Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1701.233433416040.0
Kwal_26.86973323297971e-105
ACR115W3483317377e-96
Scas_700.373693556572e-83
YPL138C (SPP1)3533526431e-81
CAGL0M02585g3603536413e-81
KLLA0D07260g3423376262e-79
KLLA0C16203g145428993e-04
YNL097C (PHO23)33064965e-04
CAGL0H02035g27457956e-04
Scas_666.2*31865958e-04
AFL127C152131900.004
Kwal_56.24206150246900.005
YHR090C (YNG2)28253870.006
KLLA0A06974g29557870.007
Sklu_2376.227171850.011
YMR176W (ECM5)141128840.026
Kwal_55.2172419338750.15
Scas_720.39145529740.40
KLLA0E18898g44656720.49
YOR064C (YNG1)21946700.62
Kwal_27.1110738855710.65
Scas_549.520144690.93
YKL005C (BYE1)59446701.0
CAGL0L03091g78238701.2
Sklu_2439.848128672.1
Scas_629.2360216653.6
ADR261C53351654.4
YPR031W74829654.5
KLLA0F27643g47832644.8
YJR119C72844645.6
KLLA0F16533g22346635.6
Kwal_47.1815546537636.9
Scas_717.1274259637.1
Sklu_2214.464450637.3
YKR029C (SET3)75150637.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1701.2
         (334 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement        622   0.0  
Kwal_26.8697                                                          311   e-105
ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH] complement(...   288   7e-96
Scas_700.37                                                           257   2e-83
YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component...   252   1e-81
CAGL0M02585g complement(297048..298130) similar to tr|Q03012 Sac...   251   3e-81
KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyce...   245   2e-79
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    43   3e-04
YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein ...    42   5e-04
CAGL0H02035g 182137..182961 similar to sp|P38806 Saccharomyces c...    41   6e-04
Scas_666.2*                                                            41   8e-04
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    39   0.004
Kwal_56.24206                                                          39   0.005
YHR090C (YNG2) [2380] chr8 complement(283778..284626) Component ...    38   0.006
KLLA0A06974g complement(630572..631459) similar to sp|P38806 Sac...    38   0.007
Sklu_2376.2 YHR090C, Contig c2376 1317-2132 reverse complement         37   0.011
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    37   0.026
Kwal_55.21724                                                          33   0.15 
Scas_720.39                                                            33   0.40 
KLLA0E18898g 1670923..1672263 weakly similar to sgd|S0006102 Sac...    32   0.49 
YOR064C (YNG1) [4872] chr15 complement(446080..446739) Component...    32   0.62 
Kwal_27.11107                                                          32   0.65 
Scas_549.5                                                             31   0.93 
YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein w...    32   1.0  
CAGL0L03091g complement(354241..356589) similar to sp|P36124 Sac...    32   1.2  
Sklu_2439.8 YMR068W, Contig c2439 8208-9653 reverse complement         30   2.1  
Scas_629.23                                                            30   3.6  
ADR261C [2002] [Homologous to NOHBY] (1153772..1155373) [1602 bp...    30   4.4  
YPR031W (YPR031W) [5465] chr16 (631510..633756) Protein of unkno...    30   4.5  
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...    29   4.8  
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...    29   5.6  
KLLA0F16533g complement(1525315..1525986) weakly similar to sgd|...    29   5.6  
Kwal_47.18155                                                          29   6.9  
Scas_717.12                                                            29   7.1  
Sklu_2214.4 YMR075W, Contig c2214 8469-10403 reverse complement        29   7.3  
YKR029C (SET3) [3284] chr11 complement(497220..499475) Component...    29   7.4  

>Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement
          Length = 334

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/334 (90%), Positives = 302/334 (90%)

Query: 1   MDTLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKE 60
           MDTLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKE
Sbjct: 1   MDTLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKE 60

Query: 61  LVFSFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMC 120
           LVFSFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMC
Sbjct: 61  LVFSFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMC 120

Query: 121 TLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASIDRDPVLYNKLVANDSSL 180
           TLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASIDRDPVLYNKLVANDSSL
Sbjct: 121 TLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASIDRDPVLYNKLVANDSSL 180

Query: 181 IDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDAXXXXXXXXXXXXXX 240
           IDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDA              
Sbjct: 181 IDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDAKVKSKPKSRRKKTG 240

Query: 241 XXXXMCGYKADYQIPCSLEDFVSEYDEEATIVHGVCCKLRCSRHADWSGVLSNGFELQLQ 300
               MCGYKADYQIPCSLEDFVSEYDEEATIVHGVCCKLRCSRHADWSGVLSNGFELQLQ
Sbjct: 241 KQKSMCGYKADYQIPCSLEDFVSEYDEEATIVHGVCCKLRCSRHADWSGVLSNGFELQLQ 300

Query: 301 TLQTSIXXXXXXXXXXXXXXNMQFYERRTARVPY 334
           TLQTSI              NMQFYERRTARVPY
Sbjct: 301 TLQTSIQRLQLLVRVRQSQLNMQFYERRTARVPY 334

>Kwal_26.8697
          Length = 332

 Score =  311 bits (797), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 214/329 (65%), Gaps = 8/329 (2%)

Query: 1   MDTLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKE 60
           M  LP WCP YN+ KKD  +GE+V+CICKKPD+G+LMVGCDGCDDWFHF CL++  KF E
Sbjct: 1   MVALPEWCPAYNSLKKDPLSGEEVFCICKKPDSGELMVGCDGCDDWFHFSCLRVPQKFNE 60

Query: 61  LVFSFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMC 120
           LVFSFYCPYCQ G+TGPGS + N LPKT+W+RKCR++ CYK C+++SKYC +EH  +YM 
Sbjct: 61  LVFSFYCPYCQCGVTGPGSRSRN-LPKTLWRRKCRVLECYKPCSENSKYCSEEHALEYMR 119

Query: 121 TLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASIDRDPVLYNKLVANDSSL 180
           +L +RV  +  +   ++++ML  ++ + +   +G+  +PT S D  P     L+ +D  +
Sbjct: 120 SLLDRVESRSYDAPTVLRQMLQNTD-LASFQKMGQNDVPTPSEDLAP----GLLDDDKRI 174

Query: 181 IDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDD--AXXXXXXXXXXXX 238
            +L+ Q++ ++ + KP+VE Q   L  Y+ W K VN +LF S++   A            
Sbjct: 175 RELSSQINDVHKQAKPEVEAQFQKLANYVAWNKSVNAQLFGSQNSELASKASRAQKRKKK 234

Query: 239 XXXXXXMCGYKADYQIPCSLEDFVSEYDEEATIVHGVCCKLRCSRHADWSGVLSNGFELQ 298
                 +CGY A+++I CS E+FVS+Y+E+   +H VCCKLRC+RH DW+G+  N  + Q
Sbjct: 235 SVKPKAICGYHANFEITCSPEEFVSQYNEDIPELHSVCCKLRCARHLDWAGIQENALQFQ 294

Query: 299 LQTLQTSIXXXXXXXXXXXXXXNMQFYER 327
           L+TL++S+               +QFY++
Sbjct: 295 LETLESSLERLTLLLKIRQDQLKVQFYKK 323

>ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH]
           complement(554695..555741) [1047 bp, 348 aa]
          Length = 348

 Score =  288 bits (737), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 135/331 (40%), Positives = 192/331 (58%), Gaps = 12/331 (3%)

Query: 3   TLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELV 62
           +LP WCPP+   K+D  TGEDVYCICKKPD G+LMV CDGC DWFHF C++I   +K LV
Sbjct: 23  SLPDWCPPFQGTKQDPSTGEDVYCICKKPDGGELMVQCDGCGDWFHFTCIRIPSAYKSLV 82

Query: 63  FSFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMCTL 122
           FSFYCPYCQAGIT  G+     LP+T+WKR+CR+ GCY+ CA+DSKYC  EHG+ YM  L
Sbjct: 83  FSFYCPYCQAGITYSGT---GALPRTVWKRRCRMEGCYRACARDSKYCGPEHGEAYMRAL 139

Query: 123 WERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASIDRDPVLYNKLVANDSSLID 182
            ER          +V++M+   +      ++G G +P A  D DP LY+++V  D+ L +
Sbjct: 140 VERA---GPGGQAVVQQMVRTGQ----FESLGTGALPLARRDVDPALYDRVVGADARLGE 192

Query: 183 LNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDAXXXXXXXXXXXXXXXX 242
           L  +  ++    +  +  Q+ AL+ YL W++EVN  LF   D                  
Sbjct: 193 LEAEAREVREARRSALCAQLAALSAYLAWVREVNDALF--HDTEEAAPRRGKARARRKPK 250

Query: 243 XXMCGYKADYQIPCSLEDFVSEYDEEATIVHGVCCKLRCSRHADWSGVLSNGFELQLQTL 302
             +CG++ADYQ P    DF + Y ++A ++HGVCC+LRC RH DW+ +     + +L+ L
Sbjct: 251 RALCGFRADYQAPLPAADFAASYADDAALLHGVCCRLRCPRHQDWASMRLGSVQFELEAL 310

Query: 303 QTSIXXXXXXXXXXXXXXNMQFYERRTARVP 333
            ++               +++F+E R    P
Sbjct: 311 DSAEQRLQLLISMRKEHLSLRFHELRAGAHP 341

>Scas_700.37
          Length = 369

 Score =  257 bits (657), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 201/355 (56%), Gaps = 30/355 (8%)

Query: 3   TLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELV 62
           +LPAWCPPY+ +KKD +T E VYCICK+PD+G+LMVGCDGCDDWFHF CLKI   +++LV
Sbjct: 6   SLPAWCPPYSKQKKDPETNEAVYCICKRPDHGELMVGCDGCDDWFHFSCLKIPTVYQKLV 65

Query: 63  FSFYCPYCQAGITGP--GSITPNRLP--KTIWKRKCRLVGCYKECAKDSKYCCKEHGKKY 118
           FSF+CPYCQAGITGP   ++  +++P  KT+WKRKCRL  CY    + SKYC KEHG ++
Sbjct: 66  FSFFCPYCQAGITGPKANALGDDQIPYPKTLWKRKCRLPDCYLPVMEKSKYCSKEHGVEF 125

Query: 119 MCTLWERVRCKD--------KNPSHIVKKMLSASES--VEALTNIGKGPIPTASIDRD-- 166
           M  + +++   D         +    V+ M+  SE+  VEA  N+G        + ++  
Sbjct: 126 MKGIMDKLDVSDVGKTLRSEDDKESFVRDMIKRSENDQVEAFINLGASDFIDKEVPKELN 185

Query: 167 PVLYNKLVANDSSLIDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDA 226
           P LY K++ ND  +IDL R  + +     P++++ I  L +Y  W  ++N +L  S +D 
Sbjct: 186 PELYQKIITNDDRMIDLQRNQETVEGITIPEIKKNITLLEKYASWANDINIKLNKSVEDE 245

Query: 227 XXXXXX----------XXXXXXXXXXXXMCGYKADYQ-IPCSLEDFVSEYDE-EATIVH- 273
                                       +CGY   ++ IPCS+EDF+SEYD  + TI H 
Sbjct: 246 GDAMSSPTKKSTKGKKKKPHNKNKPKRSICGYIKSFETIPCSVEDFISEYDSNDPTITHI 305

Query: 274 -GVCCKLRCSRHADWSGVLSNGFELQLQTLQTSIXXXXXXXXXXXXXXNMQFYER 327
            GVC   +C RHA W  +  + +  QL++ Q+ +              ++Q+YE+
Sbjct: 306 QGVCLNSKCQRHAGWVSMRMDQYVQQLESSQSYLERIKLLMHSRRNQLHIQYYEQ 360

>YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component of
           SET1 and COMPASS complex, may be involved in chromatin
           remodeling [1062 bp, 353 aa]
          Length = 353

 Score =  252 bits (643), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 194/352 (55%), Gaps = 25/352 (7%)

Query: 3   TLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELV 62
           +LP WCPP++T K++  TGEDVYCICK+PD G+LMVGCDGCDDWFHF CL I  +FK+LV
Sbjct: 2   SLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLV 61

Query: 63  FSFYCPYCQAGITGPGSIT----PNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKY 118
           FSFYCPYCQAGITG            LPKT+WKRKCR+  CYK C +DSKYC +EHG+++
Sbjct: 62  FSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREF 121

Query: 119 MCTLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASI----DRDPVLYNKLV 174
           +  +W R++  +     +VKKM+  +  ++     G+      +I    D +  +++++V
Sbjct: 122 VNDIWSRLKTDEDRA--VVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIV 179

Query: 175 ANDSSLIDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDAXXXXX--- 231
             D +L  L   L ++     P  ++++  L  YL WL  V   +   +DDA        
Sbjct: 180 VRDMTLKTLEDDLQEVQEISLPLFKKKLELLEVYLGWLDNVYTEMRKLDDDAASHVECGK 239

Query: 232 ---------XXXXXXXXXXXXXMCGYKADYQ-IPCSLEDFVSEY--DEEATIVHGVCCKL 279
                                 +CGY + Y+ IPCS+E+FV ++  +EEAT +H VC K 
Sbjct: 240 EDSKGTKRKKKKNSSRSRARKNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKW 299

Query: 280 RCSRHADWSGVLSNGFELQLQTLQTSIXXXXXXXXXXXXXXNMQFYERRTAR 331
           +C+RH DW       +  Q+ +L++                N+Q+YE    R
Sbjct: 300 KCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEEILRR 351

>CAGL0M02585g complement(297048..298130) similar to tr|Q03012
           Saccharomyces cerevisiae YPL138c, hypothetical start
          Length = 360

 Score =  251 bits (641), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 197/353 (55%), Gaps = 30/353 (8%)

Query: 4   LPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELVF 63
           LP WCPPY+T K D +TGEDVYCICKKPD G+LMVGCDGCDDWFHFEC+KI   ++ LV 
Sbjct: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64

Query: 64  SFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKYMCTLW 123
           SF CPYC+ GITGPGS      PK++WK+KCRL  CY+ C   SKYC KEHGK+YM  L 
Sbjct: 65  SFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYMSRLL 124

Query: 124 ERVRCK--------DKNPSHIVKKMLSASE-SVEALTNIGKGPIPTASI---DRDPVLYN 171
            +V+ K        +++   ++K +  A++ +VE     G      + I   DR   +Y+
Sbjct: 125 NKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGSSSFIDSDIDRVDRHGEIYD 184

Query: 172 KLVANDSSLIDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASED------- 224
           K++ +D    DL  + D I   +   +++++  L++YL+W+  VN +L   ED       
Sbjct: 185 KIINDDKYYKDLLTEKDNITNNQIEGLKKKVEELDKYLDWISSVN-KLINGEDNTIEQEE 243

Query: 225 ---DAXXXXXXXXXXXXXXXXXXMCGYKADY-QIPCSLEDFVSEYDEEATI------VHG 274
              D                   +CGY  +  +IPC+ E+F ++Y E  T       + G
Sbjct: 244 NVNDTIKTKKKKKKSQKRRSKKAICGYSLNLAKIPCNPEEFYNKYSEITTSTPDCNEIEG 303

Query: 275 VCCKLRCSRHADWSGVLSNGFELQLQTLQTSIXXXXXXXXXXXXXXNMQFYER 327
           +C KLRC++H+DWS + S+ +  Q+ +L+T +              N+ ++E 
Sbjct: 304 ICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFEH 356

>KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyces
           cerevisiae YPL138c, start by similarity
          Length = 342

 Score =  245 bits (626), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 190/337 (56%), Gaps = 14/337 (4%)

Query: 3   TLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELV 62
           +LP+WCP Y+++K D  TGE+VYCICKKPD G+LMVGCDGCDDWFHF CLKI  K+++LV
Sbjct: 2   SLPSWCPRYDSRKHDPKTGEEVYCICKKPDTGELMVGCDGCDDWFHFSCLKIPEKYRDLV 61

Query: 63  FSFYCPYCQAGITGPGSITPNRLPKTIWKRKCRLVGCYKECAKD--SKYCCKEHGKKYMC 120
           FSFYC YC AGITGP  I   +LPKT+WKRKCRL  CY EC  +  SKYC K+H  +Y+ 
Sbjct: 62  FSFYCSYCSAGITGPALINGGKLPKTLWKRKCRLPECYTECDANSRSKYCSKKHAVQYVQ 121

Query: 121 TLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASIDRDPVLYNKLVANDSSL 180
           ++ +++     +   +++++L+ + S+E    +G+  +P  +       Y+KL+ ND  L
Sbjct: 122 SIVDKLNLPGVDKIALLRQLLNETTSLEEFKTLGRDKLPEVTSPLSKDQYSKLLENDQHL 181

Query: 181 IDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDAXXXXXXXXXXXXXX 240
             L  + D++ + +  ++ ++   + +Y+ W+ EVN RL                     
Sbjct: 182 NKLINEHDELVSVKLSKLNEEDAVIEKYVNWIGEVNERL-----SPHFNQPTGRKKSKSA 236

Query: 241 XXXXMCGYKADYQIPCSLEDFVSEY-----DEEATI--VHGVCCKLRCSRHADWSGVLSN 293
               +CGY  ++ IP S+E+F+ +      DE + I  V GVC K +C++H DW  +  N
Sbjct: 237 SKVTICGYHNEFTIPRSVEEFLDKLLQLKEDENSNITSVDGVCVKTKCAKHQDWITLSQN 296

Query: 294 GFELQLQTLQTSIXXXXXXXXXXXXXXNMQFYERRTA 330
               Q  +L+                  + F+E+  +
Sbjct: 297 DLSEQKDSLENVKRRLDLLISVRTNQLRISFFEQEMS 333

>KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q03214
            Saccharomyces cerevisiae YMR176w ECM5 involved in cell
            wall biogenesis and architecture singleton, start by
            similarity
          Length = 1454

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 25   YCICKKPDNGDLMVGCDGCDDWFHFECL 52
            YC C++ DNG++MV C+ C +W+H  C+
Sbjct: 1278 YCFCRRGDNGNVMVQCEICSEWYHTSCI 1305

>YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein
           involved in chromatin remodeling and possibly
           transcription regulation, involved in expression of PHO5
           [993 bp, 330 aa]
          Length = 330

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 11/64 (17%)

Query: 13  TKKKDLDTGEDVYCICKKPDNGDLMVGCDGCD---DWFHFECLKIS--PKFKELVFSFYC 67
           ++ K  D GE +YC C +   G+ MVGCDG D   +WFH  C+ +   PK K     +YC
Sbjct: 270 SRPKTNDYGEPLYCYCNQVAYGE-MVGCDGADCELEWFHLPCIGLETLPKGK-----WYC 323

Query: 68  PYCQ 71
             C+
Sbjct: 324 DDCK 327

>CAGL0H02035g 182137..182961 similar to sp|P38806 Saccharomyces
           cerevisiae YHR090c YNG2, start by similarity
          Length = 274

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 7/57 (12%)

Query: 22  EDVYCICKKPDNGDLMVGCDGCD---DWFHFECLKISPKFKELVFSFYCPYCQAGIT 75
           +++YC C++   G+ MV CDG +   +WFH+EC+ ++   K    ++YCP C+  ++
Sbjct: 214 QNLYCFCQRVSFGE-MVACDGPNCKYEWFHYECVNLTEPPK---GTWYCPDCKQEMS 266

>Scas_666.2*
          Length = 318

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 12  NTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCD---DWFHFECLKIS--PKFKELVFSFY 66
           N   K  + GE +YC C +   G+ MVGCDG D   +WFH +C+ +   PK K     +Y
Sbjct: 254 NNGLKTNEYGEPLYCYCNQVAYGE-MVGCDGADCELEWFHLQCIGLETIPKGK-----WY 307

Query: 67  CPYCQ 71
           C  C+
Sbjct: 308 CDDCK 312

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..198039)
            [4566 bp, 1521 aa]
          Length = 1521

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 22   EDVYCICKKPDNGDLMVGCDGCDDWFHFECL 52
            + VYC C++ D G  MV C+ C +W+H  C+
Sbjct: 1294 QSVYCFCRQGDVGSTMVECEICREWYHVACI 1324

>Kwal_56.24206
          Length = 1502

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 7    WCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECL 52
            W P       D +  +  YC C+  D+G  MV C+ C +W+H  C+
Sbjct: 1261 WIP-------DPNKSDGHYCFCRGGDSGSRMVACEVCGEWYHMNCI 1299

>YHR090C (YNG2) [2380] chr8 complement(283778..284626) Component of
           NuA4 histone acetyltransferase complex, involved in
           transcriptional regulation and chromatin remodeling [849
           bp, 282 aa]
          Length = 282

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 11/53 (20%)

Query: 24  VYCICKKPDNGDLMVGCDGCD---DWFHFEC--LKISPKFKELVFSFYCPYCQ 71
           +YC C++   G+ MV CDG +   +WFH++C  LK  PK      ++YCP C+
Sbjct: 223 LYCFCQRVSFGE-MVACDGPNCKYEWFHYDCVNLKEPPK-----GTWYCPECK 269

>KLLA0A06974g complement(630572..631459) similar to sp|P38806
           Saccharomyces cerevisiae YHR090c YNG2 component of NuA4
           histone acetyltransferase complex, start by similarity
          Length = 295

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 11/57 (19%)

Query: 24  VYCICKKPDNGDLMVGCDGCD---DWFHFECLKIS--PKFKELVFSFYCPYCQAGIT 75
           +YC C++   G+ MV CDG +   +WFH+ C+ ++  PK +     +YCP C+  I 
Sbjct: 234 LYCFCQRVSYGE-MVACDGPNCKYEWFHYSCVNLTEPPKGQ-----WYCPECRLEIA 284

>Sklu_2376.2 YHR090C, Contig c2376 1317-2132 reverse complement
          Length = 271

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 14/71 (19%)

Query: 11  YNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCD---DWFHFEC--LKISPKFKELVFSF 65
           YN  ++D    + +YC C+    G+ MV CDG +   +WFH+ C  LK  PK      ++
Sbjct: 200 YNQGEED---DKQLYCFCQSVSYGE-MVACDGENCKYEWFHYTCVNLKEPPK-----GAW 250

Query: 66  YCPYCQAGITG 76
           YCP C+  I  
Sbjct: 251 YCPECRQEIAN 261

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in cell
            wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 25   YCICKKPDNGDLMVGCDGCDDWFHFECL 52
            YC C++ + G  MV C+ C +W+H +C+
Sbjct: 1240 YCFCRRVEEGTAMVECEICKEWYHVDCI 1267

>Kwal_55.21724
          Length = 193

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 21  GEDVYCICKKPDNGDLMVGCDGCD---DWFHFECLKIS 55
            E VYCIC++   G  M+ CD      +WFH+ C+ ++
Sbjct: 117 AEPVYCICREVSYG-AMIACDNSKCPIEWFHYGCIGLT 153

>Scas_720.39
          Length = 1455

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 24   VYCICKKPDNGDLMVGCDGCDDWFHFECL 52
            VYC C+  D G  M+ C+ C +W+H  C+
Sbjct: 1261 VYCFCRGGDIGT-MIQCELCQEWYHTACI 1288

>KLLA0E18898g 1670923..1672263 weakly similar to sgd|S0006102
          Saccharomyces cerevisiae YPL181w, start by similarity
          Length = 446

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 19 DTGEDVYCICKK---PDNGDLMVGCDGCDDWFHFECLKISPKFKELVFSFYCPYCQ 71
          D GE   CIC K   PD+  L + C+ C  W H  C+ IS   +E    ++C  C+
Sbjct: 28 DEGE-TRCICGKIEPPDDSGLYIQCEQCHVWQHGYCVGISE--EETPDKYWCEQCK 80

>YOR064C (YNG1) [4872] chr15 complement(446080..446739) Component of
           NuA3 histone acetyltransferase complex, required for
           interaction of NuA3 complex with chromatin, has
           similarity to human retinoblastoma binding protein 2
           [660 bp, 219 aa]
          Length = 219

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 19  DTGEDVYCICKKPDNGDLMVGCDGCD---DWFHFEC--LKISPKFK 59
           +  E+VYC C+    G  MV CD      +WFH+ C  LK +PK K
Sbjct: 151 NNQEEVYCFCRNVSYGP-MVACDNPACPFEWFHYGCVGLKQAPKGK 195

>Kwal_27.11107
          Length = 388

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 23 DVYCICKK---PDNGDLMVGCDGCDDWFHFECLKISPKFKELVFSFYCPYCQAGI 74
          D  CIC +   PD+  L + C+ C  W H  C+ I+         ++C  C+  +
Sbjct: 34 DTRCICSETDPPDDSGLYIQCEQCSVWQHGFCVGITEGEDSAPDKYWCEQCRPDL 88

>Scas_549.5
          Length = 201

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 15  KKDLDTGEDVYCICKKPDNGDLMVGCDGCD---DWFHFECLKIS 55
           KK  +   + YC C +   G+ M+ CD  +   +WFH++C+ ++
Sbjct: 118 KKRQEPIVERYCFCNRESYGE-MIACDNPNCPYEWFHYDCIGMT 160

>YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein with
           similarity to Drosophila transcription factor TFIIS,
           contains a PHD finger [1785 bp, 594 aa]
          Length = 594

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 33  NGDLMVGCDGCDDWFHFECLKISPKFKELVFS----FYCPYCQAGI 74
           +GD MV CDGCD W H +C+       + + S    +YC  C   +
Sbjct: 91  HGD-MVQCDGCDTWQHIKCMTDGKDTIDGLMSEDSKYYCELCDPSL 135

>CAGL0L03091g complement(354241..356589) similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, hypothetical start
          Length = 782

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 17  DLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKI 54
           D+D G  + C+C   D+    + CD C+ W H  C  I
Sbjct: 131 DIDAGI-ITCVCDFDDDDGFTIQCDHCNRWQHASCFGI 167

>Sklu_2439.8 YMR068W, Contig c2439 8208-9653 reverse complement
          Length = 481

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 247 GYKADYQIPCSLEDFVSEYDEEATIVHG 274
           G   D+  P   ++F SE D+EA +VHG
Sbjct: 393 GANEDHGEPIEQQEFTSEADQEAQLVHG 420

>Scas_629.23
          Length = 602

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 10/16 (62%), Positives = 11/16 (68%)

Query: 37  MVGCDGCDDWFHFECL 52
           MV CDGCD W H  C+
Sbjct: 85  MVQCDGCDMWQHIRCM 100

>ADR261C [2002] [Homologous to NOHBY] (1153772..1155373) [1602 bp,
           533 aa]
          Length = 533

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 15  KKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELVFSF 65
           +K +D G+DVY + + P + +++  C        F C KI P+ + L  +F
Sbjct: 240 RKCMDNGDDVYYLVRVPISYEMLASC--------FICFKIEPELR-LTLAF 281

>YPR031W (YPR031W) [5465] chr16 (631510..633756) Protein of unknown
           function, has similarity to human BR140 zinc finger
           protein [2247 bp, 748 aa]
          Length = 748

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 26  CICKKPDNGDLMVGCDGCDDWFHFECLKI 54
           C+    DN + +V CDGCD   H EC  I
Sbjct: 269 CLGTDSDNLNTIVFCDGCDIAVHQECYGI 297

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
          Saccharomyces cerevisiae YER051w singleton, start by
          similarity
          Length = 478

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 4/32 (12%)

Query: 27 ICKKPDNGD----LMVGCDGCDDWFHFECLKI 54
           CKK D+ D    + VGC+ CD W H  C+ I
Sbjct: 10 FCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPI 41

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 10  PYNTKKKDLDTGEDVYCI-CKKPDNGDLMVGCDGCDDWFHFECL 52
           P +    D +  +D  CI C+K ++    + CD CD  FH  CL
Sbjct: 222 PDSNSGSDFEEDDDDACIVCRKTNDPKRTILCDSCDKPFHIYCL 265

>KLLA0F16533g complement(1525315..1525986) weakly similar to
           sgd|S0005590 Saccharomyces cerevisiae YOR064c YNG1
           component of histone acetyltransferase complex, has,
           start by similarity
          Length = 223

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 23  DVYCICKKPDNGDLMVGCDG---CDDWFHFECLKIS--PKFKELVF 63
           + YC C+    G  MV CD      +WFH+ C+ +S  PK  E  F
Sbjct: 158 ETYCFCRDVSYGP-MVACDNESCAIEWFHYPCVGLSAAPKPNEKWF 202

>Kwal_47.18155
          Length = 465

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 1/37 (2%)

Query: 25 YCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKEL 61
          YC    PD   L V C+ CD W H  C+ I     E+
Sbjct: 8  YCSSSDPDKL-LWVQCEVCDSWVHVTCVPIKDIVNEM 43

>Scas_717.12
          Length = 742

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 13/59 (22%)

Query: 23  DVYCICKK-----------PDNGDLMVGCDGCDDWFHFECLKISPK--FKELVFSFYCP 68
           D Y IC K           P+ G L++ CD C+  +H +C+   P+   K +   + CP
Sbjct: 482 DKYLICYKCRTTKMGTWDHPEKGRLIMRCDYCNTPWHLDCIPEVPRASLKNIGLKWKCP 540

>Sklu_2214.4 YMR075W, Contig c2214 8469-10403 reverse complement
          Length = 644

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 21  GEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPK--FKELVFSFYCP 68
           GE        P++  L++ CD C+  +H +C+   P+  FK L   + CP
Sbjct: 413 GESKMGTIDHPEDERLIMKCDYCNTPWHLDCVPGVPRASFKNLGSKWKCP 462

>YKR029C (SET3) [3284] chr11 complement(497220..499475) Component of
           the Set3p complex with histone deacetylase activity that
           represses meiotic-specific sporulation gene expression,
           has similarity to E(z) Enhancer of zeste in the
           C-terminal domain, contains a PHD finger and a SET
           domain [2256 bp, 751 aa]
          Length = 751

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 5   PAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKI 54
           P W  P ++   D D G  + CIC   D+    + CD C+ W H  C  I
Sbjct: 101 PQWPVP-DSYIVDPDAGI-ITCICDLNDDDGFTIQCDHCNRWQHAICYGI 148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,606,184
Number of extensions: 427388
Number of successful extensions: 1179
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1175
Number of HSP's successfully gapped: 60
Length of query: 334
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 232
Effective length of database: 13,065,073
Effective search space: 3031096936
Effective search space used: 3031096936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)