   + 
Sbjct: 140 VLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVG-----LYKLRSHKDAIT 194

Query: 70  HVVWHSV---------LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
            +  + V         L  L S+S D  I+IW D     QC      H G  W       
Sbjct: 195 GIWCNEVTNNNQEENELDWLISTSKDGLIKIW-DLKIQ-QCVETHIAHTGECWSLAVRND 252

Query: 121 ESSLRLCSGSDDTTVRIWK 139
                + + S D+ V+ W+
Sbjct: 253 ----LVITTSSDSQVKFWQ 267

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           YL T S D++V +W+     +   C++ L+ H  +V + V+H +L ++ S S D T++IW
Sbjct: 200 YLITSSDDRTVKVWDY----QTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIW 255

Query: 93  KDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
               + ++    LN      WC     +     + +G D+
Sbjct: 256 N--SNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDN 293

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 86/203 (42%), Gaps = 24/203 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVL 61
           WN E    L    EGHE+ V SV+++       AT   D +V IW   +    F   + L
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHL 183

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQ---CAAVLNGHEGTVWCSDFE 118
           ++    V +  +     L+ SS  D T+++W     D+Q   C A L GH   V  + + 
Sbjct: 184 EKGVNFVDYYPFQDKPYLITSSD-DRTVKVW-----DYQTKSCVATLEGHLSNVSYAVYH 237

Query: 119 KSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG---L 175
                  + SGS+D TV+IW        +   + L+  L     R+ + V+  PTG    
Sbjct: 238 PMLPI--IISGSEDGTVKIW--------NSNTYKLERTLNLGLERS-WCVAAHPTGKRNF 286

Query: 176 IASTGSDGLLAIYQEKEEGKWEI 198
           IA+   +G   +    +E +  +
Sbjct: 287 IAAGFDNGFTVLAIGNDEPRLSL 309

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 101/237 (42%), Gaps = 23/237 (9%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E +TE+ +I    E  V++  +     ++   S D  + ++  +  GE+   +   +
Sbjct: 40  WNYETQTEVRSI-SVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNT-GEK---VVDFE 94

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   ++ +  H   S + S+S D T+++W +++ +W       GHE  V    F   + 
Sbjct: 95  AHPDYIRALAVHPTRSYVLSASDDLTVKLW-NWEKNWALEQTFEGHEHFVMSVTFNPKDP 153

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSD 182
           +    +   D TV+IW   ++  +    + L++ L    +   Y        LI S+  D
Sbjct: 154 N-TFATACLDHTVKIWSLGQETSN----FTLRAHLEKGVNFVDYYPFQDKPYLITSS-DD 207

Query: 183 GLLAIYQEKEEGKWEIIAQH--ELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
             + ++  + +     +  H   +++ VY   +          ++++G +DG V IW
Sbjct: 208 RTVKVWDYQTKSCVATLEGHLSNVSYAVYHPML---------PIIISGSEDGTVKIW 255

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 93/231 (40%), Gaps = 25/231 (10%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSV--WIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           E H + +++++   +  Y+ + S D +V  W WE +   E+       + H   V  V +
Sbjct: 94  EAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQ-----TFEGHEHFVMSVTF 148

Query: 74  HSV-LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGH-EGTVWCSDFEKSESSLRLCSGSD 131
           +    +  A++  D T++IW    +       L  H E  V   D+   +    L + SD
Sbjct: 149 NPKDPNTFATACLDHTVKIWSLGQE--TSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSD 206

Query: 132 DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQE- 190
           D TV++W Y        Q  +  + L    S   Y+V      +I S   DG + I+   
Sbjct: 207 DRTVKVWDY--------QTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSN 258

Query: 191 --KEEGKWEIIAQHE---LAHGVYETNVVKWTQIDGETLLVTGGDDGCVNI 236
             K E    +  +      AH   + N +     +G T+L  G D+  +++
Sbjct: 259 TYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFTVLAIGNDEPRLSL 309

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 106/239 (44%), Gaps = 34/239 (14%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           I EGHE+ + S+  +  G ++AT S+D +  +W  +E   +F+  +    HS  V  V  
Sbjct: 383 IYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGL 442

Query: 74  HSVLS-----LLASSSYDDTIRIW----KDFDDDWQCAAV----LNGHEGTVWCSDFEKS 120
            +++S      L ++S D TI+ W         D Q   V     + HE  +       +
Sbjct: 443 PNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPN 502

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP-TGLIAST 179
           +S     + S D T +IW  +E+ E       L++ L + H R ++ VS+     L+A++
Sbjct: 503 DSI--FATASYDKTCKIWN-LENGE-------LEATL-ANHKRGLWDVSFCQYDKLLATS 551

Query: 180 GSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVV-KWTQIDGETLLVTGGDDGCVNIW 237
             D  + I+        + +  H        TN V + + I+ +  L++ G DG + IW
Sbjct: 552 SGDKTVKIWSLDTFSVMKTLEGH--------TNAVQRCSFINKQKQLISCGADGLIKIW 602

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E   EL A +  H+  +  VS+      LAT S DK+V IW  D     F  +  L+
Sbjct: 518 WNLE-NGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLD----TFSVMKTLE 572

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
            H+  V+   + +    L S   D  I+IW       +C   L+GH   +W 
Sbjct: 573 GHTNAVQRCSFINKQKQLISCGADGLIKIWD--CSSGECLKTLDGHNNRLWA 622

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 65/142 (45%), Gaps = 21/142 (14%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           LL    GH   V S++++  G  L T S D+S+ IW+    G   + IS    HS+ V  
Sbjct: 88  LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLN-GSLMKTIS---AHSEAVVS 143

Query: 71  V-VWHSVLSLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVWCSDFEK 119
           V V  +  S+L+S SYD  IRI+            +D DW+         G V  S  + 
Sbjct: 144 VDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWK------RENGVVPISQVKF 197

Query: 120 SESSLRLCSGSDDTTVRIWKYI 141
           SE++  L   S D  V+IW  I
Sbjct: 198 SENARYLLVKSLDGVVKIWDCI 219

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 8/126 (6%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
            +V  H      + WS  G  +AT S D SV I     YG     +     H+  V  + 
Sbjct: 49  TLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHL-SYG----LLHTFIGHTAPVISLT 103

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           ++   +LL +SS D++I+IW   +        ++ H   V   D   ++SS+ L SGS D
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDTLNGSLM--KTISAHSEAVVSVDVPMNDSSI-LSSGSYD 160

Query: 133 TTVRIW 138
             +RI+
Sbjct: 161 GLIRIF 166

>Kwal_56.23920
          Length = 937

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+  V S+  S     L T S DK++ IW  D +G   +C   L  H+  +  VV+   
Sbjct: 565 GHKLPVLSIDISFDSKLLITSSADKNIKIWGLD-FG---DCHRSLFAHNDSIMKVVFVPE 620

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                S S D  ++ W    D ++C   L  H+  VW      S     + S S D ++R
Sbjct: 621 SHNFFSCSKDALVKYWD--GDKFECIQKLAAHQKEVWT--LAISSDGRFVVSASHDQSIR 676

Query: 137 IWKYIEDNEDDEQVW 151
           +W     +E D+QV+
Sbjct: 677 VW-----SETDDQVF 686

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 60/141 (42%), Gaps = 17/141 (12%)

Query: 11  LLAIVEG-HENEVKSVSWSHSGYYLATCSRDKSVWIWE-----------ADEYGEEFECI 58
           LL  +EG H   + S+  +  G  L T S DK+V  W+            D++  + +  
Sbjct: 458 LLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMF 517

Query: 59  -SVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
                E + DV  V       LLA S  D+T++++  F D  +    L GH+  V   D 
Sbjct: 518 HDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVF--FMDSMKFFLSLYGHKLPVLSIDI 575

Query: 118 EKSESSLRLCSGSDDTTVRIW 138
             S  S  L + S D  ++IW
Sbjct: 576 --SFDSKLLITSSADKNIKIW 594

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 77/182 (42%), Gaps = 50/182 (27%)

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVL---NGHEGTVWCSDFEKSESSLRL 126
           ++ +H    LLA    D  I+IW     D    +VL   NGH+  +    F+++ +  RL
Sbjct: 80  YLQYHPETRLLAVGYNDGAIKIW-----DLLSKSVLISFNGHKSAITILTFDQTGT--RL 132

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-------IAST 179
            SGS D+ + +W  +     +  ++ L+S     H  ++       TGL       + ST
Sbjct: 133 ISGSRDSDIIVWDLV----GEVGLYKLRS-----HKDSI-------TGLWCEGEEWLIST 176

Query: 180 GSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVK----WTQIDGETLLVTGGDDGCVN 235
             DGL+ +        W++  Q        ET+V      W+    E L++T G D  + 
Sbjct: 177 SKDGLIKV--------WDLKVQQ-----CVETHVAHVGECWSMGVHEDLVITAGADNQIK 223

Query: 236 IW 237
           +W
Sbjct: 224 LW 225

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 20/131 (15%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDK-SVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           + GH ++V+++  S     LAT S     +W  + +     FEC   L          + 
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYAL------ACKFLP 434

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLN----GHEGTVWCSDFEKSESSLRLCSG 129
              L +L + + D  + ++     D   + +LN     H G +W  D   +    RL +G
Sbjct: 435 GGALVVLGTKTGD--LHLY-----DLASSTLLNTIEGAHSGAIWSLDM--TTDGKRLVTG 485

Query: 130 SDDTTVRIWKY 140
           S D TV  W +
Sbjct: 486 SADKTVCFWDF 496

>Scas_558.3
          Length = 725

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 97/233 (41%), Gaps = 25/233 (10%)

Query: 8   ETELLAIVEG-HENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           E +LL    G H + ++++    SG  +ATCS D ++ I + D   ++     VL  H  
Sbjct: 171 ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGNIKQ-----VLSGHES 225

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
            V +V        L S   D ++RIW D ++++    V+     ++WC D   +   +  
Sbjct: 226 FVYNVKLSKQGDKLVSCGEDRSLRIW-DINNNFNIKQVIKLPAVSIWCVDTLPNGDIVVG 284

Query: 127 CSGSDDTTVRIW-----KYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS 181
           CS   D TVRI+     +    +E DE    L+S   ++ +        SP  ++   G 
Sbjct: 285 CS---DNTVRIFTEDQTRVASQSEIDEFTKQLESTSINSQTMDFDESKLSPYEILQKPG- 340

Query: 182 DGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCV 234
                    K+EG+  ++         Y  +  KW+++       TG +D  V
Sbjct: 341 ---------KKEGQVVVVKAPSGVIEAYLYSSEKWSKVGDVVSSSTGSNDKKV 384

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD 49
           S+++  +  ++ GHE+ V +V  S  G  L +C  D+S+ IW+ +
Sbjct: 210 SDLDGNIKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDIN 254

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 6/49 (12%)

Query: 55  FECISVLQEHSQDVKHVVWHSVL--SLLASSSYDDTIRIWKDFDD-DWQ 100
           ++  + L  H+QDVK +V   V+  S +AS S D T+R+WK  D+  WQ
Sbjct: 2   YQLSATLLGHTQDVKDIV---VIDDSQVASVSRDGTLRLWKHNDNGTWQ 47

>Kwal_23.5769
          Length = 627

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 68/153 (44%), Gaps = 18/153 (11%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L+  + GH + VK++ +   G  L T S D+ + +W          C++    HS  V 
Sbjct: 348 KLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVL 401

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V   S   ++ S S D T+++W     + +    L GH  T W    +    S    SG
Sbjct: 402 SV--DSYKKIIVSGSADKTVKVWHV---ESRTCYTLRGH--TEWVGTVKLHPKSFTCFSG 454

Query: 130 SDDTTVRIWKYIEDNEDDE----QVWALQSVLP 158
           SDDTT+R+W  I  N   +     V  +Q VLP
Sbjct: 455 SDDTTIRMWD-IRSNTCVKVFRGHVGQVQKVLP 486

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 78  SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRI 137
           S L S S D+TI++W+      +C     GH   +W    + +  + R+ SG+ D TV++
Sbjct: 530 SHLLSCSLDNTIKLWEV--RTGKCVRTHFGHVEGIW----DIAADNFRIVSGAHDKTVKV 583

Query: 138 W 138
           W
Sbjct: 584 W 584

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LL + SYD T+ IW D     +    L GH   V    F+      +L +GS D  +R+W
Sbjct: 329 LLFTGSYDSTVAIW-DLATG-KLVRRLTGHRDGVKAIYFDGQ----KLITGSLDRMIRVW 382

Query: 139 KYI 141
            Y+
Sbjct: 383 NYV 385

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 58/129 (44%), Gaps = 13/129 (10%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L+  + GH + VK++ +      L T S DK++ +W          C+S  + H   V 
Sbjct: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVL 343

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V   S   L+ S S D T+++W     + +    L GH G V C        S    SG
Sbjct: 344 SV--DSFRKLIVSGSADKTVKVWHV---ESRTCYTLRGHTGWVNCVKLH--PKSFTCFSG 396

Query: 130 SDDTTVRIW 138
           SDD T+R+W
Sbjct: 397 SDDMTIRMW 405

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LL + SYD T+ IW D     +    L+GH   V    F+      +L +GS D T+R+W
Sbjct: 271 LLLTGSYDSTVAIW-DLATG-KLIRRLSGHTDGVKALRFDDQ----KLITGSLDKTIRVW 324

Query: 139 KYI 141
            Y+
Sbjct: 325 NYV 327

>Kwal_56.24163
          Length = 729

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           YL T S D++V IW+     +   C++ L+ H  +V + V+H  L ++ S S D T+++W
Sbjct: 57  YLITSSDDRTVKIWDY----QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVW 112

Query: 93  KDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
               + ++    LN      WC     +     + SG D+
Sbjct: 113 N--SNTYKLEKTLNLGLERSWCIATHPTGKRNYIASGFDN 150

 Score = 30.8 bits (68), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 43/111 (38%), Gaps = 11/111 (9%)

Query: 78  SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGT-VWCSDFEKSESSLRLCSGSDDTTVR 136
           S  AS+  D T++IW            L  HE   V   D+   +    L + SDD TV+
Sbjct: 11  STFASACLDHTVKIWSL--GQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVK 68

Query: 137 IWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAI 187
           IW Y        Q  +  + L    +   Y+V      +I S   DG L +
Sbjct: 69  IWDY--------QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKV 111

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
            H++ + +V +    +   +CS+D  V  W+    GE+FECI  L  H  +V  +   + 
Sbjct: 613 AHQDSIMNVKFLPQSHNFFSCSKDAVVKYWD----GEKFECIQKLYAHQSEVWALAVATD 668

Query: 77  LSLLASSSYDDTIRIWKDFDD 97
              + SSS+D +IRIW++ +D
Sbjct: 669 GGFVVSSSHDHSIRIWEETED 689

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 8/127 (6%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+  V S+  S     + T S DK++ IW  D +G   +C   L  H   + +V +   
Sbjct: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLD-FG---DCHKSLFAHQDSIMNVKFLPQ 626

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                S S D  ++ W    + ++C   L  H+  VW      +     + S S D ++R
Sbjct: 627 SHNFFSCSKDAVVKYWD--GEKFECIQKLYAHQSEVWA--LAVATDGGFVVSSSHDHSIR 682

Query: 137 IWKYIED 143
           IW+  ED
Sbjct: 683 IWEETED 689

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 68/172 (39%), Gaps = 36/172 (20%)

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVL---NGHEGTVWCSDFEKSESSLRLCSGS 130
           H    LLA    D  I++W     D     VL   NGH+  +    F+ + +  RL SGS
Sbjct: 88  HKDTDLLAVGYADGVIKVW-----DLMSKTVLLNFNGHKAAITLLQFDGTGT--RLISGS 140

Query: 131 DDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQE 190
            D+ + +W  +     +  ++ L+S     H  ++          + ST  DG++ ++  
Sbjct: 141 KDSNIIVWDLV----GEVGLYKLRS-----HKDSITGFWCQGEDWLISTSKDGMIKLWDL 191

Query: 191 KEEGKWEIIAQHELAHGVYETNVVK----WTQIDGETLLVTGGDDGCVNIWK 238
           K              H   ET++      W     + LL+T G D  V IWK
Sbjct: 192 K-------------THQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWK 230

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 58/145 (40%), Gaps = 40/145 (27%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYG--EEFEC-------------IS 59
           ++G   +V+S+  S     LAT S + S+ IW    +     FEC             + 
Sbjct: 387 LQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLV 445

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           +L   + +++       L  LASSS  DTI                + H+  +W  D   
Sbjct: 446 ILGTRNGELQ-------LFDLASSSLLDTIE---------------DAHDAAIWSLDL-- 481

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDN 144
           +    RL +GS D TV+ W +  +N
Sbjct: 482 TSDGKRLVTGSADKTVKFWDFKVEN 506

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 16/137 (11%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD-----EYGEEFECISVLQEH---- 64
           I + H+  + S+  +  G  L T S DK+V  W+         G + + + VL+ H    
Sbjct: 468 IEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTT 527

Query: 65  ---SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
              + D+  V        LA S  D+T++++  F D  +    L GH+  V   D   S 
Sbjct: 528 LELTDDILCVRVSPDDRYLAISLLDNTVKVF--FLDSMKFYLSLYGHKLPVLSIDI--SF 583

Query: 122 SSLRLCSGSDDTTVRIW 138
            S  + + S D  ++IW
Sbjct: 584 DSKMIITSSADKNIKIW 600

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 13/142 (9%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           M   +L    GH+  +  + +  +G  L + S+D ++ +W  D  GE    +  L+ H  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVW--DLVGE--VGLYKLRSHKD 164

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
            +    W      L S+S D  I++W D     QC      H G  W       +  L +
Sbjct: 165 SITG-FWCQGEDWLISTSKDGMIKLW-DLKTH-QCIETHIAHTGECWGL---AVKDDLLI 218

Query: 127 CSGSDDTTVRIWKYIEDNEDDE 148
            +G+ D+ V+IWK   D E+D+
Sbjct: 219 TTGT-DSQVKIWKL--DIENDK 237

>Kwal_27.11585
          Length = 823

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 95/239 (39%), Gaps = 71/239 (29%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
            +E EL    EGH + + S+  S +G +LATCS+D +V +W+ +   E+F+  +    H+
Sbjct: 390 PLEVELY---EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHA 446

Query: 66  QDVKHVVWHSVLS-----LLASSSYDDTIRIW--------------------------KD 94
             V  V   +V+       + ++S D TI+ W                          KD
Sbjct: 447 GPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKD 506

Query: 95  FD-------------------------DDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            +                         D  +    L  H+  +W   F + +  L  CSG
Sbjct: 507 INALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSG 566

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW-SPTGLIASTGSDGLLAI 187
             D T+++W         E +  ++++    H+ AV   S+ +    I STG+DGL+ +
Sbjct: 567 --DKTIKVWSL-------ESMSVVKTL--EGHTNAVQRCSFINRNKQIVSTGADGLIKV 614

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           EL   +  H+  +  V++      LATCS DK++ +W      E    +  L+ H+  V+
Sbjct: 537 ELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSL----ESMSVVKTLEGHTNAVQ 592

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
              + +    + S+  D  I++W D     +C   L+ H   +W 
Sbjct: 593 RCSFINRNKQIVSTGADGLIKVW-DL-STGECIRTLDAHSNRIWA 635

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 54/129 (41%), Gaps = 29/129 (22%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
            W+  M   L+ ++ G    + SV+   SGYY+AT S+DKS+ IW+   + E        
Sbjct: 247 LWSPSMPEPLVKLLSG-RGPINSVAVDRSGYYMATVSQDKSLKIWDIRNFKE-------- 297

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
                       HSV + L +   + TI        D    AV  G   T+W  D  KS 
Sbjct: 298 -----------LHSVEN-LPTPGTNVTI-------SDTGVLAVSRGPHVTLW-KDALKSS 337

Query: 122 SSLRLCSGS 130
            S R C GS
Sbjct: 338 KSARPCFGS 346

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 90/225 (40%), Gaps = 28/225 (12%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L   ++GH   V+ +  S    Y+ + S+DK V  W+     E    +         V 
Sbjct: 147 KLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDL----ERNTVVRDFHGTLSGVH 202

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V  H  L L+ S+  D  +R+W        C   L GH G +  +         ++ S 
Sbjct: 203 SVDLHPSLDLIVSAGRDSVVRVWD--IRSRSCVLTLAGHRGPI--NKVRCLPVDPQIVSC 258

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIY 188
           S D TV++W  +           ++++  + H R V  ++++PT    AS  +D + +  
Sbjct: 259 STDATVKLWDLVAGK-------PMKTL--THHKRNVRDLAFNPTEFSFASACTDDIRS-- 307

Query: 189 QEKEEGKWEIIAQHELAHGVYET-NVVKWTQIDGETLLVTGGDDG 232
                  W+++    L +   E   +V     + + +L  GGD G
Sbjct: 308 -------WKLVDGQLLTNFNSEALGIVNTLACNQDGVLFAGGDTG 345

 Score = 31.2 bits (69), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 81  ASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           A + Y++ +     +   W+   V+NGH G V C   +  +++    +GS+D+T+R+W
Sbjct: 85  ALARYEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVDNAW-FATGSNDSTIRVW 141

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE 47
           ++ET  +      E  V + ++  +G  L TC RDKS+ IW+
Sbjct: 360 KLETTAMPGSLESEKGVLASTFDRTGLRLLTCERDKSIKIWK 401

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 8/134 (5%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           A ++GHE EV  V +     ++ + S D  V IW+  +Y    +CI  +Q +S+ +  V 
Sbjct: 53  ATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS-HLQCIQTIQHYSKTI--VA 109

Query: 73  WHSVLSLLASSSYDDTIRIWKDF--DDDWQCAAVLNGHEGTVW--CSDFEKSESSLRLCS 128
             ++ SL++    D TI IW+    +D++  A      +G  +  C    K E    L +
Sbjct: 110 LSALPSLISVGCADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLA 169

Query: 129 -GSDDTTVRIWKYI 141
            G  +  V I  +I
Sbjct: 170 IGGTNVNVFIASFI 183

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 81/174 (46%), Gaps = 33/174 (18%)

Query: 10  ELLAIVEGHENEVKSVSWSHS----GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
            ++A +EGHE+ VKS+++ H      Y L + S+D+ + +W             ++ +  
Sbjct: 193 RVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWR-------IRINDLIDDSE 245

Query: 66  QDVKHVVWHSVLSLLASSSY----DDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
           +D K       L+LL++  Y    DD +R+  +F+      A++ GH+   W S  +  E
Sbjct: 246 EDSKK------LTLLSNKQYKFQIDDELRVGINFE------ALIMGHDD--WISSLQWHE 291

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL 175
           S L+L + + DT++ +W    + ++   +W     L    S+   + + S  G 
Sbjct: 292 SRLQLLAATADTSLMVW----EPDETSGIWVCSLRLGEMSSKGASTATGSSGGF 341

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 83/167 (49%), Gaps = 15/167 (8%)

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCA-AVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           H V  ++A  +   TI +W   + + +   A L GHE  V C  F     S  + S S+D
Sbjct: 24  HKVKKIVAFGA-GKTIALWDPIEPNNKGVYATLKGHEAEVTCVRF--VPDSDFMVSASED 80

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEK- 191
             V+IWK+     D   +  +Q++    +S+ + ++S  P+ LI+   +DG ++I+++  
Sbjct: 81  HHVKIWKFT----DYSHLQCIQTI--QHYSKTIVALSALPS-LISVGCADGTISIWRQNI 133

Query: 192 EEGKWEIIAQHELAHGVYETNVVKWTQI-DGETLLVTGGDDGCVNIW 237
           +  ++ +  +  +  G +    +  +++ + + LL  GG +  VN++
Sbjct: 134 QNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLAIGGTN--VNVF 178

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 98/234 (41%), Gaps = 19/234 (8%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEE--FECISVLQEHSQDVKHVVWH 74
           GH  E+  +  S     +A+  R  +V       +  E   E    L  HS  +  + + 
Sbjct: 556 GHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKPALPFHSLTITRLKFS 615

Query: 75  SVLSLLASSSYDDTIRIW-KDFDDDWQCAAVLN--GHEGTVWCSDFEKSESSLRLCSGSD 131
                L S   D    +W ++ +D+       N   H   +W +D+   E      + S 
Sbjct: 616 KDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASR 675

Query: 132 DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-----LIASTGSDGLLA 186
           D TV++W++ ++  DD   + L++ +   H++AV ++S   +      LI+    +G + 
Sbjct: 676 DKTVKVWRHQKEPADD---YVLEASI--KHTKAVTAISIHDSMIREKILISVGLENGEIY 730

Query: 187 IYQEKEEGKWEIIAQ-HELAHGVYETNVVKWTQI--DGETLLVTGGDDGCVNIW 237
           +Y     GK+E+I Q +E      +   ++W+ +  +G+  L  G  D    I+
Sbjct: 731 LYS-YTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLSTRIY 783

 Score = 27.7 bits (60), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/90 (17%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           E+   +  H   +  + +S  G +L +  RD+   +WE +     FE   +  ++ +   
Sbjct: 597 EIKPALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFE---LRFKNEKPHT 653

Query: 70  HVVWHS------VLSLLASSSYDDTIRIWK 93
            ++W +        ++  ++S D T+++W+
Sbjct: 654 RIIWDADWAPLEFGNVFVTASRDKTVKVWR 683

>Scas_442.2*
          Length = 795

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 8/152 (5%)

Query: 88  TIRIWKDFDDDWQ-CAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNED 146
           TI +W   D++ Q   A L GHE  V C  F      +  C  S+D  V+IWK       
Sbjct: 37  TIALWNPLDENSQGVFATLKGHEAEVTCVKFITDTPYMVSC--SEDHHVKIWKQNPGVAR 94

Query: 147 DEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIY-QEKEEGKWEIIAQHELA 205
           +   W     L   +S  V +++  P GLIA   +DG ++++ Q+ +E  + +  + E+ 
Sbjct: 95  EVDGWTCVQTL-DHYSHTVVALAVLP-GLIAVGCADGKVSLWVQKMKEDVFILGEEFEVQ 152

Query: 206 HGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            GV    +     ID + LL  GG +  VN++
Sbjct: 153 KGVLPLALAFSKVIDDKYLLAVGGTN--VNVF 182

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 70/138 (50%), Gaps = 25/138 (18%)

Query: 10  ELLAIVEGHENEVKSVSWSH----SGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           +L A +EGHE+ +KS+++ H      Y L + S+D+ + +W             ++++  
Sbjct: 199 QLAAKLEGHEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLW-------RIRINDLMKKQD 251

Query: 66  QDVKHVVWHSVLSLLASSSYD----DTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
           +D + +   + L+LL +  Y     D +R+  +F+      A++ GH+   W S  +  E
Sbjct: 252 EDDEDIA--TKLALLNNKQYKFHVTDALRVCINFE------ALIMGHDD--WISSLQWHE 301

Query: 122 SSLRLCSGSDDTTVRIWK 139
           + L+L + + DT + +W+
Sbjct: 302 TRLQLLASTADTALMVWE 319

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 79/226 (34%), Gaps = 73/226 (32%)

Query: 3   WNS--EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE-YGEEFE--- 56
           WN   E    + A ++GHE EV  V +     Y+ +CS D  V IW+ +     E +   
Sbjct: 41  WNPLDENSQGVFATLKGHEAEVTCVKFITDTPYMVSCSEDHHVKIWKQNPGVAREVDGWT 100

Query: 57  CISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW------------------------ 92
           C+  L  +S  V  V    +  L+A    D  + +W                        
Sbjct: 101 CVQTLDHYSHTV--VALAVLPGLIAVGCADGKVSLWVQKMKEDVFILGEEFEVQKGVLPL 158

Query: 93  -----KDFDDDW----------------------------QCAAVLNGHEGTVWCSDFEK 119
                K  DD +                            Q AA L GHE  +    F  
Sbjct: 159 ALAFSKVIDDKYLLAVGGTNVNVFVFSFVLNATAETIETLQLAAKLEGHEDWIKSLAFRH 218

Query: 120 SESS--LRLCSGSDDTTVRIWKY-IED-----NEDDEQVWALQSVL 157
            E+     LCSGS D  +R+W+  I D     +EDDE +    ++L
Sbjct: 219 QETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDEDDEDIATKLALL 264

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 65/148 (43%), Gaps = 14/148 (9%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           +N++   E+   +  H   V  + +S    YL +  RD+   +WE D   ++F   ++  
Sbjct: 600 FNTDNWLEVKPPLAFHTLTVTKLRFSPDSKYLLSVCRDRQWVVWERDPETDKF---TLKY 656

Query: 63  EHSQDVKHVVWHS------VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSD 116
           + ++    ++W          ++  + S D TI++WK FD++     + N    T   + 
Sbjct: 657 KTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWK-FDENKSNFDLENSLNMTSLVTA 715

Query: 117 FEKSES----SLRLCSGSDDTTVRIWKY 140
               +S     L +  G +D ++ I+KY
Sbjct: 716 LSVXDSVLDGRLLIAXGLEDGSIYIYKY 743

 Score = 32.0 bits (71), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 77/196 (39%), Gaps = 22/196 (11%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKS-----VWIWEADEYGEEFECISVLQEHSQDVKHV 71
           GH  E+  +  S  G ++A+  R  +     V I+  D +    E    L  H+  V  +
Sbjct: 566 GHGYEITCLDVSPDGKFIASACRSNTPQHAVVRIFNTDNW---LEVKPPLAFHTLTVTKL 622

Query: 72  VWHSVLSLLASSSYDDTIRIWK------DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLR 125
            +      L S   D    +W+       F   ++ A     H   +W  D+   E    
Sbjct: 623 RFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTA---KPHTRIIWDGDWAPLEFGNV 679

Query: 126 LCSGSDDTTVRIWKYIED--NEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDG 183
             +GS D T+++WK+ E+  N D E    + S++ +    +V         LIA    DG
Sbjct: 680 FVTGSRDRTIKLWKFDENKSNFDLENSLNMTSLVTAL---SVXDSVLDGRLLIAXGLEDG 736

Query: 184 LLAIYQEKEEGKWEII 199
            + IY+      ++++
Sbjct: 737 SIYIYKYDSTSGFDVV 752

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE 50
           A++ GH++ + S+ W  +   L   + D ++ +WE DE
Sbjct: 285 ALIMGHDDWISSLQWHETRLQLLASTADTALMVWEPDE 322

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 82/194 (42%), Gaps = 12/194 (6%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           +EGHE  +     S  G  +A+CS D+S+ +W   E GE+   + +   H+  +  + + 
Sbjct: 177 LEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSL-ETGEQ---VGIAWGHTARIWDLRFL 232

Query: 75  SVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE-GTVWCSDFEKSESSLRLCSGSDDT 133
            V   L S S D T R+W    +  Q  AV + H+  +VW  D +  E  +   +  +D 
Sbjct: 233 RVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDVQ--EDDMVAVTAGNDG 290

Query: 134 TVRIWKYIEDNEDDEQVWALQS-VLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEKE 192
            +R+         +     L +  L +          W   G IA T    +L   Q + 
Sbjct: 291 RLRLVDLTRPGSRERPAIDLTTEGLYNMDHTTFKGFCWFERGPIAITSCGKIL---QRRM 347

Query: 193 EGKWE-IIAQHELA 205
            G+WE I+A   LA
Sbjct: 348 LGRWECILADQRLA 361

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
            H++ + +V +    Y   +CS+D +V  W+    G++FECI  L  H  +V  +   + 
Sbjct: 610 AHQDSIMNVKFLPESYNFFSCSKDATVKYWD----GQKFECIQKLAAHQSEVWSISVSND 665

Query: 77  LSLLASSSYDDTIRIWKDFDD 97
            + + S+ +D +IR+W++ +D
Sbjct: 666 GTFVISTGHDHSIRVWEETED 686

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 56/127 (44%), Gaps = 8/127 (6%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH+  V S+  S+    + TCS DK++ IW  D +G   +C   L  H   + +V +   
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD-FG---DCHKSLFAHQDSIMNVKFLPE 623

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
                S S D T++ W      ++C   L  H+  VW      S     + S   D ++R
Sbjct: 624 SYNFFSCSKDATVKYWD--GQKFECIQKLAAHQSEVWS--ISVSNDGTFVISTGHDHSIR 679

Query: 137 IWKYIED 143
           +W+  ED
Sbjct: 680 VWEETED 686

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 14/186 (7%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           +L    GH++ +  +++  +G  L + S+D  + +W  D  GE    +  L+ H +D   
Sbjct: 113 VLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVW--DLVGE--SGLYKLRSH-KDAIT 167

Query: 71  VVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGS 130
            +W    + L S+S D  ++IW D     QC      H G  W       E     CS  
Sbjct: 168 GLWCEDENWLISTSKDGLVKIW-DLKSQ-QCVETHLAHTGECWSLGI--IEDMAVTCSA- 222

Query: 131 DDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAV---YSVSWSPTGLIASTGSDGLLAI 187
            D+ V++WK     E+  ++     +   +  R V   ++V+           +D  + I
Sbjct: 223 -DSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEI 281

Query: 188 YQEKEE 193
           Y+ ++E
Sbjct: 282 YRLRKE 287

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 33/131 (25%)

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVL---NGHEGTVWCSDFEKSESSLRLCSG 129
           +H   +LLA+   D  I+IW     D     VL   NGH+  +    F+ + +  RL S 
Sbjct: 87  YHPETNLLAAGYADGVIKIW-----DLISKTVLISFNGHKSAITVLAFDTTGT--RLISA 139

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-------IASTGSD 182
           S D+ + +W  +     +  ++ L+S     H  A+       TGL       + ST  D
Sbjct: 140 SKDSDIIVWDLV----GESGLYKLRS-----HKDAI-------TGLWCEDENWLISTSKD 183

Query: 183 GLLAIYQEKEE 193
           GL+ I+  K +
Sbjct: 184 GLVKIWDLKSQ 194

>Scas_695.15
          Length = 327

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 6/129 (4%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEY--GEEFECISVLQEHSQDVKHV 71
           I +     ++S+S +  G  L   +     ++WE   +      + I+    H   +  V
Sbjct: 175 IPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRV 234

Query: 72  VWHSVLSLLASSSYDDTIRIWK--DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
           V  S +  +A+ S D T +IW   + +DD+     L+GH+  VW   F  S  S  L + 
Sbjct: 235 VLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAF--SADSAYLVTA 292

Query: 130 SDDTTVRIW 138
           S D  VR+W
Sbjct: 293 SSDHYVRLW 301

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           +A  EGH+  V SVS+     ++ T S D ++ +W+          +    +H+  V  V
Sbjct: 88  VATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDV-----RSPSVPRNYKHNAPVNEV 142

Query: 72  VWHSVLSLLASSSYDDTIRIW 92
           V H     L S   D TI+IW
Sbjct: 143 VIHPNQGELISCDRDGTIKIW 163

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 120/249 (48%), Gaps = 26/249 (10%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           + W+   ET++  ++ GHE  +  V+ S++G Y+A+CS D+S+ +W+  E G++   +SV
Sbjct: 162 IIWDLFSETKIHNLL-GHEGSIFYVNLSNNGRYVASCSDDRSIRLWDL-ETGKQ---LSV 216

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA--AVLNGHE----GTVWC 114
              H+  + ++++    S L S S D T R+W   +     A  ++ N +E     ++W 
Sbjct: 217 GWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNIIESRENVAELSISNVYEVHLIKSIWG 276

Query: 115 SDFEKSESSLRLCSGSDDTTVRI-WKYIEDNEDDEQVWALQSVLPSA-----HSRAVYSV 168
            D  K +  + + SG+D     I    ++ + D+E  ++L  +          + ++   
Sbjct: 277 VDV-KDDEMIAVTSGNDGRLKLIDLLQLKRHGDEETSFSLDDIAKQCGDIFEKNESIKGF 335

Query: 169 SWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHE------LAHGVYETNVVKWTQIDGE 222
            W   G+IA T S G +  Y +  + +W+++  +E      + +G+   N+  ++    +
Sbjct: 336 QWFSFGVIAIT-SLGKILKYSDVTK-QWKLLLTNEKFNSYPITNGIQTQNIAVFSNNKSD 393

Query: 223 TLLVTGGDD 231
            LL+    D
Sbjct: 394 ILLIKFSKD 402

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEADEY--GEEFECISVLQEHSQDVKHVVWHSVLS 78
            ++S+S +  G  L   +   + ++WE   +      +  +  + H   +  V+  S + 
Sbjct: 161 PLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVK 220

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
            +A+ S D T RIW   +D++   + L+GH+  VW   F  S  S  L + S D  VR+W
Sbjct: 221 HMATCSADHTARIWS-VEDNFNLESTLDGHQRWVWDCAF--SADSAYLVTASSDHYVRLW 277

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           +A  EGH   V SVS+     ++ T S D ++ +W+          +    +H+  V  V
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDI-----RSPSVPRNYKHNAPVNEV 122

Query: 72  VWHSVLSLLASSSYDDTIRIW 92
           V H     L S   D  IRIW
Sbjct: 123 VIHPNQGELISCDRDGNIRIW 143

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           + H + +  V  S    ++ATCS D +  IW  +   + F   S L  H + V    + +
Sbjct: 204 KAHPSYITRVLLSSDVKHMATCSADHTARIWSVE---DNFNLESTLDGHQRWVWDCAFSA 260

Query: 76  VLSLLASSSYDDTIRIW 92
             + L ++S D  +R+W
Sbjct: 261 DSAYLVTASSDHYVRLW 277

>Scas_605.18
          Length = 424

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 97/232 (41%), Gaps = 30/232 (12%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           ++GH N++    WS     + + S+D  + IW+    G +   I +    SQ V      
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTAS-GLKRNAIPL---DSQWVLSCALS 142

Query: 75  SVLSLLASSSYDDTI---RIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
              +L AS+  ++     R+ K+        ++  GH  T + SD E  ++S  + + S 
Sbjct: 143 PSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDIEFLDNS-HIITSSG 199

Query: 132 DTTVRIWKYIEDNEDDE------QVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLL 185
           D T  +W   +     E       V AL    PSA          +   + AS GSDG  
Sbjct: 200 DMTCALWDIPKAKRVREYADHLGDVLALALPPPSADEN-------TGANIFASCGSDGYT 252

Query: 186 AIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            I+  +        A  +      + N +++ + DG + +VTGGDDG +N++
Sbjct: 253 YIWDTRTSA-----AVQKFFASDTDVNAIQFFK-DGNS-IVTGGDDGVINMF 297

 Score = 31.2 bits (69), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD 49
           ++ E++  +EGH N V SV  S  G  + T S D ++ IW  +
Sbjct: 380 LKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPN 422

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 4/71 (5%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLA 81
           V S+ +S+SG  +  C  D    IW+      + E +  L+ HS  V  V        + 
Sbjct: 353 VVSLDFSNSGRLMFACYTDLGCIIWDV----LKAEIVGKLEGHSNRVSSVRTSPDGLGVC 408

Query: 82  SSSYDDTIRIW 92
           + S+D T+RIW
Sbjct: 409 TGSWDSTMRIW 419

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 5/120 (4%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEADEY--GEEFECISVLQEHSQDVKHVVWHSVLS 78
            ++S+S +  G  L   +   + ++W+   +      E ++  + H++ +  V+  + + 
Sbjct: 161 PLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVK 220

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
            LA+ S D T R+W + +D+++    L+GH+  VW  D   S  S  L +   D  VR+W
Sbjct: 221 HLATCSADHTARVW-NIEDNFELETTLDGHQRWVW--DCAFSADSAYLVTACSDHYVRLW 277

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 8/124 (6%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           EGH+  V S+++     ++ + S D ++ +W+          +    +H+  V  V  H 
Sbjct: 72  EGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDV-----RSPSVQRNYKHNAPVNEVAIHP 126

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
               L S   D  IRIW D  ++ QC   L   + T   S    S+ S+ L +G++    
Sbjct: 127 NQGELISCDQDGNIRIW-DLGEN-QCTNQLTPEDNTPLQSLSVASDGSM-LVAGNNKGNC 183

Query: 136 RIWK 139
            +WK
Sbjct: 184 YVWK 187

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 8/132 (6%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSH--SGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           W+    T    +  G E  V  V +       Y+ T S D ++ IW+     +   C++ 
Sbjct: 168 WSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDY----QTKSCVAT 223

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
           L+ H  +V   V+H  L ++ S S D T++IW      ++    LN      WC     +
Sbjct: 224 LEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWN--SSTYKVEKTLNVGLERSWCIATHPT 281

Query: 121 ESSLRLCSGSDD 132
                + SG D+
Sbjct: 282 GRKNYIASGFDN 293

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 63/136 (46%), Gaps = 7/136 (5%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E + E+ +I +  E  V++  +     ++   S D  + ++  +  GE+   +   +
Sbjct: 40  WNYETQVEVRSI-QVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNT-GEK---VVDFE 94

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   ++ +  H     + S S D T+++W +++++W       GHE  V C  F   + 
Sbjct: 95  AHPDYIRSIAVHPTKPYVLSGSDDLTVKLW-NWENNWALEQTFEGHEHFVMCVAFNPKDP 153

Query: 123 SLRLCSGSDDTTVRIW 138
           S    SG  D TV++W
Sbjct: 154 S-TFASGCLDRTVKVW 168

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 18/116 (15%)

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLL 185
           + SGSDD TV++W +       E  WAL+      H   V  V+++P     ST + G L
Sbjct: 112 VLSGSDDLTVKLWNW-------ENNWALEQTF-EGHEHFVMCVAFNPKD--PSTFASGCL 161

Query: 186 AIYQEKEEGKWEI---IAQHELAHGVYE-TNVVKWTQIDGETLLVTGGDDGCVNIW 237
               ++    W +        L  G     N V +  +  +  ++T  DD  + IW
Sbjct: 162 ----DRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIW 213

>Kwal_26.8776
          Length = 433

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 95/228 (41%), Gaps = 24/228 (10%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L   + GH   V+SV+ S     + + S DK V  W+     E    I     H   V 
Sbjct: 155 KLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDL----ERNAAIRDYHGHFSGVN 210

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V  H  L L+AS+  D  +R+W D          L GH+  +        +  +  C  
Sbjct: 211 TVDVHPTLDLIASAGRDAVVRLW-DIRTRLPV-MTLAGHKSPINQVKCFPVDPQIMSC-- 266

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQ 189
           S D TVR+W        D +      +L + HS++V +++  P     +T S   +  ++
Sbjct: 267 SSDATVRLW--------DIRAGKATKIL-THHSKSVRAIAAHPAESSVATASTSDVRSWR 317

Query: 190 EKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
             +    +++  +  + G+    ++    ++ + +L  GGDDG ++ +
Sbjct: 318 HSD---GQLLTNYH-SEGI---GIINSLSVNADGVLFGGGDDGNLSFF 358

 Score = 30.8 bits (68), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 99  WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           W+   V+NGH G V C   +  +++    +GS+DTT+++W
Sbjct: 111 WKLMRVINGHNGWVRCVCPDPVDNAW-FATGSNDTTIKVW 149

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 99/230 (43%), Gaps = 21/230 (9%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GHE  +  V+ S +G Y+ +CS D+S+ +W      +  E +S    H+  +  + +   
Sbjct: 179 GHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNL----KSGELLSTGWGHTARIWQLKFIDN 234

Query: 77  LSLLASSSYDDTIRIW---KDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD-D 132
            + + S S D T R+W   K  DD  Q           VW  D E+ E  L + SG+D  
Sbjct: 235 DTKVVSVSEDCTCRVWDIAKPHDDLVQSGIYEVHLIKNVWGVDVEEDE-MLAITSGNDGR 293

Query: 133 TTVRIWKYIEDNEDDEQVWALQSV----LPSAHSRAVYSVSWSPTGLIASTGSDGLLAIY 188
             +   K +    D+ +V++LQ +    +    +  +    W   GL+A T    ++   
Sbjct: 294 LKLTDLKPLSRKGDEVEVFSLQDISSGKINLEKNEIIKGFYWLSFGLVAITSVGQIIKFD 353

Query: 189 QEKEEGKWEIIAQ------HELAHGVYETNVVKWTQIDGETLLVTGGDDG 232
           Q+  +  W ++ +      + +  G+ E N V ++      LL+   +DG
Sbjct: 354 QKSSQ--WSVVMKDSRFSSYSVTSGIQELNTVIFSSNKCNLLLLKFTEDG 401

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE--EFECISVLQEHSQDVKHVVWHSV 76
           +  ++S+S +  G  L   +   + ++W+   + +    + ++  + H++ +  V+  S 
Sbjct: 159 DTPLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSD 218

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
           +  LA+ S D T R+W   +D+++    L+GH+  VW  D   S  S  L +   D  VR
Sbjct: 219 VKHLATCSADHTARVWS-IEDNFKLETTLDGHQRWVW--DCAFSADSAYLVTACSDHYVR 275

Query: 137 IW 138
           +W
Sbjct: 276 LW 277

 Score = 35.8 bits (81), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 8/124 (6%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           EGH   V S+S+     ++ + S D ++ +W+          +    +H   V  VV H 
Sbjct: 72  EGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDV-----RAPSVQRNYKHHAPVNEVVIHP 126

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
               L S   D  IRIW D  ++ QC   L   + T   S    S+ S+ L +G++    
Sbjct: 127 NQGELISCDQDGNIRIW-DLGEN-QCTHQLTPEDDTPLQSLSIASDGSM-LVAGNNKGNC 183

Query: 136 RIWK 139
            +W+
Sbjct: 184 YVWQ 187

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 85/204 (41%), Gaps = 25/204 (12%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYG-----------EEFECISV 60
           LA +  H   V ++ +S    YLA+ S DK + IWE +E             E +     
Sbjct: 70  LANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRR 129

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
           L  H  D++ + W    S+L +   D +I +W      ++     + H+  V    F+ +
Sbjct: 130 LVAHDNDIQDICWAPDSSILVTVGLDRSIIVWN--GSTFEKIKRFDVHQSHVKGVVFDPA 187

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLP-----SAHSRAVYSVSWSPTG- 174
                  + SDD TV++++Y   ++  +  + ++ ++      S  +     +SWSP G 
Sbjct: 188 NKY--FATASDDRTVKVFRY---HKGTDLSFTIEHIITEPFQGSPLTTYFRRLSWSPDGQ 242

Query: 175 -LIASTGSDGLLAIYQEKEEGKWE 197
            +     ++G ++       G W+
Sbjct: 243 HIAVPNATNGPVSTVAIISRGNWD 266

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 13/129 (10%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L+  + GH + VK++ +      L T S DK++ +W         ECIS  + H+  V 
Sbjct: 365 KLIRRLTGHSDGVKTLYFDDQK--LITGSLDKTIRVWNY----ITGECISTYRGHTDSVM 418

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V  H    ++ S S D T+++W     + +    L GH  T W +  +    S    S 
Sbjct: 419 SVDSHK--KIIVSGSADKTVKVWHV---ESRTCYTLKGH--TEWVNCVKLHPKSFSCYSC 471

Query: 130 SDDTTVRIW 138
           SDDTT+R+W
Sbjct: 472 SDDTTIRMW 480

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LL + SYD T+ IW  F    +    L GH   V    F+      +L +GS D T+R+W
Sbjct: 346 LLFTGSYDTTVAIWDLFT--GKLIRRLTGHSDGVKTLYFDDQ----KLITGSLDKTIRVW 399

Query: 139 KYI 141
            YI
Sbjct: 400 NYI 402

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           L S + D+TI++W+      +C     GH   VW    + +  + R+ SGS D +++IW
Sbjct: 555 LLSCALDNTIKLWEV--RSGRCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIW 607

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 19/141 (13%)

Query: 12  LAIVEGHENEVKSVSWSH-SGYYLATCSRDKSVWIWEADE-YG-----------EEFECI 58
           + +  GH  +V    +S  + + +A+ S D  + IWE  E YG           ++ + +
Sbjct: 86  VPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPV 145

Query: 59  SVLQEHSQDVKHVVWHSVL-SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
            +L  HS+ V H+++H +  ++LASSS D T++IW   D   +       H   V    F
Sbjct: 146 RMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIW---DISQEEVKFTLKHPDMVTSMSF 202

Query: 118 EKSESSLRLCSGSDDTTVRIW 138
             S     L + S D  +R+W
Sbjct: 203 --SYDGKHLVTVSRDKKLRVW 221

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 10/132 (7%)

Query: 18  HENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS-QDVKHVVWHSV 76
           H + V S+S+S+ G +L T SRDK + +W  D   E  + +S    HS    + VVW   
Sbjct: 193 HPDMVTSMSFSYDGKHLVTVSRDKKLRVW--DVRAE--KIVSEGPAHSGAKNQRVVWLGD 248

Query: 77  LSLLASSSY----DDTIRIWKDFD-DDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
              +A++ +    D  I +W  F+ +        N  + +     F    + +   +G  
Sbjct: 249 TDKVATTGFSRLSDRQIGVWDAFNLEKGNLGGFYNVDQSSGILMPFYDDSNRILYVAGKG 308

Query: 132 DTTVRIWKYIED 143
           D  +R +++  D
Sbjct: 309 DGNIRYFEFQND 320

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 16/135 (11%)

Query: 18  HENEVKSVSWSHSGYYLATCSRDKSVWIWEADE-------YGEEFE-----CISVLQEHS 65
           H   +  V +S  G YLA+ S D+ + IW  DE       +G E E         L  H 
Sbjct: 78  HTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHD 137

Query: 66  QDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLR 125
            D++ + W    S+L +   D ++ +W      ++     + H+  V    F+ +     
Sbjct: 138 NDIQDICWAPDSSILVTVGLDRSVIVWN--GSTFEKLKRFDVHQSLVKGVVFDPANKY-- 193

Query: 126 LCSGSDDTTVRIWKY 140
             + SDD T++I++Y
Sbjct: 194 FATTSDDRTMKIFRY 208

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
            H+N+++ + W+     L T   D+SV +W     G  FE +     H   VK VV+   
Sbjct: 135 AHDNDIQDICWAPDSSILVTVGLDRSVIVWN----GSTFEKLKRFDVHQSLVKGVVFDPA 190

Query: 77  LSLLASSSYDDTIRIWK 93
               A++S D T++I++
Sbjct: 191 NKYFATTSDDRTMKIFR 207

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 88/233 (37%), Gaps = 49/233 (21%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           E  + E+ +V  SH G  LAT   D  + IW  D                         S
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSID-------------------------S 48

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
           +L  +   S    I + +D      C+  ++ H G++ C  F  S     L SGSDD  +
Sbjct: 49  ILRCMELESLTPEIPLPQDLQMPL-CS--MSRHTGSITCVKF--SPDGKYLASGSDDRIL 103

Query: 136 RIWKYIED--------NEDDEQVWALQSVLPSAHSRAVYSVSWSP-TGLIASTGSDGLLA 186
            IW   E+        +E + + W ++  L  AH   +  + W+P + ++ + G D  + 
Sbjct: 104 LIWALDEEQSSQPAFGSEHEREHWTVRKRL-VAHDNDIQDICWAPDSSILVTVGLDRSVI 162

Query: 187 IYQEKEEGKWEIIAQHE-LAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
           ++      K +    H+ L  GV      K+          T  DD  + I++
Sbjct: 163 VWNGSTFEKLKRFDVHQSLVKGVVFDPANKY--------FATTSDDRTMKIFR 207

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           +L S S D ++RIW       +C  V  GH  TV C D  + E    + +GS D T+ IW
Sbjct: 422 ILVSGSTDRSVRIWNIHLG--KCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIW 479

Query: 139 KY--IEDNEDDE 148
           K   + D+  DE
Sbjct: 480 KLPQMSDSNIDE 491

 Score = 29.3 bits (64), Expect = 3.1,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 56/138 (40%), Gaps = 25/138 (18%)

Query: 105 LNGH-EGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR 163
           L GH    V C  FE +     + +G+DD  +RI+  I      E          S H  
Sbjct: 364 LKGHMTSVVTCLQFEDN----YVITGADDKMIRIYDSITKKFLIEL---------SGHDG 410

Query: 164 AVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI---D 220
            V+++ ++  G++ S  +D  + I+         +   H        T+ V+   I   +
Sbjct: 411 GVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGH--------TSTVRCLDIVEHE 462

Query: 221 GETLLVTGGDDGCVNIWK 238
           G   +VTG  D  ++IWK
Sbjct: 463 GVKYIVTGSRDNTLHIWK 480

 Score = 27.7 bits (60), Expect = 9.6,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 66/167 (39%), Gaps = 25/167 (14%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           ++ + L I+ GH + + S  + +      + S D ++ IW+        EC++V      
Sbjct: 550 IQMKCLYILMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVP 609

Query: 67  DVK----------HVVWHSVLSL----LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV 112
             K          H     +L L    L S++ D ++R W   D   + A     H    
Sbjct: 610 CTKITGPMMTLQGHTALVGLLKLSDKFLVSAAADGSLRGWDSSDYSRKFAY---HHNNLS 666

Query: 113 WCSDFEKSESSLRLCSGSDDT----TVRIWKYIEDN--EDDEQVWAL 153
             + F  +++   L SGS+       +R  K I  N   D +Q+W++
Sbjct: 667 AITTFYMTDNI--LVSGSEGQFNIYNLRTGKLIHSNILNDADQIWSV 711

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 77/176 (43%), Gaps = 31/176 (17%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + V+  + + +G Y  + S DK++ +W+    GE F+       H  DV  V    
Sbjct: 62  KGHSHIVQDCTLTENGAYALSGSWDKTLRLWDV-ATGETFQ---TFVGHKGDVMSVAIDK 117

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESS-----LRLCSGS 130
             S++ S S D +I++W    D   C A L GH    W S    + SS     + + S  
Sbjct: 118 KASMIISGSRDKSIKVWSIKGD---CLATLIGHND--WVSQVRIANSSDDDDKVTVISAG 172

Query: 131 DDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRA---VYSVSWSPTG--LIASTGS 181
           +D  V++            +W   + +P     A   VY++S+SP    L A+T S
Sbjct: 173 NDKMVKV------------LWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATAS 216

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 11/82 (13%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           E      GH+ +V SV+       + + SRDKS+ +W       + +C++ L  H+    
Sbjct: 98  ETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSI-----KGDCLATLIGHND--- 149

Query: 70  HVVWHSVLSLLASSSYDDTIRI 91
              W S + +  SS  DD + +
Sbjct: 150 ---WVSQVRIANSSDDDDKVTV 168

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 81/197 (41%), Gaps = 36/197 (18%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           E H+ EV  +S+   G  LA+ + D +V IW+  +  +    I   + H   VK + WH 
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDP---IWTKRNHKAAVKAISWHP 386

Query: 76  -VLSLLAS--SSYDDTIRIWK--------DFDDDWQCAAV-----LNGHEGTVWCSDFEK 119
            + +LLA+   S D  I  W           D   Q +++      + H G   C D E 
Sbjct: 387 EITNLLATGGGSLDKHIHFWNTTTGNRLGTIDTGSQVSSLHWGQSYSKHSG---CMDTE- 442

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIAS 178
               +    G+ +  + I+ Y    E   +V  +Q     AH   + S   SP G  IAS
Sbjct: 443 ----IVATGGTPNNCITIYNY----ETKFKVAEIQ----QAHDSRIVSSQLSPDGTTIAS 490

Query: 179 TGSDGLLAIYQEKEEGK 195
            G D  L  Y+  EE +
Sbjct: 491 VGGDENLKFYRVFEERR 507

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 24/162 (14%)

Query: 24  SVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASS 83
           S++WS    +++    D +V IW+A+         S L      +    W   L +  S 
Sbjct: 254 SLTWSDDSCHISIGKNDGNVEIWDAETMTHVRTMRSGL---GVRIGSQSWLDTLCVTGSK 310

Query: 84  SYD---DTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKY 140
           S +   + +RI       W+       H+G V    F   E  ++L SG++D TV IW  
Sbjct: 311 SGEIQINDVRIKNHVVQTWE------RHQGEVCGLSFR--EDGIQLASGANDNTVMIW-- 360

Query: 141 IEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--TGLIASTG 180
            +  ++++ +W  ++     H  AV ++SW P  T L+A+ G
Sbjct: 361 -DTRQNNDPIWTKRN-----HKAAVKAISWHPEITNLLATGG 396

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 101/234 (43%), Gaps = 21/234 (8%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           +  + + I++GH N++    WS     + + S+D  + +W++    +     S +   SQ
Sbjct: 73  INLKPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKR----SAIPLDSQ 128

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDD---DWQCAAVLNGHEGTVWCSDFEKSESS 123
            V         +L AS+  ++   I++            ++  GH G +   +F  SES 
Sbjct: 129 WVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFV-SES- 186

Query: 124 LRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDG 183
            R+ + S D T  +W   +     E    L  VL    + ++   + S   + AS GSDG
Sbjct: 187 -RVVTSSGDMTCALWDIPKAKRVREYSDHLGDVL----AISIPVTNLSKNNMFASCGSDG 241

Query: 184 LLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
              I+  +        A  + + G  ++N +K+   DG ++ V G DDG ++++
Sbjct: 242 YTFIWDVRSPS-----AVQQFSIGSCDSNCLKFFP-DGNSVAV-GNDDGTISLF 288

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 13/129 (10%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L+  + GH + VK++ +      L T S DK++ +W         ECIS  + HS  V 
Sbjct: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNY----ITGECISTYRGHSDSVL 386

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V   S   ++ S S D T+++W     + +    L GH  T W +  +    S    S 
Sbjct: 387 SV--DSYQKVIVSGSADKTVKVWHV---ESRTCYTLRGH--TEWVNCVKLHPKSFSCFSC 439

Query: 130 SDDTTVRIW 138
           SDDTT+R+W
Sbjct: 440 SDDTTIRMW 448

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LL + SYD TI IW  F    +    L+GH   V    F+      +L +GS D T+R+W
Sbjct: 314 LLFTGSYDSTIGIWDLFT--GKLIRRLSGHSDGVKTLYFDDR----KLITGSLDKTIRVW 367

Query: 139 KYI 141
            YI
Sbjct: 368 NYI 370

>Kwal_26.8628
          Length = 422

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 103/232 (44%), Gaps = 32/232 (13%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           + GH N++   +WS     + + S+D  + +W+A   G +   I +    SQ V     +
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDA-SLGFKKNAIPL---DSQWVLTCAIN 137

Query: 75  SVLSLLASSSYDDTIRIWKDFDDD---WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
           S  +L+AS+   ++  I++   ++    Q  ++  GH  T + S  E  E++  + + S 
Sbjct: 138 SSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGH--TCYVSQVEFFENN-SIITASG 194

Query: 132 DTTVRIW-----KYIEDNEDD-EQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLL 185
           D T  +W     K I +  D    V AL   LP  H++     + SP  + AS GSDG +
Sbjct: 195 DMTCALWDIPKAKRIAEFSDHLGDVLAL--ALPPPHAQ-----TSSP--IFASGGSDGYV 245

Query: 186 AIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            I+  +     +       +  V E+++      +    +VTG DDG   ++
Sbjct: 246 YIWDTRARAAAQ-------SFFVSESDISTLKFFNNGYAIVTGADDGVARMF 290

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 92/229 (40%), Gaps = 26/229 (11%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L   + GH   VK +  S    Y+ + S DK V  W+     E+   I     H   V 
Sbjct: 163 KLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDL----EKNRVIRDYHGHLSGVH 218

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            V  H  L+L+A++  D  +R+W D          + GH+  +        +  +  CS 
Sbjct: 219 TVDIHPTLNLIATAGRDSVVRLW-DIRTKLPVMT-MAGHKSPINRVKCLPVDPQVVSCSA 276

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIY 188
             D TVR+W        D        VL + H R+V  +   P    I+S  +D + +  
Sbjct: 277 --DATVRLW--------DITAGKTLKVL-THHKRSVRDIGIHPGEFSISSACTDDIRS-- 323

Query: 189 QEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            +  EG+     Q E      +T ++    I+ + +L  G D+G ++ +
Sbjct: 324 WKLPEGQLLTNFQSE------KTGIINTLSINQDDVLFAGSDNGVLSFY 366

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 70/173 (40%), Gaps = 42/173 (24%)

Query: 99  WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW-------------------- 138
           W+   V+NGH G V     +  ++     +GS+DTT++IW                    
Sbjct: 119 WKLMRVINGHNGWVRTVAVDPIDNEW-FATGSNDTTIKIWDLATGKLKLTLSGHIMTVKD 177

Query: 139 -------KYIEDNEDDEQV--WALQS--VLPSAHSR--AVYSVSWSPT-GLIASTGSDGL 184
                   Y+    +D+ V  W L+   V+   H     V++V   PT  LIA+ G D +
Sbjct: 178 ICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSV 237

Query: 185 LAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           + ++  + +     +A H+        N VK   +D +  +V+   D  V +W
Sbjct: 238 VRLWDIRTKLPVMTMAGHK-----SPINRVKCLPVDPQ--VVSCSADATVRLW 283

>Kwal_23.5035
          Length = 744

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 9/116 (7%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW-HSVLSLLASSSYDDTIRI 91
           Y+ T + DK + +++A    E+F  I+ L  H   V  + + H    +L S S D ++R+
Sbjct: 382 YVITGADDKMIRVYDAKT--EKF--ITQLSGHDGGVWALKYGHD--GILVSGSTDRSVRV 435

Query: 92  WKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDD 147
           W       +C  V  GH  TV C D  +      + +GS D T+ +WK    N +D
Sbjct: 436 WNI--KSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAED 489

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/106 (17%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           ++  ++     + ++ GH   V++VS    G  + + S D ++ +W+      + +C+ V
Sbjct: 497 VFNTTDANPYFVGVLRGHMAAVRTVSGH--GNIVVSGSYDFNLMVWDI----AQMKCLYV 550

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW--KDFDDDWQCAAV 104
           L  H+  +   ++    +   S+  D T+++W   D   +  C  +
Sbjct: 551 LTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWDLADVSKNGPCTTI 596

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 60/138 (43%), Gaps = 25/138 (18%)

Query: 105 LNGHE-GTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR 163
           L GH    V C  FE       + +G+DD  +R++    D + ++ +  L     S H  
Sbjct: 365 LRGHTMKIVTCLQFEDD----YVITGADDKMIRVY----DAKTEKFITQL-----SGHDG 411

Query: 164 AVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI---D 220
            V+++ +   G++ S  +D  + ++  K      +   H        T+ V+   I   +
Sbjct: 412 GVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGH--------TSTVRCLDIVEHN 463

Query: 221 GETLLVTGGDDGCVNIWK 238
           G+  +VTG  D  +++WK
Sbjct: 464 GKKFIVTGSRDHTLHVWK 481

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 106/285 (37%), Gaps = 77/285 (27%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           +GH + +  + +S  G  + T S +  + IW+       F C++   EH+  V  V +  
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDV---ASGF-CLATFDEHAGGVSAVEFAK 393

Query: 76  VLSLLASSSYDDTIRIW-----KDF---------------------------DDDW---- 99
              +L S+S D T++ W     ++F                           +D +    
Sbjct: 394 KGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFV 453

Query: 100 ------QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWAL 153
                 Q    L+GHEG + C  F  S  +  L S S D T+R+W     ++  E     
Sbjct: 454 WSVQTGQLVDTLSGHEGPISCLSF--SNENGVLASASWDKTIRVWSLFGRSQQVEPFEVF 511

Query: 154 QSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAIYQEKE-------EGKWEIIAQHEL- 204
             VL         S+S  P G  IA++   G +  +   E       +GK +II+   L 
Sbjct: 512 SDVL---------SISMKPDGQQIAASTLAGQILFFDVAEGKQVGNIDGKRDIISGRHLE 562

Query: 205 --------AHGVYETNVVKWTQIDGETLLVTGGDDG-CVNIWKNE 240
                   A   Y T +      DG +L+  G ++  C+    NE
Sbjct: 563 DRFTSESSARSKYFTTI--HYSFDGLSLVAAGNNNSICLYDIPNE 605

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE 63
           +L+  + GHE  +  +S+S+    LA+ S DK++ +W      ++ E   V  +
Sbjct: 460 QLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLFGRSQQVEPFEVFSD 513

>Kwal_0.212
          Length = 303

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE--EFECISVLQEHSQDVKHVVWHSV 76
           +  ++S+S +  G  L   +   + ++W+     +    + ++  + H++ +  V+  S 
Sbjct: 159 DTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSD 218

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
           +  LA+ S D T R+W   DD++Q    L+ H+  VW  D   S  S  L +   D  VR
Sbjct: 219 VKHLATCSADHTARVWS-IDDNFQLETTLDNHQRWVW--DCAFSADSAYLVTACSDHYVR 275

Query: 137 IW 138
           +W
Sbjct: 276 LW 277

 Score = 33.9 bits (76), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 8/124 (6%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           EGH   V S+++     ++ + S D ++ +W+          +    +H   V  VV H 
Sbjct: 72  EGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-----RAPSVQRNYKHQAAVNEVVIHP 126

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
               L S   D  +RIW D  ++ QC   L   + T   S    S+ S+ L +G++    
Sbjct: 127 NQGELISCDQDGNVRIW-DLGEN-QCVHQLAPEDDTPLQSLSVASDGSM-LVAGNNKGNC 183

Query: 136 RIWK 139
            +W+
Sbjct: 184 YVWQ 187

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 3/77 (3%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
             H   +  V  S    +LATCS D +  +W  D   + F+  + L  H + V    + +
Sbjct: 204 RSHAKYITRVLLSSDVKHLATCSADHTARVWSID---DNFQLETTLDNHQRWVWDCAFSA 260

Query: 76  VLSLLASSSYDDTIRIW 92
             + L ++  D  +R+W
Sbjct: 261 DSAYLVTACSDHYVRLW 277

>Kwal_27.11126
          Length = 996

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 108/245 (44%), Gaps = 25/245 (10%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+ E E  L    + HE  +  V+ S +G Y A+CS D+S+ +W+     +  + +S   
Sbjct: 166 WDLESEQNLHHFTD-HEGAIFFVTASKNGKYAASCSDDRSIKLWDL----KSGQLLSTAW 220

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEG----TVWCSDFE 118
            H+  + ++++    S + S S D T R+W   +D+    A +  HEG    +VW  D +
Sbjct: 221 GHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASV--HEGHLLKSVWGLDVD 278

Query: 119 KSESSLRLCSGSDD----TTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYS-VSWSPT 173
            +E  +   SG+D     T ++    + D      +  +++   +   + +     W   
Sbjct: 279 -NERMIAATSGNDGRIKLTDLKAKSRVGDETMSSSLEDIEAAGVAMKPKEIIKGFHWFKF 337

Query: 174 GLIASTGSDGLLAIYQEKEEGKWEII------AQHELAHGVYETNVVKWTQIDGETLLVT 227
           GLIA T    +L    E+   KW  I      + + +  G+ E N++ +     + L++ 
Sbjct: 338 GLIAMTSEGQVLKF--EQSSKKWSSILNDSTFSNYSITAGLQELNLIVFCSSQCDLLVIK 395

Query: 228 GGDDG 232
             DDG
Sbjct: 396 FNDDG 400

>Kwal_56.23685
          Length = 1102

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 62/139 (44%), Gaps = 7/139 (5%)

Query: 14  IVEGHENEVKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           ++ GH   +  +++  +    LATCS D  V  W+       +   SV    +  VK   
Sbjct: 109 VLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK--- 165

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           W+   S + +S++ + + IW D         VL GH  +V   DF K + +  + S S+D
Sbjct: 166 WNYKNSNVMASAHSNDVYIW-DLRKGCTPLHVLQGHVNSVNSIDFSKFDET-EIMSSSND 223

Query: 133 TTVRIWKY-IEDNEDDEQV 150
            TV+ W Y + D E    V
Sbjct: 224 GTVKFWDYSLSDKEPQRTV 242

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 7/79 (8%)

Query: 161 HSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI 219
           H  AV  V +SPTG    TGS D  + IYQ K     EI     + H +++   VK+T +
Sbjct: 297 HVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQH-IFQ---VKYT-M 351

Query: 220 DGETLLVTGGDDGCVNIWK 238
           D +  +V+G DDG V +W+
Sbjct: 352 DSK-YIVSGSDDGNVRLWR 369

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 17/91 (18%)

Query: 56  ECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
           + + V ++H   V  V +      + + SYD TIRI++          V +GH   ++ +
Sbjct: 289 KALHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQ----------VKHGHSREIYHT 338

Query: 116 D-------FEKSESSLRLCSGSDDTTVRIWK 139
                    + +  S  + SGSDD  VR+W+
Sbjct: 339 KRMQHIFQVKYTMDSKYIVSGSDDGNVRLWR 369

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 95/232 (40%), Gaps = 32/232 (13%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69
           +L   ++ H+  V+ ++ S+   Y+ + S DK+V  W+     E+   I     H   V 
Sbjct: 149 KLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDL----EKNTAIRNYHGHLSGVH 204

Query: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGT---VWCSDFEKSESSLRL 126
            V  H  + ++ ++  D  +++W D          L GH+G    V C   +      ++
Sbjct: 205 TVDIHPTVDVVVTAGRDSVVKVW-DIRTRLPVMT-LPGHKGPITKVRCLPVDP-----QV 257

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLL 185
            S S D ++R+W  +              VL + H R V  +S  P+    AS  ++ + 
Sbjct: 258 ISSSVDASIRLWDLVAGKS--------MKVL-THHQRTVRDISVHPSEFSFASACTNDIR 308

Query: 186 AIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           +    K E     ++Q        + +V+    I+ + +L  G D+G +  +
Sbjct: 309 SWLLPKGELLTNFVSQ--------DLDVINTVSINQDDVLFAGSDNGSLTFF 352

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 99  WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           W    V++GH G V C   +K ++     +GS+D T++IW
Sbjct: 105 WHLTRVIHGHHGWVRCIAMDKVDNEW-FATGSNDKTIKIW 143

>Kwal_33.15136
          Length = 473

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query: 138 WKYIEDNEDDEQVWALQSVLPSA------HSRAVYSVSWSPTGLIASTGS-DGLLAIYQE 190
           + ++  NED    +     L  A      H  AV  V +SPTG    TGS D  + IYQ 
Sbjct: 270 YNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQV 329

Query: 191 KEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
           K     EI     + H V++   VK+T +D    +V+G DDG V +W+
Sbjct: 330 KHGHSREIYHTKRMQH-VFQ---VKYT-MDSR-YIVSGSDDGNVRMWR 371

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 47/116 (40%), Gaps = 20/116 (17%)

Query: 31  GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIR 90
            Y     + D + + ++          + V ++H   V  V +      + + SYD TIR
Sbjct: 269 AYNFVVANEDHNAYYYDMRNLSR---ALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIR 325

Query: 91  IWKDFDDDWQCAAVLNGHEGTVWCSD-------FEKSESSLRLCSGSDDTTVRIWK 139
           I++          V +GH   ++ +         + +  S  + SGSDD  VR+W+
Sbjct: 326 IYQ----------VKHGHSREIYHTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMWR 371

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 74/171 (43%), Gaps = 49/171 (28%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYG----------EEF---- 55
           +L A + GH  +V+SV  S S   +A+ SRD +V IW  D  G          E+F    
Sbjct: 3   QLSAQLRGHTQDVRSV-VSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSL 61

Query: 56  -----ECI--------------SVLQEHSQDVKHVVWH--SVLSL------LASSSYDDT 88
                +C+               +L    + V  +V H  ++ SL      L SSS+D T
Sbjct: 62  TYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKT 121

Query: 89  IRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
            ++W +    W+    L GH  +VW +      S L   + S DTTV++WK
Sbjct: 122 AKVWTNGIVKWE----LKGHSASVWDAKLLNDGSVL---TASADTTVKLWK 165

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           +L S S D ++RIW    +  +C  V  GH  TV C +  +   S  + +GS D T+ +W
Sbjct: 313 ILVSGSTDRSVRIWNI--ETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW 370

Query: 139 KYIEDNEDDE 148
           K     E D+
Sbjct: 371 KLPPMKELDK 380

 Score = 34.3 bits (77), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 105 LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LNGHEG VW   F   +    L SGS D +VRIW
Sbjct: 296 LNGHEGGVWALKFVDGKI---LVSGSTDRSVRIW 326

 Score = 28.1 bits (61), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 65/166 (39%), Gaps = 23/166 (13%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           +  +LL I+ GH + V S  + +      + S D +V IW+ +         ++    S 
Sbjct: 433 ISMKLLYILTGHTDRVYSTIYDYKRNRCISASMDTTVMIWDLENIENNGTTTTINDGASI 492

Query: 67  DV----KHVVWHSVL--------SLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
            V    K +  H+ L          L S++ D +IR W   D   + +     H      
Sbjct: 493 KVVGSMKCLYGHTALVGLLCLSNKFLVSAAADGSIRGWDPNDYSRKFSF---HHTNLAAI 549

Query: 115 SDFEKSESSLRLCSGSDDT----TVRIWKYIEDN--EDDEQVWALQ 154
           + F  +++   L SGS+       +R  K I      D EQVW ++
Sbjct: 550 TSFSMNDNI--LVSGSERQFNVYNLRTGKLIHRKLLTDSEQVWGIK 593

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
            +V  H   V  + WS  G  +A+CS D +V +        +   +  L  H+  V  + 
Sbjct: 49  TLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTH-----RQLGLLHRLVGHTAPVISLC 103

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           +++  +LL +SS D++I++W            ++ H   V   D   ++ S+ L SGS D
Sbjct: 104 YNNKGNLLFTSSMDESIKVWDVLTG--TVMKTMSAHSEPVVSIDLSDNDGSI-LSSGSHD 160

Query: 133 TTVRIW 138
             +RI+
Sbjct: 161 GLIRIF 166

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 62/139 (44%), Gaps = 21/139 (15%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           LL  + GH   V S+ +++ G  L T S D+S+ +W+          +  +  HS+ V  
Sbjct: 88  LLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDV----LTGTVMKTMSAHSEPVVS 143

Query: 71  V-VWHSVLSLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVWCSDFEK 119
           + +  +  S+L+S S+D  IRI+            +D DWQ         G V  +  + 
Sbjct: 144 IDLSDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQ------SETGVVPIAKVKF 197

Query: 120 SESSLRLCSGSDDTTVRIW 138
           S ++  L   S D  V+IW
Sbjct: 198 SANTKYLLVKSYDGVVKIW 216

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 102/227 (44%), Gaps = 19/227 (8%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVW 73
           +++GH N++    WS     + + S+D  + IW++   G +   I +    SQ V     
Sbjct: 87  VLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSAS-GLKQNAIPL---DSQWVLSCAI 142

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDD---WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGS 130
               +L+AS+  ++   I++   ++      A++  GH  T + SD E ++++  + + S
Sbjct: 143 SPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH--TCYISDIEFTDNA-HILTAS 199

Query: 131 DDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQE 190
            D T  +W   +     E    L  VL  A      S + S T   AS GSDG   I+  
Sbjct: 200 GDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNT--FASCGSDGYTYIWDS 257

Query: 191 KEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           +     +    ++      + N +++ + DG + +V G D+G +N++
Sbjct: 258 RSPSAVQSFYVND-----SDINALRFFK-DGMS-IVAGSDNGAINMY 297

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 11/99 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E   +++ +   H + V S+S+S+ G YLAT +RDK + +W   E     + +S   
Sbjct: 168 WNVETGKDMITL--KHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREE----KIVSEGP 221

Query: 63  EHS-QDVKHVVWHSVLSLLASSSY----DDTIRIWKDFD 96
            H+    + VVW      LA++ +    D  I IW  F+
Sbjct: 222 AHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFN 260

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 14/95 (14%)

Query: 12  LAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWE----------ADEYGE--EFECI 58
           + +  GH  +V    +   + + +A+ S D  + IW+           DE GE  + + +
Sbjct: 74  VPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPV 133

Query: 59  SVLQEHSQDVKHVVWHSVL-SLLASSSYDDTIRIW 92
             L  H++ V HV++H V  ++LASSS D T+++W
Sbjct: 134 KFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLW 168

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 103 AVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIED-------NEDDEQVWALQS 155
            +  GH   V  +DF+   +  R+ SGSDD+ + IW   E+       +ED E +     
Sbjct: 75  PLFRGHTAQVLDTDFDPF-NDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPV 133

Query: 156 VLPSAHSRAVYSVSWSPTG--LIASTGSD 182
              + H+R V  V + P    ++AS+  D
Sbjct: 134 KFLTGHARKVGHVLYHPVAENVLASSSGD 162

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 57/136 (41%), Gaps = 19/136 (13%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           GH   V S+ ++  G  L + S D+S+ IW+    G   + IS   E    +   V    
Sbjct: 95  GHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLT-GTLLKTISAHSEPVVSIDMPVCDP- 152

Query: 77  LSLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
            S+L+S SYD  IRI+            +D DW+         G V  S  + S +   L
Sbjct: 153 -SILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWK------SENGVVPISQVKFSVNGKYL 205

Query: 127 CSGSDDTTVRIWKYIE 142
              S D  ++IW +I 
Sbjct: 206 LVKSLDGVLKIWDFIR 221

>Kwal_26.7570
          Length = 218

 Score = 40.0 bits (92), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 7/94 (7%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
            GH + V+  + +  G Y  + S DK+V +WE        +CI     H  DV  V    
Sbjct: 62  RGHSHIVQDCTVTPDGEYALSASWDKTVRLWEL----ATGKCIQRFVGHKSDVLSVTIDR 117

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHE 109
             S + S+S D T+++W       +C   L GH 
Sbjct: 118 RASQIVSASRDKTVKVWNTLG---ECMVTLLGHN 148

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/240 (17%), Positives = 99/240 (41%), Gaps = 29/240 (12%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E + E+ +I +  +  V++  +     ++   S D  V ++  +  GE+   ++   
Sbjct: 40  WNYETQQEVRSI-QVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNT-GEK---VADFV 94

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
            H   ++ +  H     + + S D T+++W ++++DW       GHE  V C  F   + 
Sbjct: 95  AHPDYIRSIAVHPSKPYILTGSDDLTVKLW-NWENDWSLEQTFKGHEHFVMCVAFNPKDP 153

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP---TGLIAST 179
           ++   SG  D  V++W   +   +          L +   + V  V + P      + ++
Sbjct: 154 NV-FASGCLDHKVKVWSLGQSTPN--------FTLHTGQEKGVNYVDYYPLPDKPYMITS 204

Query: 180 GSDGLLAIYQEKEEGKWEIIAQH--ELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
             D  + I+  + +     +  H   ++  V+   +          ++++G +DG V +W
Sbjct: 205 SDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTL---------PIIISGSEDGTVKLW 255

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           Y+ T S D +V I++     +   C++ L+ H  +V   V+H  L ++ S S D T+++W
Sbjct: 200 YMITSSDDTTVKIFDY----QTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLW 255

Query: 93  KDFDDDWQCAAVLNGHEGTVWC 114
                 ++    LN      WC
Sbjct: 256 N--SSTYKLEKTLNLGLERSWC 275

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 88/199 (44%), Gaps = 40/199 (20%)

Query: 8   ETELLAIVEGHENEV---KSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           E  L+  ++ H   V   K VS+S + +   T S DK++ +W+ D+  + F  I     H
Sbjct: 126 EGSLVYNLQAHNASVWDAKVVSFSENKFL--TASADKTIKLWQNDKVIKTFSGI-----H 178

Query: 65  SQDVKHVV----WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLN---GHEGTVWCSDF 117
           +  V+H+      H +     S S D  I++      D     VL    GHE  V+C   
Sbjct: 179 NDVVRHLAVVDDGHFI-----SCSNDGLIKLV-----DMHTGDVLRTYEGHESFVYCIKL 228

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIA 177
             +     + S  +D TVRIW   ++N   +QV  L ++       +++SV     G I 
Sbjct: 229 LPNGD---IVSCGEDRTVRIWS--KENGSLKQVITLPAI-------SIWSVDCMSNGDII 276

Query: 178 STGSDGLLAIYQEKEEGKW 196
              SD L+ I+ + E+ +W
Sbjct: 277 VGSSDNLVRIFSQ-EKSRW 294

>Kwal_33.14971
          Length = 818

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 10/92 (10%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSV-LP 158
           +C+ V  GHEG +     + S   L L +GSDD +VRIW+ +   E    V+ +Q V L 
Sbjct: 443 RCSTVYRGHEGRIRTLSIDPS--GLWLATGSDDGSVRIWEILTGRE----VYKVQLVDLE 496

Query: 159 SAHSRAVYSVSWSP---TGLIASTGSDGLLAI 187
           +     +  V W+P   TG++A    + +  I
Sbjct: 497 AKTGDNIEVVEWNPDKSTGILAVAAGENIFLI 528

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE 47
             T    +  GHE  ++++S   SG +LAT S D SV IWE
Sbjct: 440 FPTRCSTVYRGHEGRIRTLSIDPSGLWLATGSDDGSVRIWE 480

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 5/119 (4%)

Query: 22  VKSVSWSHSGYYLATCSRDKSVWIWEADEYGE--EFECISVLQEHSQDVKHVVWHSVLSL 79
           ++S+S +  G  L   +   + ++W+   + +    + ++  + HS+ +  V+    +  
Sbjct: 162 LQSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKH 221

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LA+ S D T R+W   +D++Q    L+ H   VW  D   S  S  L +   D  VR+W
Sbjct: 222 LATCSADHTARVWS-VEDNFQLETTLDAHSRWVW--DCAFSADSAYLVTACSDHYVRLW 277

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 8/124 (6%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           EGH   V S+++     ++ + S D ++ +W+      +        +H   V  VV H 
Sbjct: 72  EGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN-----YKHDAPVNEVVIHP 126

Query: 76  VLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
               L S   D  I+IW D  ++ QC   L   + T   S    S+ S+ L +G++    
Sbjct: 127 NQGELISCDQDGNIKIW-DLGEN-QCTNQLALEDNTALQSLSIASDGSM-LVAGNNKGNC 183

Query: 136 RIWK 139
            +WK
Sbjct: 184 YVWK 187

>CAGL0K03861g complement(359448..360989) highly similar to sp|Q04225
           Saccharomyces cerevisiae YMR131c Ribosome assembly
           protein, start by similarity
          Length = 513

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 79/188 (42%), Gaps = 23/188 (12%)

Query: 17  GHENEVKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           G+   ++ + WS +     AT   D  + +W  D   ++ +    ++  + DV  + W+ 
Sbjct: 321 GNNKSIEDIQWSKTESTVFATAGCDGYIRVW--DTRSKKHKPAISVKASNTDVNVISWNE 378

Query: 76  VLSLLASSSYD-------DTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCS 128
            +  L +S  D       D  +   D   + Q  A  N H+G +    F   E S+ +  
Sbjct: 379 KIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESI-VAV 437

Query: 129 GSDDTTVRIWKYIEDNEDD------EQVWALQSVLPS---AH-SRAVYSVSWSP--TGLI 176
           GS+D TV +W    + +D+      E+   L+ + P     H  + +  V W     G +
Sbjct: 438 GSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLFVHWQKEIKDVKWHKQIPGCL 497

Query: 177 ASTGSDGL 184
            STG+DGL
Sbjct: 498 VSTGTDGL 505

>Scas_707.22
          Length = 730

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 69/149 (46%), Gaps = 9/149 (6%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
           W+N   + E   +  GH   V +        Y+ T + D+ + I++A    ++F  +  L
Sbjct: 339 WYNPSFKPERTTLT-GHATSVVTC-LQFEDDYVITGADDRQLRIYDARS--KKF--LKEL 392

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSE 121
             H   V  + + +   ++ S S D ++RIW D      C  V  GH  TV C +    +
Sbjct: 393 SGHEGGVWALKYDAD-GIIVSGSTDRSVRIW-DIKRGC-CTHVFKGHTSTVRCLEIVTYK 449

Query: 122 SSLRLCSGSDDTTVRIWKYIEDNEDDEQV 150
           +   + +GS D T+ +WK I++ + D ++
Sbjct: 450 NMKYIVTGSRDNTLHVWKLIKEEKFDGEL 478

 Score = 28.1 bits (61), Expect = 6.9,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 25/138 (18%)

Query: 105 LNGHEGTV-WCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSR 163
           L GH  +V  C  FE       + +G+DD  +RI+       D      L+ +  S H  
Sbjct: 351 LTGHATSVVTCLQFEDD----YVITGADDRQLRIY-------DARSKKFLKEL--SGHEG 397

Query: 164 AVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI---D 220
            V+++ +   G+I S  +D  + I+  K      +   H        T+ V+  +I    
Sbjct: 398 GVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGH--------TSTVRCLEIVTYK 449

Query: 221 GETLLVTGGDDGCVNIWK 238
               +VTG  D  +++WK
Sbjct: 450 NMKYIVTGSRDNTLHVWK 467

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           G  +E+  +SWS    YL T S D S+ ++  D       C++  ++H+  V+ V W  +
Sbjct: 150 GGASEIYDLSWSPDDKYLVTASMDNSLKVFNVDTGN----CVAFAKDHNHYVQGVTWDPL 205

Query: 77  LSLLASSSYDDTIRIW 92
              + S S D +I I+
Sbjct: 206 NQYIISQSVDRSINIY 221

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 95/239 (39%), Gaps = 37/239 (15%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL- 61
           +N E   E     EGH +E+ +V+ S  G Y+ T  RD+ + +W      E    + V+ 
Sbjct: 222 FNPETTNEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWST----ESLSPVKVIP 277

Query: 62  -QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
            ++   +V  + +      L +S  D  +R +    + +    VL GH+  V     + S
Sbjct: 278 TKDRRGEVLSLAFRKNSDQLFASCADYKVRTYA--INQFSQLEVLYGHQDLV----VDIS 331

Query: 121 ESSLRLC--SGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIAS 178
             S+  C   GS D T  +WK  ++                  +R  +     P  L+  
Sbjct: 332 ALSMERCVTVGSRDRTAMLWKIADE------------------TRLTFRGGEDPERLLKR 373

Query: 179 TGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
                L    +E E G+ E  A+ E A   Y    +    +  ++  +TG D+G +++W
Sbjct: 374 ----WLKQNSKELENGEIE-PAKEEDAPKFYGEGSIDCVCMVDDSHFITGSDNGNISLW 427

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 101/243 (41%), Gaps = 36/243 (14%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           + + EGH + + S+  +  G ++AT S+D SV +W      E+F   +    H   V  V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 72  VWHSVLS-----LLASSSYDDTIRIWK------DFDDDWQCAA----VLNGHEGTVWCSD 116
              +V+       + ++S D TI+ WK      D  +D             HE  +    
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 117 FEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP-TGL 175
              ++S     + S D T +IW     N DD +    Q+ L + H R ++ V++     L
Sbjct: 503 ISPNDS--LFATASYDKTCKIW-----NLDDGE---FQATL-ANHKRGLWDVAFCQYDKL 551

Query: 176 IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVV-KWTQIDGETLLVTGGDDGCV 234
           +A+   D  + I+  +     + +  H        TN V + + I+    L++ G DG V
Sbjct: 552 LATCSGDKTIKIWSLESYAVVKTLEGH--------TNAVQRCSFINKNKQLISTGADGLV 603

Query: 235 NIW 237
            IW
Sbjct: 604 IIW 606

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN + + E  A +  H+  +  V++      LATCS DK++ IW  + Y      +  L+
Sbjct: 522 WNLD-DGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYA----VVKTLE 576

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
            H+  V+   + +    L S+  D  + IW D     +    L+ H   +W 
Sbjct: 577 GHTNAVQRCSFINKNKQLISTGADGLVIIW-DL-STGESVKTLDAHNNRIWA 626

>Scas_719.52
          Length = 628

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 14/95 (14%)

Query: 12  LAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWE------------ADEYGEEFECI 58
           + +  GH  +V    +   + + +A+ S D  + IW+             D   +  + +
Sbjct: 74  VPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPV 133

Query: 59  SVLQEHSQDVKHVVWHSVL-SLLASSSYDDTIRIW 92
             L  HS+ V HV++H V  ++LASSS D T+++W
Sbjct: 134 KFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLW 168

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN  +ET    I   H + V S+S+S+ G +LAT  RDK + +W+      E + +S   
Sbjct: 168 WN--IETGEAVITLKHPDMVTSMSFSYGGNHLATVCRDKKLRVWDI----REGKIVSEGP 221

Query: 63  EHS-QDVKHVVWHSVLSLLASSSY----DDTIRIWKDFD 96
            H+    + VVW      LA++ +    D  I IW  F+
Sbjct: 222 AHAGAKNQRVVWLGNSDRLATTGFSRLSDRQIGIWDAFN 260

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 10/89 (11%)

Query: 103 AVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIED-------NEDDEQVWALQS 155
            +  GH   V  +DF+     + + S SDD+ + IWK  ED       + D E       
Sbjct: 75  PLFRGHTAQVLDTDFDPFNDHI-IASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPV 133

Query: 156 VLPSAHSRAVYSVSWSPTG--LIASTGSD 182
              S HSR V  V + P    ++AS+  D
Sbjct: 134 KFLSGHSRKVGHVLFHPVAENVLASSSLD 162

>Kwal_56.23035
          Length = 424

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 85/200 (42%), Gaps = 32/200 (16%)

Query: 18  HENEVKSVSW--SHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHS 75
           H   + SV W  + +G +  T S D  V +W+ +     FE  S +     DV H V   
Sbjct: 141 HAFSITSVQWYGADNGLFF-TGSNDHKVKVWDTNA----FEVASTI-----DVGHRVVQL 190

Query: 76  VLS--LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGT-----VWCSDFEKSE---SSLR 125
            +   LLA +S D   R+    D     AA+  G + T     +  + F +S+       
Sbjct: 191 DVQGDLLAVASEDSHPRL---IDLASMSAAITLGVKRTDMRYGINTAKFARSDEGSPQQL 247

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSV--LPSAHSRAVYSVSWSPTGL--IASTGS 181
           L +G DD  VR+W     N     +  LQ    L   H+R    + W P+G   I +TG+
Sbjct: 248 LATGDDDGNVRLWDLRMGN---RALCDLQEPDSLAKPHARCCNDLCWDPSGANRIVTTGN 304

Query: 182 DGLLAIYQEKEEGKWEIIAQ 201
           DG   +++   +G  +++ Q
Sbjct: 305 DGKCKLWEISPDGSSQLLRQ 324

>Scas_693.22
          Length = 1145

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 14  IVEGHENEVKSVSWSHSGY-YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           ++ GH   +  ++++      LATCS D  V  W+       F   S  +  +  VK   
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVK--- 168

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           W+   S + +S++ + I IW D          L GH+ +V   DF + +SS  + S S+D
Sbjct: 169 WNYKDSNILASAHSNDIYIW-DLRMGSTPLHKLVGHDSSVNSIDFNRFKSS-EIMSSSND 226

Query: 133 TTVRIW 138
            TV+ W
Sbjct: 227 GTVKFW 232

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADE--------YGEE 54
           W+   E ELL   EGH   +K ++++ +G+  A+ S DK V IW  ++        +   
Sbjct: 163 WDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSV 222

Query: 55  FECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
             CI+    H +D   +    V+ L  S      +R+ ++  +        + H+G++  
Sbjct: 223 PNCITF---HPKDKNQL----VVGLSNSEIRHYDLRLSENHGE----VQKYDHHQGSILA 271

Query: 115 SDFEKSESSLRLCSGSDDTTVRIW 138
             +       +L S S+D TVRIW
Sbjct: 272 LKY--FPDGKKLISSSEDKTVRIW 293

>Scas_721.7
          Length = 325

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 64/143 (44%), Gaps = 28/143 (19%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           + GH   V S++++ SG  L T S D+S+ IW+   +G   + IS    HS+    VV  
Sbjct: 94  LMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDT-FHGAILKTISA---HSES---VVSL 146

Query: 75  SVL-----SLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVWCSDFEK 119
           S+      S+LAS S+D  IR++            +D DW+        +G V  S    
Sbjct: 147 SICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWK------SDDGVVPISQVRF 200

Query: 120 SESSLRLCSGSDDTTVRIWKYIE 142
           S +   L   S D  V+IW  + 
Sbjct: 201 SPNGKFLLVSSFDGIVKIWDCVR 223

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 80/184 (43%), Gaps = 22/184 (11%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           +   H   +  V W      LAS+S D TI I         C   L GH   V       
Sbjct: 52  IPTSHVAPISEVAWSPDNQCLASASDDFTIEITH---LTHGCLHRLMGHTAPVI--SLTY 106

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP---TGLI 176
           ++S   L + S D +++IW       D      L+++  SAHS +V S+S  P   + ++
Sbjct: 107 NDSGNLLFTSSMDESIKIW-------DTFHGAILKTI--SAHSESVVSLSICPDRDSSVL 157

Query: 177 ASTGSDGLLAIYQEKEEGKWEIIAQH---ELAHGVYETNVVKWTQIDGETLLVTGGDDGC 233
           AS   DGL+ ++  +     + +      +   GV   + V+++  +G+ LLV+   DG 
Sbjct: 158 ASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSP-NGKFLLVSSF-DGI 215

Query: 234 VNIW 237
           V IW
Sbjct: 216 VKIW 219

 Score = 35.4 bits (80), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 50/135 (37%), Gaps = 18/135 (13%)

Query: 103 AVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHS 162
            +L    G   C+ F  +    RL + +  T + I+        D Q  A+ S++P++H 
Sbjct: 9   PLLEESRGHCTCARFSPNG---RLIAVTQLTQILIY--------DLQTRAIHSIIPTSHV 57

Query: 163 RAVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE 222
             +  V+WSP     ++ SD           G    +  H          V+  T  D  
Sbjct: 58  APISEVAWSPDNQCLASASDDFTIEITHLTHGCLHRLMGH-------TAPVISLTYNDSG 110

Query: 223 TLLVTGGDDGCVNIW 237
            LL T   D  + IW
Sbjct: 111 NLLFTSSMDESIKIW 125

>ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH]
           (1126443..1128008) [1566 bp, 521 aa]
          Length = 521

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 78/182 (42%), Gaps = 22/182 (12%)

Query: 22  VKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLL 80
           ++ + WS S     ATC  D  V IW  D   ++ +    ++    DV  + W+  +S L
Sbjct: 335 IEDIKWSPSENTVFATCGVDGHVRIW--DIRSKKHKPALSVKVSDTDVNVMSWNQKISYL 392

Query: 81  ASSSYDD------TIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTT 134
            ++  D+       +R + +        A  + H+G +    F   + S+ +   S+D T
Sbjct: 393 LATGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESI-IAVASEDNT 451

Query: 135 VRIWKYIEDNEDDE------QVWALQSVLPS---AH-SRAVYSVSWSP--TGLIASTGSD 182
           V +W    + +D+E      +V  LQ + P     H  + V  V W     G + STG+D
Sbjct: 452 VTLWDLSVEADDEEIKQQAAEVKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTD 511

Query: 183 GL 184
           GL
Sbjct: 512 GL 513

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 13/89 (14%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
           +C+ + +GHEG +         + + L +GSDD +VRIW+ +   E    V+ +Q V   
Sbjct: 427 RCSTIYSGHEGKI--RTLSIDPTGIWLATGSDDGSVRIWEILTGRE----VYRVQLVNKE 480

Query: 160 AHSR-AVYSVSWSPTGLIASTGSDGLLAI 187
            +    ++SV W+P       GS G+LA+
Sbjct: 481 DNPEDNIHSVEWNP------DGSVGILAV 503

 Score = 34.7 bits (78), Expect = 0.061,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE 47
           I  GHE +++++S   +G +LAT S D SV IWE
Sbjct: 431 IYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWE 464

>Scas_571.4
          Length = 601

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 48/95 (50%), Gaps = 14/95 (14%)

Query: 12  LAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIW------------EADEYGEEFECI 58
           +++  GH+ +V    +   + + +A+ S D  + IW            +++    +    
Sbjct: 82  VSLFRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPS 141

Query: 59  SVLQEHSQDVKHVVWHS-VLSLLASSSYDDTIRIW 92
            +L  H++ V HV++H  + ++LASSS D T++IW
Sbjct: 142 KILSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIW 176

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 18  HENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS-QDVKHVVWHSV 76
           H + V ++++   G YLAT +R+K + IW+        + +S  + H     + VVW   
Sbjct: 189 HSDMVTAMAFDPDGAYLATITRNKKLTIWDIASK----QIVSQTKSHQGPKNQRVVWLGY 244

Query: 77  LSLLA----SSSYDDTIRIWKDFD 96
             ++A    S S D  I IW   D
Sbjct: 245 SRIIATTGFSKSMDREIGIWDALD 268

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 61/149 (40%), Gaps = 21/149 (14%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64
           + +E   L  + GH   V SV ++  G  L T S D+S+  W+          +  +  H
Sbjct: 82  THLEYGRLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDV----LSGTLLKTMSAH 137

Query: 65  SQDVKHVVWHSV-LSLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVW 113
           S  V  +       ++L+S SYD  IRI+            +D DWQ        +G V 
Sbjct: 138 SDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQ------TDDGVVP 191

Query: 114 CSDFEKSESSLRLCSGSDDTTVRIWKYIE 142
            S  + S +   L   S D  V++W +I 
Sbjct: 192 ISQVKFSRNGKFLLVRSLDGVVKLWDFIR 220

 Score = 32.0 bits (71), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 93/215 (43%), Gaps = 26/215 (12%)

Query: 28  SHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDD 87
           S  G Y+A   R  ++ ++   + G    C      H++ +  + W    + +AS S D 
Sbjct: 23  SPDGRYVAVADR-TAICVYSVGDGG----CARYETTHTEPINDICWSPDSACVASGSEDF 77

Query: 88  TIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDD 147
           T+ I      ++     L GH   V    F   + +L LC+ S D +++ W  +      
Sbjct: 78  TVEITH---LEYGRLHKLRGHSAPVLSVVFN-CKGNL-LCTASVDESIKQWDVLSGT--- 129

Query: 148 EQVWALQSVLPSAHSRAVYSVSWSPT-GLIASTGS-DGLLAIYQEKEEGKWEIIAQH--- 202
                L+++  SAHS  V S+        I S+GS DGL+ I+  +     + +      
Sbjct: 130 ----LLKTM--SAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDW 183

Query: 203 ELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           +   GV   + VK+++ +G+ LLV    DG V +W
Sbjct: 184 QTDDGVVPISQVKFSR-NGKFLLVR-SLDGVVKLW 216

>Scas_720.45
          Length = 755

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           YL T S D +  +W+     +   C++ L+ H  +V   V+H  L ++ S S D T++IW
Sbjct: 57  YLITSSDDLTCKVWDY----QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIW 112

>Scas_718.6*
          Length = 546

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 19/142 (13%)

Query: 97  DDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSV 156
           DD +    L GH+GT+ C +F  + S L L S   D ++RIW   ++N  +         
Sbjct: 357 DDNKPIGKLLGHQGTISCIEFNVN-SRLLLTSSDSDYSIRIWHGQKENCCN--------- 406

Query: 157 LPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKW 216
               HS+++ S+SW    L+ S   DG + I        W ++    +   + + N +  
Sbjct: 407 CFYGHSQSIISLSWINDDLVISASMDGSVRI--------WSVVENCLVGMAMVDGNAIIC 458

Query: 217 TQID-GETLLVTGGDDGCVNIW 237
            +I   +     G  +G +N++
Sbjct: 459 GKISHDKNKFAIGSMNGQINVY 480

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           + S SYD  +R W   +   +     +GH G V    F    SS RL SG +D T+R+WK
Sbjct: 116 IVSGSYDGVVRTW---NLSGKIEKQYSGHTGAVRAVKFI---SSTRLVSGGNDRTLRLWK 169

Query: 140 YIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIY 188
               N+D + V  L+     AH+ A+     +P   +   G   L A Y
Sbjct: 170 --TKNDDVKHVDELEGT-EEAHTLAILEGHQAPVVSVDVQGDRILSASY 215

>Scas_603.5
          Length = 589

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 20/130 (15%)

Query: 16  EGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS-----QDVKH 70
           E H  E+ SVS+ +   YL + SRDKS+  W+    G   + +     H+     +D   
Sbjct: 388 EAHTAEITSVSYDNE--YLLSASRDKSIRQWDL-TTGNCVQTLEATLSHNSGTNIKDSTV 444

Query: 71  VVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAV---LNGHEGTVWCSDFEKSESSLRLC 127
               SV + LA+ S D  IR+W     D +   V   L  H+G +    F+    S ++ 
Sbjct: 445 EALQSVGAALATGSKDGIIRLW-----DLRSGKVVRTLLKHQGPITSLQFD----STKII 495

Query: 128 SGSDDTTVRI 137
           +GS D  + +
Sbjct: 496 TGSTDANISV 505

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           VL  H + +  V ++    LL + S D +  +W  + ++ +    L+GH G++W  D   
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVW--YSNNGERLGTLDGHMGSIWSID--S 60

Query: 120 SESSLRLCSGSDDTTVRIW 138
             +SL   +GS D T+++W
Sbjct: 61  DHTSLYCVTGSADYTIKVW 79

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 14/84 (16%)

Query: 14 IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH-----SQDV 68
          ++ GHE  +  V ++  G  L TCS+D S  +W    Y    E +  L  H     S D 
Sbjct: 5  VLMGHERPLTQVKYNREGDLLFTCSKDISASVW----YSNNGERLGTLDGHMGSIWSIDS 60

Query: 69 KHVVWHSVLSLLASSSYDDTIRIW 92
           H   + V     + S D TI++W
Sbjct: 61 DHTSLYCV-----TGSADYTIKVW 79

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           L+  + GH + VK + +      + T S DK++ +W          CIS  + H   V  
Sbjct: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGS----CISTYRGHQDSVLS 397

Query: 71  VVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGS 130
           V   S   ++ S+S D T+++W     + +    L GH  T W +  +    S    S S
Sbjct: 398 V--DSYKKIIVSASADKTVKVWHV---ESRTCYTLRGH--TEWVNCVKLHPKSFTCYSSS 450

Query: 131 DDTTVRIW 138
           DD T+R+W
Sbjct: 451 DDKTLRMW 458

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           L S S D+TI++W+      +C     GH   VW    + +  + R+ SGS D ++++W
Sbjct: 526 LLSCSLDNTIKLWEV--SSGRCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVW 578

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 12/108 (11%)

Query: 33  YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           +L +CS D ++ +WE         CI     H + V  +   +    + S S+D +I++W
Sbjct: 525 HLLSCSLDNTIKLWEV----SSGRCIRTQFGHVEGVWDIAADNF--RIVSGSHDKSIKVW 578

Query: 93  KDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKY 140
            D  +  +C     GH+  + C     S       SG +   V++W +
Sbjct: 579 -DLQNG-KCIQTFTGHKAPIVCVGIGDSS----FVSGDELGEVKMWHF 620

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LL + SYD T+ IW     +      L GH   V    F+      ++ + S D T+R+W
Sbjct: 324 LLFTGSYDSTVAIWDTKSGNL--IRRLTGHTDGVKGIYFDDQ----KMITASLDKTIRVW 377

Query: 139 KYI 141
            YI
Sbjct: 378 NYI 380

>Kwal_47.17827
          Length = 523

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 85/196 (43%), Gaps = 23/196 (11%)

Query: 9   TELLAIVEGHENEVKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           T+  A   G+   ++ + +S +     ATC  D  + IW  D   ++ +    ++  S D
Sbjct: 323 TDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIW--DTRSKKHKPAISVKASSTD 380

Query: 68  VKHVVWHSVLS-LLASSSYDDTIRIW--KDFDDDWQCA----AVLNGHEGTVWCSDFEKS 120
           V  + W+  +  LLAS   + T  +W  + F  +   +    A  + H+G +    F   
Sbjct: 381 VNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPL 440

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDE------QVWALQSVLPS---AH-SRAVYSVSW 170
           + S+ +   S+D TV +W    + +D+E      +   LQ + P     H  + V  V W
Sbjct: 441 DDSI-IAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKW 499

Query: 171 SP--TGLIASTGSDGL 184
                G + STG+DGL
Sbjct: 500 HKQIPGCLVSTGTDGL 515

>ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH]
           complement(302396..304048) [1653 bp, 550 aa]
          Length = 550

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 7/93 (7%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
            W   M T L  I+      V  V+    GYY+AT   DKS+ +W+   + +E   +  L
Sbjct: 256 LWAPNMPTPLARILTAR-GPVTGVAVDRQGYYMATTGADKSMRLWDIRNF-KELHSVENL 313

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKD 94
              + +VK     S + LLA S     + +WKD
Sbjct: 314 PIPASNVK----ISDMGLLAVSR-GPHVTLWKD 341

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 6/128 (4%)

Query: 14  IVEGHENEVKSVSWSHSGY-YLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           ++ GH   +  ++++      LATCS D  V  W+       F   S  +  +  VK   
Sbjct: 109 VLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVK--- 165

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           W+     + +SS+ + I +W D          L GH  +V   DF + + S  + S S+D
Sbjct: 166 WNYKDPNVLASSHGNDIFVW-DLRKGSTPLCSLKGHVSSVNSIDFNRFKYS-EIMSSSND 223

Query: 133 TTVRIWKY 140
            TV+ W Y
Sbjct: 224 GTVKFWDY 231

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 42/170 (24%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           A++ GH++ + S+ W  S   L   + D SV +WE DE    + C S L E S       
Sbjct: 285 ALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVCASRLGEFSS------ 338

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVW-CSDFEKSESSLRLCSGSD 131
                                      + A+   G  G  W C  F   ++   L +G  
Sbjct: 339 ---------------------------KGASTATGSAGGFWSCLWFATGDAEYILANGKT 371

Query: 132 DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG--LIAST 179
            +  R+W+   D    EQ+ A+     +  +R+V  V+WSP+G  L+AS+
Sbjct: 372 GSW-RMWENRGDGGSWEQLPAI-----TGPTRSVTDVAWSPSGSYLLASS 415

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 7/99 (7%)

Query: 3   WNS--EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           WN   E    +   ++ H  EV SV +  +   L + S D ++ +W  D   E +E    
Sbjct: 61  WNPLDEHNAGVYCTLKAHNAEVTSVKFIGAEKLLVSASADATINVWRGD---ERWELAQT 117

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDW 99
           L+     V  +   +   L+ +   D T+ +W + DD +
Sbjct: 118 LEGPKSSVTSLAVAA--GLIVAGFADGTLSVWSEHDDAF 154

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSV-----WIWEAD 49
           E L  + G    V  V+WS SG YL   S D++      W++E D
Sbjct: 387 EQLPAITGPTRSVTDVAWSPSGSYLLASSLDQTTRLYTRWMYEGD 431

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 12  LAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWEA-----------DEYGEEFECIS 59
           + +  GH  +V    +       +A+ S D  + IW+            +E  ++ E   
Sbjct: 74  VPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTK 133

Query: 60  VLQEHSQDVKHVVWHSVLS-LLASSSYDDTIRIW 92
            L  HS+ V H+++H     +LASSS D T+RIW
Sbjct: 134 FLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIW 167

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           WN E   ++  +   H + V S+S+S+ G +LAT +RDK + +W       E + +S   
Sbjct: 167 WNVETGEDIYKL--KHPDMVTSMSFSYDGTHLATVARDKKLRVWNV----REEKVVSEGA 220

Query: 63  EHS-QDVKHVVWHSVLSLLASSSY----DDTIRIWKDFD 96
            H+    + VVW      LA++ +    D  I IW  F+
Sbjct: 221 AHAGAKNQRVVWLGNSERLATTGFSKLSDRQIGIWDAFN 259

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 103 AVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIED-----NEDDEQVWALQSV- 156
            +  GH   V  +DF+  + + R+ S SDD  + IW   +D     + D+E++  ++   
Sbjct: 75  PLFRGHTAQVLDTDFDPFDDN-RVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTK 133

Query: 157 LPSAHSRAVYSVSWSPTG--LIASTGSDGLLAI 187
             + HSR V  + + PT   ++AS+  D  + I
Sbjct: 134 FLTGHSRKVGHILYHPTAKDVLASSSLDYTVRI 166

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 161 HSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI 219
           H  AV  V +SPTG    TGS D  + I+  K     E+     + H V++   VK+T +
Sbjct: 301 HVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQH-VFQ---VKFT-M 355

Query: 220 DGETLLVTGGDDGCVNIWK 238
           D +  +V+G DDG V +W+
Sbjct: 356 DSK-YIVSGSDDGNVRLWR 373

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 20/115 (17%)

Query: 32  YYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRI 91
           +  A  + D + + ++          + V ++H   V  V +      + + SYD TIRI
Sbjct: 272 FNFAIANEDHNAYYYDMRNMSR---ALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRI 328

Query: 92  WKDFDDDWQCAAVLNGHEGTVWCSD-------FEKSESSLRLCSGSDDTTVRIWK 139
           +           + +GH   V+ +         + +  S  + SGSDD  VR+W+
Sbjct: 329 FN----------LKHGHSREVYHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLWR 373

>Kwal_26.7655
          Length = 743

 Score = 37.4 bits (85), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           + QEH+QD+  + W S    + ++S D T R+W     D   A  +  H   V C+ F  
Sbjct: 267 IYQEHTQDILDLDW-SKNGFILTTSMDKTARLWH---CDRPKALKVFTHPDFVTCAKFHP 322

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDN 144
           ++      SG  D T+R+W  ++++
Sbjct: 323 NDDRF-FISGCLDHTLRLWSILDNS 346

>Kwal_27.10385
          Length = 536

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLL 80
           E+  ++WS    Y+ T S D S+ I+E     EE  C++   +H+  V+ VVW      +
Sbjct: 138 EIYDLAWSPDDNYIVTGSMDNSLRIFEV----EEGTCVANAADHNHYVQGVVWDPQNEFI 193

Query: 81  ASSSYDDTIRIWK 93
            S S D ++ +++
Sbjct: 194 FSQSADRSVHVYR 206

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 24/94 (25%)

Query: 162 SRAVYSVSWSPTGL-------IASTGSDGLLAI----YQEKEEGKWEII------AQHEL 204
           S+ +YS+ +  TG        + + G D  + +    ++E+ E K + I       QHE 
Sbjct: 13  SQPIYSLCFQSTGTKQHRIRRLVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQ 72

Query: 205 AHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
           A      NV+++   +   +L T GDDG + +WK
Sbjct: 73  A-----VNVIRFNSRND--VLATAGDDGQLLLWK 99

>Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement
          Length = 573

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE 53
            W   M T L+ ++      + SV+    GYY+AT   DKS+ IW+   + E
Sbjct: 278 LWAPNMPTPLVRLLSA-RGPITSVAIDRQGYYMATTGADKSMKIWDIRNFRE 328

>Kwal_23.5962
          Length = 552

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE 53
            W   M T L  ++      + S++    GYY+AT   DKS+ IW+   + E
Sbjct: 257 LWAPNMPTPLARLLSAR-GPITSIALDRQGYYMATTGADKSLKIWDVRNFRE 307

>Kwal_34.15818
          Length = 349

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 38/196 (19%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           +L+ H + +  V ++    L+ + + D+   +W  +  + +      GH+GT+W  D + 
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVW--YSINGERLGTFEGHQGTIWSIDVD- 61

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG----- 174
            + +    +GS D ++++WK     +D   V+  ++  P      V  V +SP+G     
Sbjct: 62  -QFTQYAVTGSADFSIKLWKV----QDGTNVFTWKTKTP------VRRVQFSPSGDKILA 110

Query: 175 -LIASTGSDGLLAIYQEK------------EEGKWEIIAQHELAHGVYETNVVKWTQIDG 221
            L    G  G + +Y  +            EE  + I+ +     G     V  W+  D 
Sbjct: 111 VLDGVMGYPGSVTVYTVRRDPETKDIVDISEEPTFNILTR----EGFEIAAVAAWSFND- 165

Query: 222 ETLLVTGGDDGCVNIW 237
            T +V G  DG V+ +
Sbjct: 166 -TYIVAGHKDGRVSKY 180

 Score = 30.8 bits (68), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 14/85 (16%)

Query: 14 IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH-----SQDV 68
          +++GHE  +  V ++  G  + TC++D    +W    Y    E +   + H     S DV
Sbjct: 5  LLKGHERSLTQVKFNREGDLIFTCAKDNVASVW----YSINGERLGTFEGHQGTIWSIDV 60

Query: 69 KHVVWHSVLSLLASSSYDDTIRIWK 93
               ++V     + S D +I++WK
Sbjct: 61 DQFTQYAV-----TGSADFSIKLWK 80

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 72/168 (42%), Gaps = 28/168 (16%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLS 78
           ENE  S++W  +G +LA    +  V I++  +     +CI  L  H   V  + W++   
Sbjct: 291 ENEYTSINWVGAGSHLAVGQGNGLVEIYDIVKR----KCIRTLSGHMDRVACLSWNN--H 344

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHE----GTVWCSDFEKSESSLRLCSGSDDTT 134
           +L S S D  I + +D          +  H     G  W +D        RL SG +D  
Sbjct: 345 ILTSGSRDRKI-LHRDVRMPEPYFEQVETHTQEVCGLKWNTDEN------RLASGGNDNV 397

Query: 135 VRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--TGLIASTG 180
           V    Y+ D    +    L     + H+ AV +++WSP   G++A+ G
Sbjct: 398 V----YVYDGTSRKPTLKL-----AEHTAAVKAIAWSPHKRGILATGG 436

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 16/113 (14%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATC---SR-DKSVWIWEADEYGEEFECI 58
           WN    T+L  I  G  ++V ++ WS +   L T    SR + ++W + +       E +
Sbjct: 446 WNVNTSTKLRDIDTG--SQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPS------MEPV 497

Query: 59  SVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCA----AVLNG 107
           ++L+ HS  V H+   +  + + S + D+T+R WK FD     A    A+LN 
Sbjct: 498 AILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDRPKPKAQPGSALLNA 550

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 38/90 (42%), Gaps = 7/90 (7%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
            M       VE H  EV  + W+     LA+   D  V++++    G   +    L EH+
Sbjct: 361 RMPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYD----GTSRKPTLKLAEHT 416

Query: 66  QDVKHVVWHS-VLSLLAS--SSYDDTIRIW 92
             VK + W      +LA+   + D  ++IW
Sbjct: 417 AAVKAIAWSPHKRGILATGGGTADKKMKIW 446

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%)

Query: 32  YYLATCSRDKSVWIWEAD------EYGEEFECISVLQEHSQDVKHVVW---HSVLSLLAS 82
           + +AT   DK + +W+          G +   I+ +Q H   V+ V W   HS  ++L S
Sbjct: 241 HIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHS--NMLLS 298

Query: 83  SSYDDTIRIWKDFDDD 98
           +SYD T R+W D  DD
Sbjct: 299 TSYDMTCRVWTDLSDD 314

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 17/95 (17%)

Query: 15  VEGHENEVKSVSWS--HSGYYLATCSRDKSVWIW------------EADEYGEEFECISV 60
           ++GHE  V+ V+WS  HS   L+T S D +  +W            + +       C  +
Sbjct: 276 IQGHELAVRKVTWSPHHSNMLLST-SYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFI 334

Query: 61  LQEHSQDVKHVVWH--SVLSLLASSSYDDTIRIWK 93
             EHS+ V    W        +AS+ +D  + IW 
Sbjct: 335 FMEHSEFVFGADWSLWGTPGFVASTGWDGQVCIWN 369

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 10  ELLAIVEGHENEVKSVSWSHSG--YYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           +LL  +  HE+ V    +  SG    LATCSRD +V +W+     +   CI   Q H+Q 
Sbjct: 202 QLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDT----KSGWCIKSFQPHNQW 257

Query: 68  VKHVVWHSVLSLLASSSYDDTIRI 91
           V+ +  H     + + S D TIR+
Sbjct: 258 VRTLELHG--DYVITGSNDATIRL 279

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 10/82 (12%)

Query: 79  LLASSSYDDTIRIWKDFDDD--WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
           L++++S D   +IW  F D+  +Q    L+ HE  V  S F +S S L L + S D TV+
Sbjct: 180 LISTTSKDLQCKIW-SFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVK 238

Query: 137 IWKYIEDNEDDEQVWALQSVLP 158
           +W       D +  W ++S  P
Sbjct: 239 VW-------DTKSGWCIKSFQP 253

>Kwal_33.15475
          Length = 783

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 6/58 (10%)

Query: 97  DDWQCAAVLNGHEGTVWCSDF-EKSESSLRLCSGSDDTTVRIWK-----YIEDNEDDE 148
           +++Q AA L GHE  V   DF E+S  ++ L +GS D  +R+W+      I+++++DE
Sbjct: 186 NNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNELIDNSDEDE 243

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 113/275 (41%), Gaps = 67/275 (24%)

Query: 10  ELLAIVEGHENEVKSVSW---SHSGYYLATCSRDKSVWIWE---------ADEYGEEFEC 57
           +L A +EGHE+ VK++ +   S     LAT S+D+ + +W          +DE  +EF+ 
Sbjct: 189 QLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNELIDNSDE--DEFKL 246

Query: 58  ISVLQEHSQ-----DVKHVV-----------------WHSVLSLLASSSYDDTIRIWKDF 95
             +  + S+     D+K  +                 WH     L +S+ D  + +W+  
Sbjct: 247 NLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKWHKERPQLLASTADTAVMVWEPD 306

Query: 96  DDD--WQCAAVL-----------NGHEGTVW-CSDFEKSESSLRLCSGSDDTTVRIWKYI 141
            D   W CA+ L            G  G  W CS F        L +G   +  R+W   
Sbjct: 307 ADSGVWICASRLGELSSKGASTATGSSGGFWSCSWFTHKNRDHILTNGKTGSW-RMWV-- 363

Query: 142 EDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGL-IASTGSDGLLAIYQ----EKEEGKW 196
               D+ + W  Q  + +  ++AV  V+WSP GL + +T  D    +      +   G W
Sbjct: 364 ---SDELEGWKQQLAI-TGPTKAVTDVAWSPNGLYMLATSLDQTTRLISRCNYDANAGSW 419

Query: 197 EIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDD 231
              A+ ++ HG Y+   V+       T  ++GGD+
Sbjct: 420 FEFARPQI-HG-YDMICVEPL---SNTRFISGGDE 449

 Score = 31.6 bits (70), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 18/188 (9%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIW----KDFDDDWQCAAVLNGHEGTVWCS 115
            L+ H+ +V  V +    +L+ SSS D  +R+W    KD  D  +C  V++ H+ T+   
Sbjct: 51  TLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKD-QDALKCVQVIDHHKHTIT-- 107

Query: 116 DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQS-VLPSAHSRAVYSVSWSPTG 174
               S  S  L  G  D +V +W    +       + LQ+ V P   +  +         
Sbjct: 108 --SLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKLVE---GDKY 162

Query: 175 LIASTGSDGLLAIY----QEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGD 230
           L+A  G++  + IY    Q+     +++ A+ E  H  +   +  + +  G  LL TG  
Sbjct: 163 LLAIGGTNPRVFIYSFTLQDGTLNNFQLAAELE-GHEDWVKAMDFYEESPGNMLLATGSQ 221

Query: 231 DGCVNIWK 238
           D  + +W+
Sbjct: 222 DRYIRLWR 229

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 64/139 (46%), Gaps = 24/139 (17%)

Query: 31  GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV--------WHSVLSLLAS 82
           G+   T SRDK +  W+  E G+++E     Q+H+  +   V         H+   L+A+
Sbjct: 659 GHVFVTASRDKHIKAWKLSEDGQQYE-----QQHALKLAVPVTAISVFPGLHNGKLLVAA 713

Query: 83  SSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIE 142
              +  I+++  +D+ ++C + ++        + F  ++   RL   S+    RI   + 
Sbjct: 714 GLENGNIQVFT-YDNQFRCYSEID--------TRFTPADRVSRLRWSSNQEKGRILLAVT 764

Query: 143 DNEDDEQVWALQSVLPSAH 161
             +   +V++++  +P AH
Sbjct: 765 SADHSIRVFSME--VPPAH 781

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEE-FECISVLQEHSQDVKHVVW 73
           ++GH  EV  V +      + + S D  V +W  +E  ++  +C+ V+  H   +  +  
Sbjct: 52  LKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSL-- 109

Query: 74  HSVLS-LLASSSYDDTIRIW 92
            SV+S +L+    D ++ +W
Sbjct: 110 -SVISNILSVGCADGSVSLW 128

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 8/92 (8%)

Query: 107 GHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQ--------SVLP 158
            H   +W  D+  +E      + S D  ++ WK  ED +  EQ  AL+        SV P
Sbjct: 643 AHTRIIWDCDWAPTEFGHVFVTASRDKHIKAWKLSEDGQQYEQQHALKLAVPVTAISVFP 702

Query: 159 SAHSRAVYSVSWSPTGLIASTGSDGLLAIYQE 190
             H+  +   +    G I     D     Y E
Sbjct: 703 GLHNGKLLVAAGLENGNIQVFTYDNQFRCYSE 734

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 12/129 (9%)

Query: 1   MWWNSEME--TELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEY----GEE 54
           MW + E+E   + LAI  G    V  V+WS +G Y+   S D++  +     Y    G  
Sbjct: 361 MWVSDELEGWKQQLAIT-GPTKAVTDVAWSPNGLYMLATSLDQTTRLISRCNYDANAGSW 419

Query: 55  FECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWC 114
           FE  +  Q H  D+  V   S    ++        +I + FD+    A +L    G    
Sbjct: 420 FE-FARPQIHGYDMICVEPLSNTRFISGGDE----KIMRSFDEPKGVAQLLQKFAGIGIE 474

Query: 115 SDFEKSESS 123
           ++ E  ES+
Sbjct: 475 NELEMPESA 483

>Kwal_26.8975
          Length = 445

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 48/108 (44%), Gaps = 15/108 (13%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           + S SYD  +R W   +   +      GH G V    +    SS RL SG++D T+R+WK
Sbjct: 115 IVSGSYDGIVRTW---NLSGKVEKQYAGHSGAVRAVKYI---SSTRLVSGANDRTLRLWK 168

Query: 140 YIED--------NEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIAST 179
              D         EDD +     ++L  AH   V +V  S   +I+ +
Sbjct: 169 TKNDELKNNLAAEEDDVEEGKTLAIL-EAHKAPVVTVDVSGDRIISGS 215

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 105 LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           LNGH+  V   D    E    LCSGS D TV++W
Sbjct: 357 LNGHKNFVVALD-TCPEMEYMLCSGSHDGTVKVW 389

>Kwal_27.12586
          Length = 509

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 2/35 (5%)

Query: 105 LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           LNGH  T+   DF  SE+++ L SGSDD T+R+W+
Sbjct: 331 LNGHSATITAFDF-NSENNM-LLSGSDDKTLRVWR 363

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/132 (17%), Positives = 54/132 (40%), Gaps = 9/132 (6%)

Query: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           E+  L  + GH   + +  ++     L + S DK++ +W +          +    ++  
Sbjct: 324 ESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSS----NCFMGNTLG 379

Query: 68  VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC 127
           +    W     ++A +S D ++R+W    +  Q  ++++G    ++C     S   L+  
Sbjct: 380 ITSAFWIDDDKVIA-TSLDGSVRLWSHLTNTLQAISMVDGVP--IFCGSL--SPDKLKFA 434

Query: 128 SGSDDTTVRIWK 139
            G  D  V ++ 
Sbjct: 435 IGKMDGEVTVYN 446

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/87 (19%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 7   METELLAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           +  +++    GH     ++ +   +G+ + +   D ++ IW+   +  ++EC+   Q H+
Sbjct: 150 LPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWD---FYHDYECLRDFQGHN 206

Query: 66  QDVKHVVWHSVLSLLASSSYDDTIRIW 92
           + +K + +        SSS+D +++IW
Sbjct: 207 KPIKALRFTEDCQSFLSSSFDRSVKIW 233

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           L+ S   D TI+IW DF  D++C     GH   +    F  +E      S S D +V+IW
Sbjct: 177 LILSGGNDHTIKIW-DFYHDYECLRDFQGHNKPIKALRF--TEDCQSFLSSSFDRSVKIW 233

>CAGL0K07095g 698028..699143 highly similar to sp|P38328
           Saccharomyces cerevisiae YBR234c AR41, hypothetical
           start
          Length = 371

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 63/149 (42%), Gaps = 15/149 (10%)

Query: 91  IWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQV 150
           I++      Q  A L  H+  V   D        R+ + S D    +W+ + D      +
Sbjct: 39  IYRVGGPTPQLVATLANHDKLVTAVDISPHG---RIVTCSQDRNAYVWEPLSDGSYKPTL 95

Query: 151 WALQSVLPSAHSRAVYSVSWSPTGLIASTGSDG-LLAI-YQEKEEGKWEIIAQHELAHGV 208
             L+       +RA  SVSW+P+G   + GS   ++A+ Y E E   W  +++H      
Sbjct: 96  VLLRI------NRAATSVSWAPSGYKFAVGSSARIIAVCYYEHENNWW--VSKHIKKPIK 147

Query: 209 YETNVVKWTQIDGETLLVTGGDDGCVNIW 237
              N + W   +G  LL  GG DG + ++
Sbjct: 148 STINCLSW-HTNG-VLLAAGGTDGYMRVF 174

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 9  TELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEA 48
           +L+A +  H+  V +V  S  G  + TCS+D++ ++WE 
Sbjct: 47 PQLVATLANHDKLVTAVDISPHGR-IVTCSQDRNAYVWEP 85

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 51/120 (42%), Gaps = 13/120 (10%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
            W+  M   L+ ++      V S++   SGYY+AT   D+S+ IW+   + ++   +  L
Sbjct: 258 LWSPSMPEPLVKLLSA-RGPVNSIAIDRSGYYMATTGADRSMKIWDIRNF-KQLHSVESL 315

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDF----DDDWQCAAVLNG--HEGTVWCS 115
                +V  +    +L+L    S    + +WKD      D   C   + G  H  T + S
Sbjct: 316 PTPGTNVS-ISDTGLLAL----SRGPHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPYMS 370

>Scas_711.11
          Length = 695

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAV---LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVR 136
           LA+ + D  +R+W     D +   V   L GH G++ C  F+       + +GS D TVR
Sbjct: 552 LATGTRDGIVRLW-----DLRAGKVVRALEGHSGSITCLKFDNKN----IVTGSIDKTVR 602

Query: 137 IW 138
           IW
Sbjct: 603 IW 604

>Scas_700.27*
          Length = 433

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 71/184 (38%), Gaps = 56/184 (30%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQ 62
           W+      ++ ++ GH+N +  V        + +CS D ++ +W+        + + V+ 
Sbjct: 233 WDIRARVAVMTLI-GHKNPINKVHCLPVDPQIVSCSTDATIRLWDI----VAGKSMKVIT 287

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIWK--------DFD--------------DDWQ 100
            H + V+++ +H     ++S S +D IR WK        +F+              DD  
Sbjct: 288 HHKKSVRNIAFHPTEFSMSSCSAND-IRSWKLPEGGLLTNFNSDGLGIINTLSINQDDVL 346

Query: 101 CAAVLNGH--------------------------EGTVWCSDFEKSESSLRLCSGSDDTT 134
            A   NG                           E  + CS F++  + LRL +G  D +
Sbjct: 347 FAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERGILCSTFDR--TGLRLLTGETDKS 404

Query: 135 VRIW 138
           ++IW
Sbjct: 405 IKIW 408

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 7/81 (8%)

Query: 161 HSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI 219
           H  AV  V +SPTG    TGS D  + IY+       EI     + H V++   VK++ +
Sbjct: 304 HVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH-VFQ---VKYS-M 358

Query: 220 DGETLLVTGGDDGCVNIWKNE 240
           D +  +++G DDG V +W+++
Sbjct: 359 DSK-YIISGSDDGNVRLWRSK 378

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

Query: 31  GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIR 90
            +   T + D + + ++          ++V ++H   V  V +      + + SYD +IR
Sbjct: 274 AFNFVTANEDHNAYYYDMRNLSR---SLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIR 330

Query: 91  IWKDFDDDWQCAAVLNGHEGTVWCSD-------FEKSESSLRLCSGSDDTTVRIWK 139
           I+K            +GH   ++ +         + S  S  + SGSDD  VR+W+
Sbjct: 331 IYK----------TNHGHSREIYHTKRMQHVFQVKYSMDSKYIISGSDDGNVRLWR 376

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 36.2 bits (82), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 9   TELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFE 56
           T L + + GH   V SVSWS  G YL T SRD  + +W+  + GE  +
Sbjct: 62  TMLGSKLGGHVQAVNSVSWSGCGRYLITTSRDWFIKLWDLAKPGEPLK 109

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 16/86 (18%)

Query: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDW-----------QCAAVLNGHEGTV 112
           HS  ++ V + S  + L S+  D T+R+WK  +DD            +  A+L GH+  V
Sbjct: 141 HSGPIRAVHYISS-TRLVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPV 199

Query: 113 WCSDFEKSESSLRLCSGSDDTTVRIW 138
              D  K     R+ S S D TV +W
Sbjct: 200 VSIDVSKD----RILSASCDNTVSLW 221

 Score = 32.0 bits (71), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 88/227 (38%), Gaps = 29/227 (12%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           LAI+EGH+  V S+  S      A+C  D +V +W  +   +E   I  +++   +V   
Sbjct: 189 LAILEGHKAPVVSIDVSKDRILSASC--DNTVSLWSTNY--KEMTVIDPMEDLGGNVSTA 244

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
                   L     D +IR            A+   H   V    F+KS+ ++   S S 
Sbjct: 245 AKKRRKLTLK----DGSIRRRAPL-------ALFESHSAPVEAVIFDKSDDTVGY-SVSQ 292

Query: 132 DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPT-GLIASTGSDGLLAIYQE 190
           D T++ W  I            + V     S ++ SV+  P   L+A   S   + ++  
Sbjct: 293 DHTIKTWDLI----------TAKCVDTKTTSYSLLSVAQLPKLNLLACGSSARHITLHDP 342

Query: 191 KEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
           +     +I  Q  + H  +   V   T  + E ++ +   DG V +W
Sbjct: 343 RVNSSSKITQQQLVGHKNFV--VALDTCPENEYMICSASHDGTVKVW 387

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 82  SSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYI 141
           S SYD  +R +   +   +     +GH G +    +    SS RL S  +D T+R+WK  
Sbjct: 118 SGSYDGIVRTY---NLSGKVEKQYSGHSGPIRAVHYI---SSTRLVSAGNDRTLRLWKTK 171

Query: 142 EDN 144
            D+
Sbjct: 172 NDD 174

>KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces
           cerevisiae YMR131c RSA2, start by similarity
          Length = 523

 Score = 35.8 bits (81), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 81/196 (41%), Gaps = 23/196 (11%)

Query: 9   TELLAIVEGHENEVKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67
           T+  A    +   ++ + WS +     A+C  D  + IW  D   ++ +    ++  + D
Sbjct: 323 TDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIW--DTRSKKHKPAISVKASNTD 380

Query: 68  VKHVVWHSVLS-LLASSSYDDTIRIWKDFDDDWQCAAVLNG------HEGTVWCSDFEKS 120
           V  + W   +  LLAS   D T  +W       Q A+  +       H+G +    F   
Sbjct: 381 VNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPL 440

Query: 121 ESSLRLCSGSDDTTVRIWKYIEDNEDDE------QVWALQSVLPS---AH-SRAVYSVSW 170
           + S+ +   S+D TV +W    + +D+E      +   LQ + P     H  + V  V W
Sbjct: 441 DESI-IAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKW 499

Query: 171 SP--TGLIASTGSDGL 184
                G + STG+DGL
Sbjct: 500 HKQIPGCLVSTGTDGL 515

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 160 AHSRAVYSVSWSPT--GLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWT 217
           A+++++  + WS T   + AS G DG + I+  + +     I+   +     + NV+ W+
Sbjct: 331 ANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAIS---VKASNTDVNVISWS 387

Query: 218 QIDGETLLVTGGDDGCVNIW 237
           +  G  LL +G DDG   +W
Sbjct: 388 EKIG-YLLASGDDDGTWGVW 406

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 35.8 bits (81), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 61/149 (40%), Gaps = 21/149 (14%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV-VWHS 75
           GH   V S+ +++ G  L + S D+S+  W     G   + +S    HS  V  + +   
Sbjct: 108 GHTAPVISICYNNKGNILCSSSMDESIKEWHVLS-GTALKTMSA---HSDAVVSIDIPKF 163

Query: 76  VLSLLASSSYDDTIRIWK----------DFDDDWQCAAVLNGHEGTVWCSDFEKSESSLR 125
             S+L+S SYD  IRI+            +D DW         +G V  S  + S +   
Sbjct: 164 DSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWI------AEDGVVPISTVKFSRNGKF 217

Query: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQ 154
           L   S D  V++W+Y         +W  Q
Sbjct: 218 LLVKSLDNVVKLWEYTRGTVVRTFLWPHQ 246

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 11/83 (13%)

Query: 105 LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRA 164
           L GH  T+   +F KS  SL   S SDD T+++W+    +  ++          + H++ 
Sbjct: 336 LLGHTSTITTLEFNKSNKSL--LSASDDNTIKVWRGGNSSAANDF---------TDHTKT 384

Query: 165 VYSVSWSPTGLIASTGSDGLLAI 187
           + S  W    LI ST  DG + +
Sbjct: 385 ISSAHWINDDLIISTAYDGTVKV 407

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           L  + GH + + ++ ++ S   L + S D ++ +W     G      +   +H++ +   
Sbjct: 333 LGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWR----GGNSSAANDFTDHTKTISSA 388

Query: 72  VWHSVLSLLASSSYDDTIRIW 92
            W +   L+ S++YD T+++W
Sbjct: 389 HWIND-DLIISTAYDGTVKVW 408

>Kwal_33.15591
          Length = 714

 Score = 35.4 bits (80), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 116/274 (42%), Gaps = 73/274 (26%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIW--------------EADEY---- 51
           +L A + GHE +VKSV+  ++   +ATCSRD SV +W              ++DE+    
Sbjct: 7   KLSATLSGHEQDVKSVAVLNNDT-VATCSRDGSVRLWKKGHNNLWQDAVVYQSDEFVNSL 65

Query: 52  ------GEEF----ECI-----SVLQEHSQDVKHV---------VWHSVLSLLASSSYDD 87
                 G  F     C+      +L +  QD + V         V +S    + S S+D 
Sbjct: 66  CYDNTSGLLFCGGQNCLINSVSPLLGDVGQDSEFVLIGHENNVCVLNSSQGYVLSGSWDT 125

Query: 88  TIRIWKDFDDDWQCAAV--LNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNE 145
           T ++W      +Q A    L GH  +VW  D +         + S D T+++W       
Sbjct: 126 TAKVW------FQGALKHELKGHTASVW--DVKMLPEVGFYMTASADGTIKLW------- 170

Query: 146 DDEQVWALQSVLPSAHSRAVYSVSWSPTG-LIASTGSDGLLAIYQEKEEGKWEIIAQHEL 204
           + E+V    + L   H+  +  +    +G   AS  +DG + I  + E    + +  HE 
Sbjct: 171 EGEKVLKTFTGL---HTDVIRHIDIDASGEKFASCSNDGTVKI-NDMEGKTLKTLVGHE- 225

Query: 205 AHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
              VY    VK+   +G+  +++ G+D  V IWK
Sbjct: 226 -SFVYS---VKFAP-NGD--VISCGEDRTVRIWK 252

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD 49
           ++ME + L  + GHE+ V SV ++ +G  + +C  D++V IW+AD
Sbjct: 211 NDMEGKTLKTLVGHESFVYSVKFAPNGDVI-SCGEDRTVRIWKAD 254

>YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein with
           possible role in ribosome biogenesis, has similarity to
           mouse Bop1 growth suppressor, has five WD (WD-40)
           domains [2424 bp, 807 aa]
          Length = 807

 Score = 35.4 bits (80), Expect = 0.032,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 25/95 (26%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNE-------DDEQVWA 152
           +C+ +  GH+G V         S L L +GSDD TVR+W+ +   E       DDE+   
Sbjct: 428 RCSTIYAGHKGKV--RTLSIDPSGLWLATGSDDGTVRVWEILTGREVYRTTLIDDEEN-- 483

Query: 153 LQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAI 187
                P  H   +  + W+P        ++G+LA+
Sbjct: 484 -----PDYH---IECIEWNP------DANNGILAV 504

 Score = 32.7 bits (73), Expect = 0.23,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE 47
           I  GH+ +V+++S   SG +LAT S D +V +WE
Sbjct: 432 IYAGHKGKVRTLSIDPSGLWLATGSDDGTVRVWE 465

 Score = 28.9 bits (63), Expect = 4.2,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 47/101 (46%), Gaps = 9/101 (8%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFE--CI 58
           +W + ++ +     +  HE  V+SV++       ++ + D ++ ++ A  Y +  +   I
Sbjct: 705 LWHDLDLASTPYKTLRYHEKAVRSVNFHKKLPLFSSAADDGTIHVFHATVYDDMMKNPMI 764

Query: 59  SVLQE-------HSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
             L++       +S  V   +WH   + L S+  D+T R+W
Sbjct: 765 VPLKKLTGHKVINSLGVLDAIWHPREAWLFSAGADNTARLW 805

>YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein
           involved in ribosome assembly, member of WD (WD-40)
           repeat family [1536 bp, 511 aa]
          Length = 511

 Score = 35.4 bits (80), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 22  VKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLS-L 79
           ++ + WS +     AT   D  + IW  D   ++ +    ++  + DV  + W   +  L
Sbjct: 324 IEDIQWSRTESTVFATAGCDGYIRIW--DTRSKKHKPAISVKASNTDVNVISWSDKIGYL 381

Query: 80  LASSSYDDTIRIW--KDFD----DDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
           LAS   + T  +W  + F     D  Q  A  + H+G +    F   + S+ +  GS+D 
Sbjct: 382 LASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESI-VAVGSEDN 440

Query: 134 TVRIWKYIEDNEDDE------QVWALQSVLPS---AH-SRAVYSVSWSP--TGLIASTGS 181
           TV +W    + +D+E      +   LQ + P     H  + V  V W     G + STG+
Sbjct: 441 TVTLWDLSVEADDEEIKQQAAETKELQEIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGT 500

Query: 182 DGL 184
           DGL
Sbjct: 501 DGL 503

>Scas_684.7
          Length = 511

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 22  VKSVSWSHS-GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLS-L 79
           ++ + WS +     A+   D  + IW  D   ++ +    ++  + DV  + W   L  L
Sbjct: 324 IEDIQWSRTESTVFASAGCDGYIRIW--DTRSKKHKPAISVKASNTDVNVISWSEKLGYL 381

Query: 80  LASSSYDDTIRIW--KDFDDD----WQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
           LAS   + T  +W  + F  +     Q  A  + H+G +    F   + S+ +  GS+D 
Sbjct: 382 LASGDDNGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESI-IAVGSEDN 440

Query: 134 TVRIWKYIEDNEDDE------QVWALQSVLPS---AH-SRAVYSVSWSP--TGLIASTGS 181
           TV +W    + +D+E      +   LQ + P     H  + V  V W     G + STG+
Sbjct: 441 TVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGT 500

Query: 182 DGL 184
           DGL
Sbjct: 501 DGL 503

>Scas_659.9
          Length = 475

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 161 HSRAVYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQI 219
           H  AV  V +SPTG    TGS D  + I+        EI     + H V++   VK++ +
Sbjct: 298 HVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQH-VFQ---VKFS-M 352

Query: 220 DGETLLVTGGDDGCVNIWKNE 240
           D +  +V+G DDG V +W+++
Sbjct: 353 DAK-YIVSGSDDGNVRLWRSK 372

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 17/91 (18%)

Query: 56  ECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCS 115
             ++V ++H   V  V +      + + SYD TIRI+             +GH   ++ +
Sbjct: 290 RALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFN----------TTHGHSREIYHT 339

Query: 116 D-------FEKSESSLRLCSGSDDTTVRIWK 139
                    + S  +  + SGSDD  VR+W+
Sbjct: 340 KRMQHVFQVKFSMDAKYIVSGSDDGNVRLWR 370

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL--QEHSQDVKHVV 72
            EGH +E+ +V+ S  G Y+ T  RDK + +W      E    + V+  ++   +V  + 
Sbjct: 251 TEGHYDEILTVAASPDGKYVVTGGRDKKLIVWST----ESLAPVKVIPTKDRRGEVLGLA 306

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           +      L ++  D  IR +    + +    VL GH+  V  +D         +  GS D
Sbjct: 307 FRRNTDQLYAACADYKIRTFA--INQFSQLEVLYGHQDIV--ADISALNMERCVTVGSRD 362

Query: 133 TTVRIWK 139
            T  +WK
Sbjct: 363 RTCMLWK 369

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 35.0 bits (79), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 9/80 (11%)

Query: 47  EADEYGEEFECISV---------LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDD 97
           EA E GE  E I V           +H+  V  V  H  L L+AS   D+ I +W     
Sbjct: 37  EAMEGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQ 96

Query: 98  DWQCAAVLNGHEGTVWCSDF 117
             + A  L+GH  +V  + F
Sbjct: 97  PPKFAGTLSGHTESVIAAHF 116

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 88/194 (45%), Gaps = 21/194 (10%)

Query: 57  CISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFD-------DDWQCAAVLNGHE 109
               L+ H+ +V  V +     ++ S+S D  +R+W +F        D+ +C  V+  H+
Sbjct: 48  VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVW-NFPKLREGHMDEVECIQVIKHHK 106

Query: 110 GTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQS-VLPSAHSRAVYSV 168
            T+      K+     L  G  D ++ +W +IED    ++ +++Q  V P   S  ++ +
Sbjct: 107 HTITVFAVLKN----LLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLS--MHEI 160

Query: 169 SWSPTGLIASTGSDGLLAIYQ--EKEEG--KWEIIAQHELAHGVYETNVVKWTQIDGETL 224
             +   ++A  G++  + IY      EG  K E   + E  H  +  ++V    + G+ L
Sbjct: 161 EKTQF-ILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLE-GHEDWIKSLVFRETVPGDYL 218

Query: 225 LVTGGDDGCVNIWK 238
           L +G  D  + +W+
Sbjct: 219 LASGSQDRYIRLWR 232

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 13  AIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           A++ GH++ + S+ W  +   L T + D +V +WE D     + C S L E S
Sbjct: 273 ALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGELS 325

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 88/231 (38%), Gaps = 60/231 (25%)

Query: 10  ELLAIVEGHENEVKSVSWSHS---GYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           E    +EGHE+ +KS+ +  +    Y LA+ S+D+ + +W         E I   +E  +
Sbjct: 192 EFATKLEGHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRI----RTNEKIDTSEEDEK 247

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRL 126
                     L+LL++  Y     I  D        A++ GH+   W S  +  ++ L+L
Sbjct: 248 K---------LTLLSNKIYK--FDISADVHVAINFEALIMGHDD--WISSLQWHKTKLQL 294

Query: 127 CSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186
            + + DT V +W    + +    +W   S L    S+          G   +TGS G   
Sbjct: 295 LTSTADTAVMVW----EPDTISGIWICSSRLGELSSK----------GASTATGSSG--- 337

Query: 187 IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
                  G W  I                W   DG+ +++T G  G   IW
Sbjct: 338 -------GFWSCI----------------WFTHDGKDVILTNGKTGSWRIW 365

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 15/156 (9%)

Query: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE-HSQDV 68
           +L  ++  H   +  + +S    YL + SRD+   +WE +     F   S  ++ HS+ +
Sbjct: 598 QLPQVLPFHNLTITKLRFSKDNRYLLSVSRDRLWSLWERNFDNNSFVLRSFKEKPHSRII 657

Query: 69  KHVVWHSVLSLLA--SSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES---- 122
               W  +   LA  ++S D T++ W+   +D   +  L   E ++  S+   S S    
Sbjct: 658 WDADWVPLAKGLAFITASRDKTLKFWRLSKEDEATSVEL---ENSIRFSEPVTSISVHKD 714

Query: 123 ----SLRLCSGSDDTTVRIWKYIEDNEDDEQV-WAL 153
                + L  G +   +RI  Y E   D  ++ WA+
Sbjct: 715 LYNEKVLLAVGFESGAIRILSYTESFNDITEIDWAI 750

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 76/194 (39%), Gaps = 26/194 (13%)

Query: 51  YGEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFD-DDW-QCAAVLNGH 108
           +G E  CI V    S D K +         A  S +    + + FD ++W Q   VL  H
Sbjct: 558 HGYEISCIDV----SPDRKLIA-------TACKSNNAQHAVIRLFDAENWNQLPQVLPFH 606

Query: 109 EGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSV 168
             T+    F K      L S S D   R+W   E N D+   + L+S     HSR ++  
Sbjct: 607 NLTITKLRFSKDNR--YLLSVSRD---RLWSLWERNFDNNS-FVLRSFKEKPHSRIIWDA 660

Query: 169 SWSP--TGLIASTGS-DGLLA---IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE 222
            W P   GL   T S D  L    + +E E    E+      +  V   +V K    + +
Sbjct: 661 DWVPLAKGLAFITASRDKTLKFWRLSKEDEATSVELENSIRFSEPVTSISVHK-DLYNEK 719

Query: 223 TLLVTGGDDGCVNI 236
            LL  G + G + I
Sbjct: 720 VLLAVGFESGAIRI 733

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 35.0 bits (79), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 25/164 (15%)

Query: 80  LASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWK 139
           L S+S D  I +W+    DW+    L GH  T   +DF+   S+    S S+D ++R+W 
Sbjct: 106 LLSASEDHKIIVWRV--KDWENFGTLKGH--TARINDFDIHPSNRVAVSVSEDHSIRLWN 161

Query: 140 YIEDNEDDEQVWALQSVLPSAHSRAVY----SVSWSPTGLIASTGSDGLLAIYQEKEEGK 195
            +      ++   L+    + + + V     + S+   GL+     + LL    E  +  
Sbjct: 162 LMT----VKKAGVLKLRKYNQNGQFVRWCGENGSYIAVGLL-----NKLLIFKTETAKVH 212

Query: 196 WEI-IAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
            EI  +++ L H   E        IDGE  +V G + G V  WK
Sbjct: 213 REIDFSRNTLMHLEREI-------IDGEEYIVVGLNSGAVQFWK 249

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 12/76 (15%)

Query: 32  YYLATCSRDKSVWIWEADEYGEEFEC-------ISVLQEHSQDVKHVVW---HSVLSLLA 81
           + +AT   DK V +W+     +           I+ +Q HS  V+ VVW   HS  ++L 
Sbjct: 236 HVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHS--NILL 293

Query: 82  SSSYDDTIRIWKDFDD 97
           S+SYD T R W D  D
Sbjct: 294 STSYDMTCRAWHDLAD 309

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 7   METELLAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           +  +++   +GH N   S+     +G+ + +   D +V +W+   +  + +C+     HS
Sbjct: 136 LPKKVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWD---FYHDRKCLRDFVGHS 192

Query: 66  QDVKHVVWHSVLSLLASSSYDDTIRIW 92
           + +K + + S  S   S SYD  ++IW
Sbjct: 193 KPIKTLDFTSDSSQFLSGSYDQQVKIW 219

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 34.7 bits (78), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 82/200 (41%), Gaps = 31/200 (15%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWEAD---------EYG 52
           W+ E   +  +I+  H++ V  V W         T S DK++ + +              
Sbjct: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273

Query: 53  EEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTV 112
             F  +S   +HS++           LLA++  D  I ++ D  D      V++GH+ +V
Sbjct: 274 SPFNTLS-FSKHSRN-----------LLAAAGVDSQIYLY-DMRDMSSPLHVMSGHQDSV 320

Query: 113 WCSDFEKSESSLRLCSGSDDTTVRIWKYI----EDNEDDEQVWALQSVLPSA-HSRAVYS 167
              +F      +   SGSD   + IW       E ++DD    A + ++  A H   V  
Sbjct: 321 TTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNE 379

Query: 168 VSWSPTG--LIASTGSDGLL 185
            S++P    L+AST  D ++
Sbjct: 380 FSFNPQIPWLLASTEEDNVI 399

>Scas_706.24
          Length = 460

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 68/159 (42%), Gaps = 14/159 (8%)

Query: 3   WNSEMETELLAIVEGH----ENE-VKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFEC 57
           +N + E  ++A +  H    EN+ + S+SW +SG ++    R   + + E  +   E   
Sbjct: 182 YNVKEEHSMVASLPVHSISDENDTIYSISWDNSGKFIFIGFRSGKLALLEVSDDTGEMTF 241

Query: 58  ISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDF 117
             ++Q H   +  +    V   + + S D +  +W        C+ +++  EG V   D 
Sbjct: 242 KLIVQAHRSAISVIKMDPVGRFVITGSTDGSCALWD--TSTLTCSLIIDDMEGAVISMDV 299

Query: 118 EKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSV 156
           +     L +CS  D   VR +     N +D  +W  +++
Sbjct: 300 DHLGKILAVCSTDD--LVRFY-----NINDGTLWKTENM 331

>Scas_542.5
          Length = 327

 Score = 34.7 bits (78), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 98/222 (44%), Gaps = 49/222 (22%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEA------DEYG-EEFECISVLQEHSQDVKHVVW 73
            + S+S+   G YL T S   ++ +++A      +  G +++ C S    H+Q+    ++
Sbjct: 28  PITSISFDDYGQYLLTASASDNMHLYDAVGCRFLNTIGSKKYGCHSAKFTHAQN--ECIY 85

Query: 74  HSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDT 133
            S +      S+D  IR      +  Q      GH+  V  SD E S  +    S S D 
Sbjct: 86  SSTMK-----SFD--IRHLNL--ETNQYLRYFIGHDALV--SDIEMSPLNDTFLSASYDE 134

Query: 134 TVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEKEE 193
           +VR+W        D +V   Q+++PS      + +++ P+GL+ + G+       +  E 
Sbjct: 135 SVRLW--------DLRVSKAQAIVPSV---VPHCIAYDPSGLVFALGNP------ENFEI 177

Query: 194 GKWEIIAQHELAHGVYETNVV-----KWTQI----DGETLLV 226
           G + +    +L +G + T  V     +W ++    DG+ LL+
Sbjct: 178 GLYNV---RQLKNGPFLTMKVDPKFSQWNKLEFSNDGKYLLL 216

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 35.0 bits (79), Expect = 0.050,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 13/89 (14%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSV-LP 158
           +C+ V  GH+G +         S L L +GSDD TVR+W+ +   E    V+    V + 
Sbjct: 454 RCSTVYAGHKGKI--RTLSIDPSGLWLATGSDDGTVRVWEILTGRE----VYKATIVDIK 507

Query: 159 SAHSRAVYSVSWSPTGLIASTGSDGLLAI 187
           +     + +V W+P   +      GLLA+
Sbjct: 508 NNQDDHIETVEWNPDKTV------GLLAV 530

 Score = 33.1 bits (74), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD--VKHV 71
           +  GH+ +++++S   SG +LAT S D +V +WE     E ++   V  +++QD  ++ V
Sbjct: 458 VYAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKATIVDIKNNQDDHIETV 517

Query: 72  VWH 74
            W+
Sbjct: 518 EWN 520

>Kwal_55.21450
          Length = 503

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 7   METELLAIVEGHENEVKSVSW-SHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           +  +L+    GH+N   S+     SG+   +   D  V IW  D Y +  E +   + HS
Sbjct: 198 LPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIW--DLYRDR-ELLRDYRGHS 254

Query: 66  QDVKHVVWHSVLSLLASSSYDDTIRIW 92
           + V+ + ++S  S   S S+D  I+IW
Sbjct: 255 KAVRGISFNSEGSEFLSVSFDQQIKIW 281

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%)

Query: 3   WNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD 49
           W+   + ELL    GH   V+ +S++  G    + S D+ + IW+ +
Sbjct: 238 WDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTE 284

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 73/181 (40%), Gaps = 14/181 (7%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           L+ + + H + + ++ +   G    + S DKS+ IWE ++     + IS   ++S  + +
Sbjct: 333 LVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWE-NQINIPIKQISDTSQYS--MPY 389

Query: 71  VVWHSVLSLLASSSYDDTIRIWKDFDD-DWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
           +  H   +  A+ S D+ I  +              +GH+   +   F  S     + SG
Sbjct: 390 IGIHPEQNYFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIASG 449

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--TGLIASTGSDGLLAI 187
                V IW        D +   L         + + +V+WSP  T  +  +G+ G + +
Sbjct: 450 DTRGRVYIW--------DWKTTHLLKHFDVPDKKTIVTVAWSPQETSKMLCSGNGGEIFL 501

Query: 188 Y 188
           Y
Sbjct: 502 Y 502

>Kwal_47.17572
          Length = 434

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFE 56
            H   ++S++WS +G YL T SRD +V +W+    GE   
Sbjct: 71  AHVRSIQSIAWSKNGRYLLTSSRDWTVKVWDLSMPGEPMR 110

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%)

Query: 25  VSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSS 84
           V +SH G YLA    + +V I++ D         +    H + ++ + W      L +SS
Sbjct: 33  VRFSHGGDYLAMGCTNGAVIIYDMDTAKPIAMLGNKGGAHVRSIQSIAWSKNGRYLLTSS 92

Query: 85  YDDTIRIW 92
            D T+++W
Sbjct: 93  RDWTVKVW 100

>Scas_705.2
          Length = 571

 Score = 34.7 bits (78), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 18/131 (13%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL--QEHSQDVKHVV 72
            EGH +E+ +V+ S  G Y+ T  RD+ + +W      E    I V+  ++   +V  +V
Sbjct: 230 TEGHYDEILTVAASPDGKYVVTGGRDRKLIVWST----ESLAPIKVIPTKDRRGEVLSLV 285

Query: 73  WHSVLSLLASSSYDDTIRIW--KDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC--S 128
           +      L +S  D  IR +  K F         L GH   V     + S  S+  C   
Sbjct: 286 FRKNSDELYASCADYKIRTYSIKQFSQ----LETLYGHHDIV----VDISALSMERCVTV 337

Query: 129 GSDDTTVRIWK 139
           G+ D T  +WK
Sbjct: 338 GARDRTAMLWK 348

>YBR234C (ARC40) [413] chr2 complement(685395..686549) Component of
           the ARP2/3 actin-organizing complex, involved in actin
           assembly and function [1155 bp, 384 aa]
          Length = 384

 Score = 34.3 bits (77), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 15/137 (10%)

Query: 103 AVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHS 162
           A L  H+ T+   D        R+ + S D    +W+ + D      +  L+       +
Sbjct: 57  ATLKDHDKTITAVDISIHG---RIVTCSQDRNAYVWEPLSDGTYKPTLVLLRI------N 107

Query: 163 RAVYSVSWSPTGLIASTGSDG-LLAI-YQEKEEGKWEIIAQHELAHGVYETNVVKWTQID 220
           RA  SV+W+P G   + GS   ++A+ Y E E   W  +++H         N + W   +
Sbjct: 108 RAATSVTWAPNGYKFAVGSSARIIAVCYYEHENNWW--VSKHIKKPIKSTINCLSW-HAN 164

Query: 221 GETLLVTGGDDGCVNIW 237
           G  LL  GG DG + ++
Sbjct: 165 G-VLLAAGGTDGFMRVF 180

 Score = 28.1 bits (61), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 11  LLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKH 70
           L A ++ H+  + +V  S  G  + TCS+D++ ++WE    G  ++   VL   ++    
Sbjct: 55  LFATLKDHDKTITAVDISIHGR-IVTCSQDRNAYVWEPLSDG-TYKPTLVLLRINRAATS 112

Query: 71  VVW 73
           V W
Sbjct: 113 VTW 115

>Scas_712.34
          Length = 399

 Score = 34.3 bits (77), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 14/91 (15%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKS---VWIWEADEYGEEFECISVL----QEHSQD 67
           +E + N V++V +S +G  LA  +   S   V ++E  ++GE    ++V     Q   + 
Sbjct: 231 IEQNSNTVRAVKFSPAGSLLAVANDSGSFGCVALYET-QFGERIGNLTVPTHSGQSSVES 289

Query: 68  VKHVVWHSVLSL------LASSSYDDTIRIW 92
             H  W   LS       LA+S YD  +R+W
Sbjct: 290 FAHSGWVFALSFNSTGEFLATSGYDSKVRVW 320

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 34.3 bits (77), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 16/115 (13%)

Query: 61  LQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKS 120
           L  H + +  V ++    LL S S D +  +W  +  + +    L+GH GT+W  D    
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW--YSLNGERLGTLDGHTGTIWSIDV--- 60

Query: 121 ESSLRLC-SGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG 174
           +   + C +GS D ++++W    D  + + V   +S +P      V  V +SP G
Sbjct: 61  DCFTKYCVTGSADYSIKLW----DVSNGQCVATWKSPVP------VKRVEFSPCG 105

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           + GHE  +  V ++  G  L +CS+D S  +W    Y    E +  L  H+  +  +   
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVW----YSLNGERLGTLDGHTGTIWSIDVD 61

Query: 75  SVLSLLASSSYDDTIRIWKDFDDDWQCAAV 104
                  + S D +I++W     + QC A 
Sbjct: 62  CFTKYCVTGSADYSIKLWD--VSNGQCVAT 89

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 33.9 bits (76), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 20  NEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSL 79
           +E+  ++WS    Y+ T   D  V I++  E      C++ + EH+  V+ VVW      
Sbjct: 137 SEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEK----TCVAHVVEHNHYVQGVVWDPQNEY 192

Query: 80  LASSSYDDTIRIWK 93
           + S S D ++ I+K
Sbjct: 193 IISQSADRSVHIYK 206

 Score = 31.2 bits (69), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 26/95 (27%)

Query: 162 SRAVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEI------------------IAQHE 203
           S+ +YS+S+ P+ L  S+G+  L+    + +   W++                  + QHE
Sbjct: 13  SQPIYSISFQPS-LPGSSGAPRLVTAGGDNKARVWQLNFDSERPGKVDSIDFLSSLTQHE 71

Query: 204 LAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
            A      NV ++    G+ +L T GDDG + +WK
Sbjct: 72  QA-----VNVARFNP-SGD-VLATAGDDGLLLLWK 99

>Scas_649.10
          Length = 806

 Score = 34.3 bits (77), Expect = 0.093,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNE 145
           +C+ +  GH+G +         S L L +GSDD TVR+W+ +   E
Sbjct: 428 RCSTIFAGHKGKI--RTLSIDPSGLWLATGSDDGTVRVWEILTGRE 471

 Score = 32.3 bits (72), Expect = 0.37,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE 47
           I  GH+ +++++S   SG +LAT S D +V +WE
Sbjct: 432 IFAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWE 465

 Score = 28.1 bits (61), Expect = 8.6,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISV 60
           +W + ++ +     +  H+  V+SV++       ++ + D ++ I+ A  Y +  +   +
Sbjct: 704 LWHDLDLASTPYKTLRYHDKAVRSVNFHKRLPLFSSVADDGNIHIFHATVYDDMMKNPMI 763

Query: 61  LQ---------EHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
           +          ++S  V   +WH   + L S+  D+T R+W
Sbjct: 764 VPLKKLTGHKIKNSLGVLDAIWHPREAWLFSAGADNTARLW 804

>Scas_670.21
          Length = 595

 Score = 33.9 bits (76), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 20/164 (12%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLS 78
           ENE  S+SW  +G +LA    +  V I++  +     +C+  L  H   V  + W+    
Sbjct: 331 ENEYTSLSWVGAGSHLAVGQGNGLVEIYDVVKR----KCVRTLSGHVDRVACLSWNG--H 384

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           +L S S D  I + +D          LN H   V    +   E+  +L SG +D  V ++
Sbjct: 385 ILTSGSRDHNI-LHRDVRMPDPFFERLNTHSQEVCGLQWNTEEN--KLASGGNDNVVCVY 441

Query: 139 KYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--TGLIASTG 180
                N   + +          H  AV +++WSP   G++A+ G
Sbjct: 442 DGTSRNPMIKFI---------EHKAAVKALAWSPHKRGILATGG 476

 Score = 30.8 bits (68), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQ 66
           ++ + +  + GH + V  +SW+  G+ L + SRD ++   +       FE    L  HSQ
Sbjct: 361 VKRKCVRTLSGHVDRVACLSWN--GHILTSGSRDHNILHRDVRMPDPFFE---RLNTHSQ 415

Query: 67  DVKHVVWHSVLSLLASSSYDDTIRIW 92
           +V  + W++  + LAS   D+ + ++
Sbjct: 416 EVCGLQWNTEENKLASGGNDNVVCVY 441

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 33.9 bits (76), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 96/234 (41%), Gaps = 36/234 (15%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           ++GH N++    WS     + + S+D  + IW+    G +   I +    SQ V      
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMS-GLKKNAIPL---DSQWVLACAIS 139

Query: 75  SVLSLLASSSYDDTIRIWKDFDDD---WQCAAVLNGHEGTVWCSDFE--KSESSLRLCSG 129
              +L+AS    +   I++   ++    +  ++  GH  T + SD E   +ES L   + 
Sbjct: 140 PSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGH--TCYVSDLEFINNESIL---TA 194

Query: 130 SDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG------LIASTGSDG 183
           S D T  +W   +     E          S H   V ++S  P G      + AS GSDG
Sbjct: 195 SGDMTCALWDIPKSKRVSEY---------SDHLGDVLTLSVPPAGTTSYDSMFASGGSDG 245

Query: 184 LLAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237
            + ++  +     +     +      + + V++   DG + ++TG DDG   ++
Sbjct: 246 YVYLWDTRSPSSVQNFFVSD-----SDISTVRFFS-DGNS-IITGSDDGIARLF 292

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 33.9 bits (76), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 89/217 (41%), Gaps = 43/217 (19%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEAD------EYGEEFECISVLQEHS 65
           +  +EGH   +  +    +   +AT S+D +V +W A+      E G   E +  L  H 
Sbjct: 440 IGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHL 499

Query: 66  QDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVL--NGHEGTVWCSDFEKS-ES 122
            +V  +      + L ++S D TIR W  +    +C  V   N    + + S F KS E 
Sbjct: 500 DEVSSLYIDG--ANLMTASQDKTIRRWDLY--SGKCIQVFDVNFPSLSAYKSSFMKSNED 555

Query: 123 SL------------------RLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRA 164
           S+                   L +G+ D  +R+W    D    E V  L+      H  A
Sbjct: 556 SMILKTVNTPIIGSIQSFDAALATGTKDGLIRLW----DMRTGEVVRVLE-----GHMDA 606

Query: 165 VYSVSWSPTGLIASTGS-DGLLAIYQEKEEGKWEIIA 200
           + S+ +  T +I+  GS DG + ++  +     +II+
Sbjct: 607 ITSLKFDATTIIS--GSLDGTIRLWDLRSNNLTDIIS 641

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 33.9 bits (76), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 8/91 (8%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPS 159
           +C+ V  GH+G +     +   + L L +GSDD TVR+W+ +   E   QV  L +    
Sbjct: 417 RCSTVYVGHKGKIRTMSID--PTGLWLATGSDDGTVRVWEILTGRE-VYQVTILNAE--E 471

Query: 160 AHSRAVYSVSWSP---TGLIASTGSDGLLAI 187
            +   +  V W+P   TG++A T  + +  +
Sbjct: 472 NNDDHIDVVEWNPDSTTGILAVTAGENIFLL 502

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 17  GHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           GH+ +++++S   +G +LAT S D +V +WE    G E   +++L     +  H+
Sbjct: 424 GHKGKIRTMSIDPTGLWLATGSDDGTVRVWEI-LTGREVYQVTILNAEENNDDHI 477

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 45/101 (44%), Gaps = 9/101 (8%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFE--CI 58
           +W + ++ +     +  HE  V+SVS+        + + D ++ ++ A  Y +  +   I
Sbjct: 689 LWHDLDLASTPYKTLRYHEKAVRSVSFHKKLPLFCSAADDGNIHVFHATVYDDLMKNPMI 748

Query: 59  SVLQE-------HSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
             L++       +S  V   +WH   + L S+  D T R+W
Sbjct: 749 VPLKKLTGHKIVNSLGVLDTIWHPREAWLFSAGADKTARLW 789

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 77/179 (43%), Gaps = 36/179 (20%)

Query: 57  CISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWK--DFDDDWQCAAV-----LNGHE 109
           C   L E +Q+ +          L +S  D+ IR+W+  + ++D +   +     L  HE
Sbjct: 21  CFQPLSETNQNTRR---------LFTSGGDNKIRVWQLNESENDGKIETIDFLSSLTQHE 71

Query: 110 GTVWCSDFEKSESSLRLCSGSDDTTVRIWKY---------IEDNE--DDEQVWALQSVLP 158
             V    F K   +L   +  DD  + +WK          ++D+E  D ++ WA+   L 
Sbjct: 72  QAVNVCRFNKQGDTL--ATAGDDGLLLLWKKNETMVKEFGVDDDEFQDFKESWAVWKRLR 129

Query: 159 S--AHSRAVYSVSWSPTGL-IASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVV 214
           S  A +  +Y +SW+P G  IA    D  + ++   ++GK   +  H   H  Y   +V
Sbjct: 130 SGSASNAEIYDISWNPQGTCIAIASLDNTVRVFN-VDQGK---VVGHITEHNHYVQGIV 184

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 23/93 (24%)

Query: 162 SRAVYSVSWSP-------TGLIASTGSDGLLAIYQEKE---EGKWEII------AQHELA 205
           S  +YS+ + P       T  + ++G D  + ++Q  E   +GK E I       QHE A
Sbjct: 14  SHPIYSLCFQPLSETNQNTRRLFTSGGDNKIRVWQLNESENDGKIETIDFLSSLTQHEQA 73

Query: 206 HGVYETNVVKWTQIDGETLLVTGGDDGCVNIWK 238
                 NV ++ +  G+TL  T GDDG + +WK
Sbjct: 74  -----VNVCRFNK-QGDTL-ATAGDDGLLLLWK 99

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 11/109 (10%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLL 80
           E+  +SW+  G  +A  S D +V ++  D+     + +  + EH+  V+ +VW      +
Sbjct: 137 EIYDISWNPQGTCIAIASLDNTVRVFNVDQG----KVVGHITEHNHYVQGIVWDPQGEFI 192

Query: 81  ASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129
            S S D ++ I K   +D       N  +G    +   KSE   R   G
Sbjct: 193 VSQSADRSLAICKMIYED-------NEVKGLQLVNKILKSELPRRKNPG 234

>Scas_692.29
          Length = 456

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 95/227 (41%), Gaps = 25/227 (11%)

Query: 12  LAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHV 71
           LAI+EGH+  V S+  S++   L++ S D S+ +W      +E   +  ++E   +  + 
Sbjct: 197 LAILEGHKAPVVSLDVSNTSRILSS-SYDNSIGLWST--IYKEMTVVDPMEE-INNADNK 252

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSD 131
           +  +       +  D TIR            ++L  H   V  + F+ ++ ++   S S 
Sbjct: 253 ISTAARKRRKLTLKDGTIRRRAPL-------SLLESHTAPVEQASFDINDDTVGY-SVSQ 304

Query: 132 DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEK 191
           D T++ W  +     D +            S ++ S++  PT  + + GS        + 
Sbjct: 305 DHTIKTWDLVTARCIDTKTT----------SYSLLSLTQLPTLNLLACGSSARHITLHDP 354

Query: 192 EEGKWEIIAQHELAHGVYETNVVKW-TQIDGETLLVTGGDDGCVNIW 237
             G    + QH+L    ++  VV   T  + E +L +G  DG V +W
Sbjct: 355 RMGASSKVTQHQLIG--HKNFVVSLDTCPENEYILCSGSHDGTVKVW 399

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 55/140 (39%), Gaps = 29/140 (20%)

Query: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSL 124
           SQD K ++         ++SYD  IR W   +   +     +GH G +    F    S  
Sbjct: 112 SQDKKAII---------TASYDGVIRTW---NLSGKVQKQYSGHSGPIRAVKFI---SDT 156

Query: 125 RLCSGSDDTTVRIWKYIE--------DNEDDEQVWALQSVLP--SAHSRAVYSVSWSPTG 174
           RL S  +D T+R+WK           D ED+E        L     H   V S+  S T 
Sbjct: 157 RLVSAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTS 216

Query: 175 LIASTGSDGLLA----IYQE 190
            I S+  D  +     IY+E
Sbjct: 217 RILSSSYDNSIGLWSTIYKE 236

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 45  IWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLLASSS-YDDTIRIWKDFDDDWQCAA 103
           I    + G+  +C      H   +  +  ++ L +L+S++  D+ I++W       QC  
Sbjct: 266 IGTKGQLGKTLKC------HDDYINSLAINAQLGVLSSTANLDNEIKLWDI--STTQCLG 317

Query: 104 VLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIW 138
           VL+GH  TV  + F   + +  L S   D +V++W
Sbjct: 318 VLSGHRATVNTTRF--IDDTRLLASAGKDASVKVW 350

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 8/90 (8%)

Query: 9   TELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEY------GEEFECISVLQ 62
           T+ L ++ GH   V +  +      LA+  +D SV +W+ D          +  C++   
Sbjct: 313 TQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFD 372

Query: 63  EHSQDVKHVVWHSVLSLLASSSYDDTIRIW 92
            H   V  +   +  + + S S D T+R W
Sbjct: 373 GHKDSVTALA--TTGNAIVSGSNDKTLRHW 400

>Kwal_56.24478
          Length = 1296

 Score = 33.9 bits (76), Expect = 0.12,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 20  NEVKSVSWSHS-GYYLATCSRD--KSVWIWEADEYGEEFECISVLQEHSQDVKHVVWH-- 74
           +E+ S++W+ + G+  A+       S+W  +A +        S +      +  V WH  
Sbjct: 155 DEIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPN 214

Query: 75  --SVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
             + ++  + S  D +I +W   + +     +  GH   V   D+ K + +L L SG D+
Sbjct: 215 NSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDN 274

Query: 133 TTVRIW 138
           + V +W
Sbjct: 275 SCV-LW 279

>Scas_692.25
          Length = 488

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSH--SGYYLATCSRDKSVWIWEADE 50
           W   E +  L  ++  HE+ V  V      +  YLA+CSRD S+ IW A++
Sbjct: 218 WSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAED 268

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

Query: 34  LATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLS--LLASSSYDDTIRI 91
           +AT S+D S+ ++       +F    VL  H   V  V     L+   LAS S D +IRI
Sbjct: 204 IATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRI 263

Query: 92  WKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRI 137
           W    +D       + H   V C D     S   + SGS D ++R+
Sbjct: 264 WT--AEDGMILNSFHPHNEWVRCLDV----SGDFVLSGSQDASLRL 303

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 18/104 (17%)

Query: 30  SGYYLATCSRDKSVWIWE-------------ADEYGEEFECISVLQEHSQDVKHVVWHSV 76
           S  Y A+ SRD+ + IWE              +     F+CI  L+ H+  VK +     
Sbjct: 358 SFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRG- 416

Query: 77  LSLLASSSYDDTIRIWKDFDDDWQCAAV-LNGHEGTVWCSDFEK 119
            + L S S D TIR W    ++ +C     + H G V C D + 
Sbjct: 417 -NYLFSCSDDKTIRCWN--LENGECVKQWTDLHSGFVTCLDMDP 457

 Score = 30.8 bits (68), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 78  SLLASSSYDDTIRI--WKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTV 135
           +++A+SS D +I++  W   ++ +    VL  HE  V      +  +++ L S S DT++
Sbjct: 202 AIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSI 261

Query: 136 RIW 138
           RIW
Sbjct: 262 RIW 264

>Scas_512.3
          Length = 534

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 65/147 (44%), Gaps = 30/147 (20%)

Query: 55  FECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQ---CAAVLNGHEGT 111
            + +S L +H Q +  V ++S  ++LAS+  D  I +WK  D + Q    AA ++     
Sbjct: 57  IDFLSSLTQHEQAINVVKFNSPGTILASAGDDGQILLWKQQDVNEQNGETAAPVDSSVPK 116

Query: 112 VWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVL--PSAHSRAVYSVS 169
            + S FE                       +D E++++ W +   L  P ++S  +Y + 
Sbjct: 117 PFGSTFE-----------------------DDEENNKESWFVWKRLRAPGSNSSEIYDLD 153

Query: 170 WSPTGLIASTGS-DGLLAIYQEKEEGK 195
           WSP      +GS D  + ++ + E GK
Sbjct: 154 WSPCDRYVVSGSMDNSIRVF-DIESGK 179

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 20/92 (21%)

Query: 162 SRAVYSVSWSPTG-----LIASTGSDGLLA--IYQEKEEGKWEII------AQHELAHGV 208
           S+ VYS+ + P       L+ + G + + +  +   K+  K + I       QHE A   
Sbjct: 13  SQPVYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTIDFLSSLTQHEQA--- 69

Query: 209 YETNVVKWTQIDGETLLVTGGDDGCVNIWKNE 240
              NVVK+      T+L + GDDG + +WK +
Sbjct: 70  --INVVKFNS--PGTILASAGDDGQILLWKQQ 97

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 21  EVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLSLL 80
           E+  + WS    Y+ + S D S+ +++     E  + +    +H+  V+ V W  +   +
Sbjct: 148 EIYDLDWSPCDRYVVSGSMDNSIRVFDI----ESGKLLGTYADHNHYVQGVTWDPLNEFI 203

Query: 81  ASSSYDDTIRIWK 93
            S S D ++ I++
Sbjct: 204 LSQSADRSVNIYQ 216

>Scas_701.45
          Length = 1276

 Score = 33.5 bits (75), Expect = 0.14,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 76/179 (42%), Gaps = 20/179 (11%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDK----SVWIWEADEYGEEFECISVLQEHSQDVKHVVWH 74
           ++E+KSVSW+ S  ++   + D     S+W  +A +        S       ++  V WH
Sbjct: 164 QDEIKSVSWNKSLAHVFASAGDTTTYASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWH 223

Query: 75  -SVLSLLASSSYDDT---IRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGS 130
             V + +A++S  D+   I IW   + +     +   H   +   D+   + SL L SG 
Sbjct: 224 PKVTTYVATASGSDSDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGR 283

Query: 131 DDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG--LIASTGSDGLLAI 187
           D   V +W        D +   + +  P+  S+  +   ++P    + AS G DG + +
Sbjct: 284 DG-IVALW--------DTKANEVSTTYPT-RSQWCFKTKFAPENPDIFASAGFDGQINV 332

 Score = 29.6 bits (65), Expect = 2.5,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 128 SGSD-DTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW--SPTGLIASTGSDGL 184
           SGSD D  + IW     N          + L   H++ + S+ W      L+ S+G DG+
Sbjct: 234 SGSDSDPVILIWDLRNSNMP-------MTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGI 286

Query: 185 LAIYQEK 191
           +A++  K
Sbjct: 287 VALWDTK 293

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 8/146 (5%)

Query: 14  IVEGHENEVKSVSWSH-SGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVV 72
           ++ GH   +  +++       LAT S D     W+     + +   S  +  +  VK   
Sbjct: 109 VLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVK--- 165

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           W+   S + ++S+ + + +W D        +VL GH G+V   DF     +  + SG +D
Sbjct: 166 WNHKNSNVLATSHSNIVYVW-DVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSG-ND 223

Query: 133 TTVRIWKYIEDNEDDEQVWALQSVLP 158
            TV+ W Y  +  +DE    + +  P
Sbjct: 224 GTVKFWDY--NKVEDELQMTITTEFP 247

>KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces
           cerevisiae YER082c singleton, start by similarity
          Length = 558

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGE 53
            W+  M + L+ ++      +  ++    GYY+AT   DKS+ IW+   + E
Sbjct: 263 LWSPSMPSPLVRLLSS-RGSITGIAVDRQGYYMATTGSDKSLKIWDIRNFKE 313

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 14/115 (12%)

Query: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119
           +L+ H + +  V ++    L+ S + D    +W  +  + +      GH GT+W  D + 
Sbjct: 5   MLKGHERSLTQVKYNREGDLIFSCAKDSVASVW--YAINGERLGTFEGHMGTIWSIDVD- 61

Query: 120 SESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTG 174
            + +    +GS D +V++WK      D   V+  ++  P      V  V +SP G
Sbjct: 62  -QFTEYAVTGSADFSVKLWKVC----DGSNVYTWKTKTP------VRRVEFSPAG 105

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 14/85 (16%)

Query: 14 IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH-----SQDV 68
          +++GHE  +  V ++  G  + +C++D    +W    Y    E +   + H     S DV
Sbjct: 5  MLKGHERSLTQVKYNREGDLIFSCAKDSVASVW----YAINGERLGTFEGHMGTIWSIDV 60

Query: 69 KHVVWHSVLSLLASSSYDDTIRIWK 93
               ++V     + S D ++++WK
Sbjct: 61 DQFTEYAV-----TGSADFSVKLWK 80

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 65/155 (41%), Gaps = 10/155 (6%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHS 65
           E+  + +  ++GH N++  V WS     + + S+D  + IW+    G +   I +L   S
Sbjct: 73  ELNLQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFT-GLKKSAIPLL---S 128

Query: 66  QDVKHVVWHSVLSLLASSSYDD---TIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSES 122
           Q V         +L+AS+  D+     R+ +D        ++  GH   +  ++F    +
Sbjct: 129 QWVLSSAISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERT 188

Query: 123 SLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVL 157
            L   + S D T  +W   +     E +  L  VL
Sbjct: 189 IL---TASGDMTCAMWDIPKSKRVTEFIDHLGDVL 220

 Score = 27.7 bits (60), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 23/40 (57%)

Query: 7   METELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIW 46
           ++ E++  V+GH N + +V  S  G  + + S D ++ +W
Sbjct: 392 IKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 106/265 (40%), Gaps = 67/265 (25%)

Query: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL---- 61
           E+ T  +   E H++E+ ++S+      L + SRDK ++ W+        +CI  L    
Sbjct: 427 EIVTPCIHNFELHKDEITALSFDSEA--LVSGSRDKKIFHWDL----TTGKCIQQLDLIF 480

Query: 62  -QEHSQDVKHVV-------------------WHSVLSLLASSSYDDTIRIWKDFDDDWQC 101
              HS D+K                           S LA+ + D  +R+W     D + 
Sbjct: 481 TPTHS-DIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLW-----DLRV 534

Query: 102 AA---VLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLP 158
                +L GH   +    F+    S +L +GS D +VRIW        D +  ++  V+ 
Sbjct: 535 GKPVRLLEGHTDGITSLKFD----SEKLVTGSMDNSVRIW--------DLRTSSILDVI- 581

Query: 159 SAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGV------YETN 212
            A+   V S+ +    LI    ++G + ++  + +  W      E  H +          
Sbjct: 582 -AYDLPVSSLDFD-GKLITVGANEGGVNVFNMERDEHW---MTPEPPHSLDGDELSRRIA 636

Query: 213 VVKWTQIDGETLLVTGGDDGCVNIW 237
           +VK+   DG   L+ G +DG +N+W
Sbjct: 637 IVKYK--DG--FLINGHNDGDINVW 657

>KLLA0E24354g complement(2163651..2164829) similar to sgd|S0006021
           Saccharomyces cerevisiae YPL100w, start by similarity
          Length = 392

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 155 SVLPSAHSRAVYSVSWSPTGLIASTGSDG--LLAIYQEKEEGKWEIIAQHELAHGVYETN 212
           +VLP+ H   +  ++ SP G++ +T S+   ++ +++  +    E I  +E   G   + 
Sbjct: 195 NVLPAVHQSNIVCIACSPDGMLMATASEKGTIIRVFKTIDTENDEPILVNEFRRGSRPSR 254

Query: 213 VVKWTQIDGETLLVTGGDDGCVNIW 237
           + +       TLL   G+   ++I+
Sbjct: 255 ISEMKFNHDNTLLACVGESDTIHIF 279

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL--QEHSQDVKHVV 72
            EGH +E+ +V+ S  G Y+ T  RD+ + +W      E    + V+  ++   +V  + 
Sbjct: 232 TEGHYDEILTVAASPDGKYVVTGGRDRKLIVWST----ESLSPVKVIPTKDRRGEVLSLA 287

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC--SGS 130
           +      L +S  D  IR +    + +    +L GH   V     + S  ++  C   G+
Sbjct: 288 FRKNSDQLYASCADFKIRTYS--INQFSQLEILYGHHDIVE----DISALAMERCVTVGA 341

Query: 131 DDTTVRIWK 139
            D T  +WK
Sbjct: 342 RDRTAMLWK 350

>Kwal_55.21144
          Length = 570

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 10/127 (7%)

Query: 15  VEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL--QEHSQDVKHVV 72
            EGH +E+ +++ S  G Y+ T  RD+ + IW      E    + V+  ++   +V  +V
Sbjct: 229 TEGHYDEILTLAASPDGKYVITGGRDRKLIIWST----ESLAPVKVIPTKDRRGEVLSLV 284

Query: 73  WHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDD 132
           +      L ++  D  IR +    + +    +L GH+  V        E  + +  GS D
Sbjct: 285 FRKNSDQLYAACADYKIRTYS--INQFSQLEILYGHQDLVVGISALGMERCVTV--GSRD 340

Query: 133 TTVRIWK 139
            T  +WK
Sbjct: 341 RTAMLWK 347

>Kwal_47.17567
          Length = 590

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 92/233 (39%), Gaps = 56/233 (24%)

Query: 19  ENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVKHVVWHSVLS 78
           +NE  S+SW  +G +LA    +  V I++     E+ +CI  +  H   V  + W++   
Sbjct: 326 DNEYTSLSWVGAGSHLAVGQTNGLVNIFDV----EKKKCIRTIPGHIDRVACLSWNN--H 379

Query: 79  LLASSSYDDTIRIWKDFDDDWQCAAVLNGHE----GTVWCSDFEKSESSLRLCSGSDDTT 134
           +L S S D  I + +D          +  H     G  W  +  K      L SG +D  
Sbjct: 380 ILTSGSRDRRI-LHRDVRTPQSSFEEIRTHNQEVCGLKWNVEDNK------LASGGNDNA 432

Query: 135 VRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSP--TGLIASTG--SDGLLAIYQE 190
           V    ++ D         L+      H+ AV +++WSP   G++A+ G  +D  L I+  
Sbjct: 433 V----FVYDGTSRLPFLKLEE-----HTAAVKAMAWSPHRRGILATGGGTADKRLKIWNV 483

Query: 191 KEEGKW-------------------EIIAQHELAHGVYETNVVKWTQIDGETL 224
           K   K                    EII     +HG  + N+  W   DG TL
Sbjct: 484 KTSVKLHDVDTASQVCNMIWSKNTNEIIT----SHGYSKYNLTLW---DGNTL 529

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 52  GEEFECISVLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFD 96
           G   E +++L+ HS  V H+   +  + + S + D+T+R WK F+
Sbjct: 526 GNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGAGDETLRYWKLFE 570

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL--QEHSQDVKHV 71
           + EGH +E+ +V+ S  G Y+ +  RD+ + +W      E    + ++  ++   +V  +
Sbjct: 227 VTEGHYDEILTVAASPDGKYVVSGGRDRKLIVWST----ESLAPVKIIPTKDRRGEVLGL 282

Query: 72  VWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC--SG 129
            +      L ++  D  IR +    + +    +L GH+  V     + S  ++  C   G
Sbjct: 283 AFKKNSDQLFAACADYKIRTYA--INQFSQLEILYGHQDLV----IDISALNMERCVTVG 336

Query: 130 SDDTTVRIWK 139
           S D T  +WK
Sbjct: 337 SRDRTAMLWK 346

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 21/89 (23%)

Query: 29  HSGYYLATCSRDKSVWIWEADEYGEE---------------FECIS-VLQEHSQDVKHVV 72
           +  Y +AT   D ++ IW+     +                  CI+ +   H   ++ V 
Sbjct: 231 YRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVT 290

Query: 73  W---HSVLSLLASSSYDDTIRIWKDFDDD 98
           W   HS  ++L S+SYD T RIW+D  +D
Sbjct: 291 WSPHHS--NILMSASYDMTCRIWRDLSND 317

>Scas_701.22
          Length = 550

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 43/107 (40%), Gaps = 7/107 (6%)

Query: 2   WWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVL 61
            W+  M   L+ ++      + S++   SGY + T   DKS+ IW+   + +E   I  L
Sbjct: 258 LWSPSMPDPLVRLLSAR-GPINSIAIDRSGYNMVTVGADKSMKIWDIRNF-KELHTIENL 315

Query: 62  QEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGH 108
                +V   +  + L  +    +   + +WKD      C   + G 
Sbjct: 316 PTPGTNV--TISDTGLLAMTRGPH---VTLWKDAFKSRPCFGSMGGQ 357

>Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement
          Length = 809

 Score = 33.1 bits (74), Expect = 0.21,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 14  IVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWE 47
           I  GH+ +++++S   SG +LAT S D +V IWE
Sbjct: 439 IYAGHKGKIRTLSIDPSGLWLATGSDDGTVRIWE 472

 Score = 32.7 bits (73), Expect = 0.27,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 100 QCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSV-LP 158
           + + +  GH+G +         S L L +GSDD TVRIW+ +   E    V+ +  + + 
Sbjct: 435 RSSTIYAGHKGKI--RTLSIDPSGLWLATGSDDGTVRIWEILTGRE----VYKVTIIDID 488

Query: 159 SAHSRAVYSVSWSP---TGLIASTGSDGLLAI 187
                 + +V W+P   TG++A    + +  I
Sbjct: 489 DNQEDHIETVEWNPDKTTGILAVAAGENIYLI 520

 Score = 28.5 bits (62), Expect = 6.4,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 43/101 (42%), Gaps = 9/101 (8%)

Query: 1   MWWNSEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFEC--- 57
           +W + ++ +     +  HE  V+SV +        + + D ++ ++ A  Y +  +    
Sbjct: 707 LWHDLDLSSTPYKTLRYHEKAVRSVDFHKKLPLFCSAADDGTIHVFHATVYDDMMKNPML 766

Query: 58  --ISVLQEH----SQDVKHVVWHSVLSLLASSSYDDTIRIW 92
             +  L  H    S  V   +WH   + L S+  D+T R+W
Sbjct: 767 VPLKKLTGHKVINSLGVLDTIWHPREAWLFSAGADNTARLW 807

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,153,514
Number of extensions: 399324
Number of successful extensions: 3070
Number of sequences better than 10.0: 395
Number of HSP's gapped: 2224
Number of HSP's successfully gapped: 906
Length of query: 240
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 141
Effective length of database: 13,168,927
Effective search space: 1856818707
Effective search space used: 1856818707
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 60 (27.7 bits)