Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1676.31011015299e-72
YDR265W (PEX10)337863152e-36
AER390W3161013091e-35
Scas_615.133301073091e-35
Kwal_55.19999152962918e-35
CAGL0M08690g328812602e-28
KLLA0E16720g305682531e-27
Kwal_14.12871518461272e-09
KLLA0F12166g15281081272e-09
Sklu_2432.91475511211e-08
CAGL0B05049g1470931131e-07
Scas_573.91502451122e-07
YLR247C1556421095e-07
YDR143C (SAN1)610951023e-06
Scas_713.45570301014e-06
AAL030C1539411007e-06
CAGL0E01441g71734991e-05
CAGL0J03586g41149962e-05
Scas_720.8946949962e-05
ACL019C57556945e-05
Kwal_56.2252251373935e-05
KLLA0E03960g70434936e-05
AAR049C44353927e-05
YOL013C (HRD1)55196928e-05
Scas_477.724449911e-04
AER074W64345902e-04
CAGL0E02299g54551902e-04
YKL034W (TUL1)75886892e-04
KLLA0C08756g42739892e-04
AFR499C25074892e-04
YLR323C (CWC24)25973892e-04
AER113W66570874e-04
Kwal_23.628545853874e-04
AGL217W41443865e-04
Sklu_2317.249329865e-04
Scas_644.651060857e-04
YCR066W (RAD18)48753858e-04
Kwal_23.413966845830.001
KLLA0C18260g22939820.001
Kwal_26.809975057820.002
CAGL0A00935g22639810.002
Kwal_56.2390058955800.003
Sklu_2102.175127790.004
Scas_625.476127790.005
YLR427W (MAG2)67058780.005
YOL054W40643780.006
Scas_719.5164758780.006
AFR275W75332780.007
Kwal_26.824738657780.007
Kwal_47.1709960568770.008
KLLA0F25674g75727770.010
Scas_625.1127457760.010
YDL074C (BRE1)70043760.011
Kwal_47.1763824839760.011
AGL191W58228760.013
YLR032W (RAD5)116984750.016
CAGL0H10274g11434730.017
Scas_665.139243750.017
Sklu_2411.239349740.018
Sklu_1785.333133740.018
ABR067C35352740.019
Scas_672.226349730.024
Kwal_47.1777197291740.026
Scas_705.4142851720.042
Sklu_2423.864743720.043
CAGL0J04796g59958720.045
KLLA0D02552g61970710.052
Kwal_27.1041930039700.070
CAGL0D00638g69343700.074
Kwal_27.1072322947700.074
CAGL0M03817g47557700.079
Scas_551.371243690.092
CAGL0L01947g75727690.11
AGR034W15928680.11
CAGL0I09988g38744680.14
Scas_674.12d132345680.14
KLLA0B02981g66343670.21
YLR148W (PEP3)91836660.30
YHL010C58550650.32
AGL289C24147650.33
CAGL0K02563g58655650.34
AAR147W158054650.35
KLLA0C05874g55349650.38
CAGL0K08052g30548640.43
ADL345C74644630.66
Scas_721.100113795630.74
Scas_709.4440048620.80
YBR062C11570610.81
YER116C (SLX8)27438620.84
Scas_718.7661338621.0
CAGL0K10384g210442611.1
YPR093C28826611.2
CAGL0I04576g14929601.3
ABR104W32849601.5
Sklu_1684.114430591.8
Kwal_23.366076844601.8
Sklu_2353.461663601.9
YOR025W (HST3)44732592.0
Kwal_23.585961936592.0
CAGL0G03553g21060592.1
Scas_718.7712828582.2
Scas_560.6*11832582.3
ADL064W64654592.4
CAGL0J03102g62036592.5
Kwal_27.1054610430572.5
Kwal_26.803066030592.6
CAGL0A03432g115150582.8
KLLA0E07007g27950582.9
KLLA0C08041g57436583.0
YOL133W (HRT1)12125573.1
YBR114W (RAD16)79044583.2
KLLA0E07139g11024563.3
KLLA0F17479g111464583.4
Scas_585.5*10927563.5
CAGL0K07766g83045583.5
AER188C217436583.7
Scas_719.6779014573.7
KLLA0F18458g14024563.9
Scas_699.3047143574.5
KLLA0F25740g51768564.9
Sklu_2412.7112791575.0
KLLA0B08679g36325565.1
AFR220W108541565.2
Kwal_55.2120627526565.8
CAGL0M06919g95668566.2
KLLA0E16698g65650566.5
Kwal_55.2205411125546.5
Scas_701.461236557.7
KLLA0B09240g80044558.0
YMR026C (PEX12)39947558.0
YER068W (MOT2)58736558.0
YOL138C134140558.8
AFR104W54316549.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1676.3
         (101 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement        208   9e-72
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...   125   2e-36
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...   123   1e-35
Scas_615.13                                                           123   1e-35
Kwal_55.19999                                                         116   8e-35
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...   104   2e-28
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...   102   1e-27
Kwal_14.1287                                                           54   2e-09
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    54   2e-09
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              51   1e-08
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    48   1e-07
Scas_573.9                                                             48   2e-07
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    47   5e-07
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    44   3e-06
Scas_713.45                                                            44   4e-06
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    43   7e-06
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    43   1e-05
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    42   2e-05
Scas_720.89                                                            42   2e-05
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    41   5e-05
Kwal_56.22522                                                          40   5e-05
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    40   6e-05
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    40   7e-05
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    40   8e-05
Scas_477.7                                                             40   1e-04
AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH] complement(...    39   2e-04
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    39   2e-04
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    39   2e-04
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    39   2e-04
AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH] (1339549.....    39   2e-04
YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein ...    39   2e-04
AER113W [2618] [Homologous to ScYLR427W - SH] complement(848584....    38   4e-04
Kwal_23.6285                                                           38   4e-04
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    38   5e-04
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            38   5e-04
Scas_644.6                                                             37   7e-04
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    37   8e-04
Kwal_23.4139                                                           37   0.001
KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces...    36   0.001
Kwal_26.8099                                                           36   0.002
CAGL0A00935g complement(97372..98052) some similarities with sp|...    36   0.002
Kwal_56.23900                                                          35   0.003
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          35   0.004
Scas_625.4                                                             35   0.005
YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing ...    35   0.005
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    35   0.006
Scas_719.51                                                            35   0.006
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    35   0.007
Kwal_26.8247                                                           35   0.007
Kwal_47.17099                                                          34   0.008
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    34   0.010
Scas_625.11                                                            34   0.010
YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin l...    34   0.011
Kwal_47.17638                                                          34   0.011
AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH] complement(...    34   0.013
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    33   0.016
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    33   0.017
Scas_665.1                                                             33   0.017
Sklu_2411.2 YMR026C, Contig c2411 3617-4798                            33   0.018
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         33   0.018
ABR067C [658] [Homologous to ScYMR026C (PEX12) - SH] (514945..51...    33   0.019
Scas_672.2                                                             33   0.024
Kwal_47.17771                                                          33   0.026
Scas_705.41                                                            32   0.042
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       32   0.043
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    32   0.045
KLLA0D02552g complement(215290..217149) similar to sgd|S0004419 ...    32   0.052
Kwal_27.10419                                                          32   0.070
CAGL0D00638g complement(80947..83028) similar to tr|Q07457 Sacch...    32   0.074
Kwal_27.10723                                                          32   0.074
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    32   0.079
Scas_551.3                                                             31   0.092
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    31   0.11 
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    31   0.11 
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    31   0.14 
Scas_674.12d                                                           31   0.14 
KLLA0B02981g complement(267798..269789) similar to sgd|S0002232 ...    30   0.21 
YLR148W (PEP3) [3557] chr12 (434642..437398) Vacuolar peripheral...    30   0.30 
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    30   0.32 
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    30   0.33 
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    30   0.34 
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    30   0.35 
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    30   0.38 
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    29   0.43 
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    29   0.66 
Scas_721.100                                                           29   0.74 
Scas_709.44                                                            28   0.80 
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    28   0.81 
YER116C (SLX8) [1547] chr5 complement(395344..396168) Subunit of...    28   0.84 
Scas_718.76                                                            28   1.0  
CAGL0K10384g complement(1010551..1016865) similar to sp|P34756 S...    28   1.1  
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    28   1.2  
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    28   1.3  
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    28   1.5  
Sklu_1684.1 YDL008W, Contig c1684 226-660                              27   1.8  
Kwal_23.3660                                                           28   1.8  
Sklu_2353.4 YER068W, Contig c2353 8340-10190                           28   1.9  
YOR025W (HST3) [4838] chr15 (378218..379561) Member of the Sir2p...    27   2.0  
Kwal_23.5859                                                           27   2.0  
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    27   2.1  
Scas_718.77                                                            27   2.2  
Scas_560.6*                                                            27   2.3  
ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH] complement(...    27   2.4  
CAGL0J03102g 294126..295988 similar to sp|P34909 Saccharomyces c...    27   2.5  
Kwal_27.10546                                                          27   2.5  
Kwal_26.8030                                                           27   2.6  
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    27   2.8  
KLLA0E07007g 641391..642230 some similarities with sp|P40072 Sac...    27   2.9  
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    27   3.0  
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    27   3.1  
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    27   3.2  
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    26   3.3  
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    27   3.4  
Scas_585.5*                                                            26   3.5  
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    27   3.5  
AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH] (986526..99...    27   3.7  
Scas_719.67                                                            27   3.7  
KLLA0F18458g complement(1697871..1698293) some similarities with...    26   3.9  
Scas_699.30                                                            27   4.5  
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    26   4.9  
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          27   5.0  
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    26   5.1  
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    26   5.2  
Kwal_55.21206                                                          26   5.8  
CAGL0M06919g complement(703702..706572) similar to sp|P53971 Sac...    26   6.2  
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...    26   6.5  
Kwal_55.22054                                                          25   6.5  
Scas_701.4                                                             26   7.7  
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    26   8.0  
YMR026C (PEX12) [3990] chr13 complement(324235..325434) Peroxiso...    26   8.0  
YER068W (MOT2) [1499] chr5 (293048..294811) Zinc finger transcri...    26   8.0  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    26   8.8  
AFR104W [3296] [Homologous to ScYKR017C - SH] complement(623416....    25   9.2  

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score =  208 bits (529), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MTKSYTKPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKD 60
           MTKSYTKPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKD
Sbjct: 1   MTKSYTKPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKD 60

Query: 61  PSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
           PSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR
Sbjct: 61  PSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score =  125 bits (315), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 53/86 (61%), Positives = 67/86 (77%)

Query: 16  TSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCI 75
           + +  I G+P +S + H++LSD  Q+PFI E+SRKCILCL  M DPSCAPCGH+FCW+C+
Sbjct: 251 SEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSCAPCGHLFCWSCL 310

Query: 76  INWCKERSECPLCRQKCLKQSILPLR 101
           ++WCKER ECPLCRQ C  Q IL LR
Sbjct: 311 MSWCKERPECPLCRQHCQPQEILVLR 336

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score =  123 bits (309), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 1/101 (0%)

Query: 1   MTKSYTKPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKD 60
           M K Y K   +     +    +G P +++ RH++LS+P   PFI+E SRKCILCL +M D
Sbjct: 217 MLKMYLKSPTENATNKNGILTNGSP-EATARHIELSNPEIFPFISEQSRKCILCLADMTD 275

Query: 61  PSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
           PSC PCGH+FCW C++ WC ER+ECPLCRQ C KQSIL LR
Sbjct: 276 PSCLPCGHMFCWACVMQWCNERNECPLCRQHCTKQSILQLR 316

>Scas_615.13
          Length = 330

 Score =  123 bits (309), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 8/107 (7%)

Query: 3   KSYTKPLDDGTVTTSNNE--------ISGVPLDSSIRHVDLSDPAQMPFINESSRKCILC 54
           KSY    + GT+T             ++ +P +S + H++LSD    PFI E +RKCILC
Sbjct: 224 KSYYSKDEKGTLTNEKQSQGDIQAGILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILC 283

Query: 55  LTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
           L  M DPSC+PCGHIFCW CI++WCKER ECPLCRQ+C  Q ILPLR
Sbjct: 284 LAYMTDPSCSPCGHIFCWECILDWCKERPECPLCRQECQIQQILPLR 330

>Kwal_55.19999
          Length = 152

 Score =  116 bits (291), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 65/96 (67%), Gaps = 3/96 (3%)

Query: 6   TKPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCAP 65
           T  L  G  T S    +G+P DS + H+ L   ++M FI   SRKCILCL  M DPSCAP
Sbjct: 60  TSSLSVGETTLST---AGLPTDSQVEHIGLEQASEMSFIPSDSRKCILCLGFMLDPSCAP 116

Query: 66  CGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
           CGH+FCW C+++WC ER ECPLCRQ C  Q++LPLR
Sbjct: 117 CGHVFCWKCLLSWCNERPECPLCRQTCHAQNVLPLR 152

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score =  104 bits (260), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%)

Query: 21  ISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCK 80
           ++ VP + +I H+ LS+  ++ FI   SR CILCL EM DPSC PCGH+FCW+CI +W K
Sbjct: 247 LTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTK 306

Query: 81  ERSECPLCRQKCLKQSILPLR 101
           E  ECPLCRQ+   Q +L LR
Sbjct: 307 ENPECPLCRQRSYPQQVLALR 327

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score =  102 bits (253), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 42/68 (61%), Positives = 51/68 (75%)

Query: 34  DLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCL 93
           DLSD   +PFI E SRKC+LCL  M DPS  PCGH+FCW+CI+ W  ER ECPLCRQ+C 
Sbjct: 238 DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRCP 297

Query: 94  KQSILPLR 101
           +Q  +P+R
Sbjct: 298 RQLTIPVR 305

>Kwal_14.1287
          Length = 1518

 Score = 53.5 bits (127), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 26/46 (56%)

Query: 46   ESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQK 91
            E    C +CL E+   S   CGH FC +CI +W K  S CPLC+ +
Sbjct: 1184 EHKFSCTICLGEIYMGSVIKCGHFFCQDCICSWLKNHSSCPLCKMQ 1229

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 53.5 bits (127), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 14/108 (12%)

Query: 8    PLDDGTVTTSNNEISGVP--------------LDSSIRHVDLSDPAQMPFINESSRKCIL 53
            PL +   TT NN I  V               L+S +R++D     +    N  +  C +
Sbjct: 1151 PLSELNATTRNNIIKKVTRGHDYDDNCKVINNLESRVRYLDTLGQLKTAIANGENISCAV 1210

Query: 54   CLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
            C +++   S   CGH FC +C+ +W K+ + CP+C+ +     +   +
Sbjct: 1211 CYSDIYTGSILKCGHFFCKDCVTHWFKKNTSCPMCKNRMSSSEVYHFK 1258

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 51   CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
            C +C  E+   S   CGH FC++CI  W KE + CPLC+       +   R
Sbjct: 1165 CAVCFNEIFVGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEVYNFR 1215

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 11/93 (11%)

Query: 9    LDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINE-----------SSRKCILCLTE 57
            LD  T+++    IS V     ++   +S  +++ +++            ++ +C +CL  
Sbjct: 1111 LDSTTLSSLRKFISNVNKKQELQRKIVSTESRVKYLHNLSTLTYEAQKNTTMECSICLQP 1170

Query: 58   MKDPSCAPCGHIFCWNCIINWCKERSECPLCRQ 90
            + + +   CGH+FC +CI +W K R  CPLC+ 
Sbjct: 1171 ITNGAMVNCGHLFCTSCIFSWLKNRKTCPLCKH 1203

>Scas_573.9
          Length = 1502

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 45   NESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
            N  S KC +CL ++   S   CGH FC  CI +W K +  CP+C+
Sbjct: 1185 NNKSFKCSICLQDISLGSMLKCGHFFCKRCITSWLKNKKNCPMCK 1229

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 51   CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKC 92
            C +CL E++  +   CGH FC +CI+ W +  S+CP+C+  C
Sbjct: 1239 CSICLGEVEIGAIIKCGHYFCKSCILTWLRAHSKCPICKGFC 1280

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 43.9 bits (102), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 43/95 (45%), Gaps = 20/95 (21%)

Query: 11  DGTVTTSNNEISGVPL--------DSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPS 62
           +GT    +NE  G PL        + SI +  + +P  +P + E  R       E  +PS
Sbjct: 194 EGTKKRKDNE--GAPLRTTADNDSNPSITNATVVEPPSIP-LTEQQRTLN---DEETNPS 247

Query: 63  CA------PCGHIFCWNCIINWCKERSECPLCRQK 91
                   PCGHIF   CI  W +  + CPLCRQK
Sbjct: 248 YKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQK 282

>Scas_713.45
          Length = 570

 Score = 43.5 bits (101), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 61  PSCAPCGHIFCWNCIINWCKERSECPLCRQ 90
           P+  PCGHIF   C+  WCK  + CPLCR 
Sbjct: 230 PTKLPCGHIFGRECLYRWCKLENTCPLCRH 259

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 43.1 bits (100), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 51   CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQK 91
            C +CL ++ D +    GH +C  CI +W + +  CPLC+ +
Sbjct: 1219 CTICLCDICDGAIIGRGHFYCQECISSWLETKQSCPLCKTQ 1259

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 58  MKDPSCAPCGHIFCWNCIINWCKERSECPLCRQK 91
           +  P   PCGHIF  +C+  W +  + CPLCR+K
Sbjct: 287 LHSPVKIPCGHIFGRSCLYEWTRLENSCPLCRKK 320

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
          Saccharomyces cerevisiae YCR066w RAD18 DNA repair
          protein, hypothetical start
          Length = 411

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 50 KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSIL 98
          +C +C   +K+P   PCGH FC  CI  +     +CPLC  + L++S+L
Sbjct: 26 RCHICKDFLKNPVLTPCGHTFCSLCIRGYLSNEPKCPLCLHE-LRESML 73

>Scas_720.89
          Length = 469

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 50 KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQSIL 98
          +C +C   +K P   PC H FC  CI  + K+ S+CPLC  + L++S+L
Sbjct: 27 RCHICKDFLKVPVLTPCSHTFCSLCIREYLKDNSKCPLCLNE-LRESML 74

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 40.8 bits (94), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 44  INESSRKCILCLTEM----------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           ++++   CI+C+ +M          +     PCGH+  + C+ +W +    CP+CR
Sbjct: 313 LDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368

>Kwal_56.22522
          Length = 513

 Score = 40.4 bits (93), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 12/73 (16%)

Query: 29  SIRHVD--LSDPAQMPFINESSRKCILCLTEMKDPS-CA---------PCGHIFCWNCII 76
           S R +D  L D ++        + CI+C+ +M  PS C          PC H     C+ 
Sbjct: 292 SNRQIDEKLPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLK 351

Query: 77  NWCKERSECPLCR 89
           +W +    CP+CR
Sbjct: 352 SWMERSQTCPICR 364

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 40.4 bits (93), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 65  PCGHIFCWNCIINWCKERSECPLCRQKCLKQSIL 98
           PCGH+F   C+  W  E + CP+CR   L +  L
Sbjct: 218 PCGHVFGRECLYKWTTEHNSCPICRAPILSEEEL 251

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
          (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 40.0 bits (92), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 50 KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC----RQKCLKQSIL 98
          +C +C   ++ P    CGH FC  CI  +  + S CPLC    RQ  L++  L
Sbjct: 31 RCHICKDMLQTPVLTQCGHTFCSLCIREYLNKESRCPLCLAELRQNMLQKEFL 83

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 40.0 bits (92), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 37/96 (38%), Gaps = 33/96 (34%)

Query: 7   KPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEM-------- 58
           K LDD  VT +  ++     D +I                    CI+C+ E+        
Sbjct: 325 KQLDDTLVTVTVEQLQNSANDDNI--------------------CIICMDELIHSPNQQT 364

Query: 59  -----KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
                K P   PCGHI   +C+ NW +    CP+CR
Sbjct: 365 WKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400

>Scas_477.7
          Length = 244

 Score = 39.7 bits (91), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 40 QMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC 88
          ++PF      KC+LC  + K P    CGH FC +C     +E + C +C
Sbjct: 16 EIPF------KCVLCKDDYKSPIVTNCGHYFCSSCFTKRVREDASCFIC 58

>AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH]
           complement(775019..776950) [1932 bp, 643 aa]
          Length = 643

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 9/45 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLCRQ 90
           C LC    KD     CGH+FC +C    CKER      +CP C +
Sbjct: 591 CSLCSKNWKDTVIKTCGHVFCADC----CKERLAARMRKCPTCNK 631

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 51  CILCLTEM------------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           CI+C+ E+            K P   PCGH+   +C+ NW +    CP+CR
Sbjct: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 38.9 bits (89), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 8/86 (9%)

Query: 4   SYTKPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSC 63
           SY KPL +  ++      +   +D +I   D+  P  +  I E+ +       +      
Sbjct: 675 SYFKPLSNEYISEHGGGTAEHTVDCAICMSDV--PIYIEEIPETHK------VDQHSYMV 726

Query: 64  APCGHIFCWNCIINWCKERSECPLCR 89
            PC H+F  +C+ NW   + +CP+CR
Sbjct: 727 TPCNHVFHTSCLENWMNYKLQCPVCR 752

>KLLA0C08756g complement(765847..767130) weakly similar to
          sp|P10862 Saccharomyces cerevisiae YCR066w RAD18 DNA
          repair protein singleton, start by similarity
          Length = 427

 Score = 38.9 bits (89), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 50 KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC 88
          +C +C   +K     PCGH FC  CI  + ++ S+CPLC
Sbjct: 31 RCHICKDFLKASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH]
           (1339549..1340301) [753 bp, 250 aa]
          Length = 250

 Score = 38.9 bits (89), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 8/74 (10%)

Query: 30  IRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           +   +  D   +PF      +C+LC    + P    CGH FC  C     +E  +C +C 
Sbjct: 143 VGQTEARDLDSIPF------RCVLCRGHYRAPVRTRCGHYFCGGCFARRVRETRQCAVCG 196

Query: 90  Q--KCLKQSILPLR 101
              + + QS   LR
Sbjct: 197 ADTQGVAQSAARLR 210

>YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein
           containing a CCCH-type zinc finger domain, which bind
           DNA or RNA, and a C3HC4 type (RING) zinc finger, which
           may mediate protein-protein interactions, has low
           similarity to uncharacterized zinc finger protein 183
           (human ZNF183) [780 bp, 259 aa]
          Length = 259

 Score = 38.9 bits (89), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 9/73 (12%)

Query: 18  NNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIIN 77
           N E +    DS    +DL    ++PF      KC LC  + K P    CGH FC +C   
Sbjct: 175 NQEWNADKEDSKAVTLDLE---KIPF------KCTLCKEDYKSPVVTNCGHYFCGSCFAK 225

Query: 78  WCKERSECPLCRQ 90
             K+ ++C +C +
Sbjct: 226 DMKKGTKCFICHK 238

>AER113W [2618] [Homologous to ScYLR427W - SH]
           complement(848584..850581) [1998 bp, 665 aa]
          Length = 665

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 18/70 (25%)

Query: 49  RKCILCLTE-MKDPSCAPCGHIFCWNCIINWCKERS-----------------ECPLCRQ 90
           + C +CL E +  P  APCGHI C  C++ +    +                 ECPLC  
Sbjct: 227 QACPICLAEEVVAPRMAPCGHILCMTCMLQFFAAETGREVARAPGAYVRRPPKECPLCGS 286

Query: 91  KCLKQSILPL 100
              K+  +P+
Sbjct: 287 IVRKERCMPV 296

>Kwal_23.6285
          Length = 458

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 50 KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC----RQKCLKQSIL 98
          +C +C   +K P   PC H FC  CI  +      CPLC    R+  LK   L
Sbjct: 36 RCHICKDFIKSPVLTPCAHTFCSLCIREYLNRELRCPLCLAELRESMLKSEFL 88

>AGL217W [4095] [Homologous to ScYOL054W - SH]
          complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 37.7 bits (86), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 4/43 (9%)

Query: 51 CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSE----CPLCR 89
          C +C   M  P    CGH +C+ CI NW    S     CP CR
Sbjct: 38 CTICHDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCR 80

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 37.7 bits (86), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 61  PSCAPCGHIFCWNCIINWCKERSECPLCR 89
           P+   CGH F   CI  W KE + CP+CR
Sbjct: 136 PTQLKCGHRFGRMCIYQWTKEHNSCPICR 164

>Scas_644.6
          Length = 510

 Score = 37.4 bits (85), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 44  INESSRKCILCLTEM-------KDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQS 96
           + +S   CI+C+ ++       K     PCGH    +C+ NW +    CP+CR     +S
Sbjct: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDES 405

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
          repair protein, required for post-replication repair
          [1464 bp, 487 aa]
          Length = 487

 Score = 37.4 bits (85), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 50 KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC----RQKCLKQSIL 98
          +C +C   +K P   PCGH FC  CI      +  CPLC    R+  L+   L
Sbjct: 27 RCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRESLLRSEFL 79

>Kwal_23.4139
          Length = 668

 Score = 36.6 bits (83), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 9/45 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLCRQ 90
           C LC    K+ +   CGH+FC  C    CKER      +CP C +
Sbjct: 616 CSLCSKNWKNTAIKNCGHVFCEEC----CKERLAARMRKCPTCNK 656

>KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces
           cerevisiae YLR323c singleton, start by similarity
          Length = 229

 Score = 36.2 bits (82), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC 88
           +C LC  E   P    C H FC +C +   K  + CP+C
Sbjct: 170 RCFLCKKEYTSPVVTKCNHYFCSSCFMKQMKVSTNCPIC 208

>Kwal_26.8099
          Length = 750

 Score = 36.2 bits (82), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 15/57 (26%)

Query: 48  SRKCILCLTEM---------------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           S  C +C++E+                D    PC HIF   C+ +W   + +CP+CR
Sbjct: 688 SVDCAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCR 744

>CAGL0A00935g complement(97372..98052) some similarities with
           sp|P53769 Saccharomyces cerevisiae YLR323c, hypothetical
           start
          Length = 226

 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC 88
           KC+LC    + P    CGH FC  C +N  K    C +C
Sbjct: 164 KCVLCKESYERPVKTNCGHYFCQKCFVNRIKIDKSCFIC 202

>Kwal_56.23900
          Length = 589

 Score = 35.4 bits (80), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 36  SDPAQ-MPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           S P Q  P  NE+S      +T    P   PC H+F   CI  W    + CP+CR
Sbjct: 196 SPPEQEQPKDNENSGDDQGKVTYKHSPVQLPCSHVFGRECIRQWTNLHNTCPICR 250

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 35.0 bits (79), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 63  CAPCGHIFCWNCIINWCKERSECPLCR 89
             PCGHIF   C+ +W   + +CP+CR
Sbjct: 719 VTPCGHIFHTQCLESWMSYKLQCPVCR 745

>Scas_625.4
          Length = 761

 Score = 35.0 bits (79), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 63  CAPCGHIFCWNCIINWCKERSECPLCR 89
             PC HIF  +C+ NW   + +CP+CR
Sbjct: 729 VTPCDHIFHTDCLENWMGYKLQCPVCR 755

>YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.6916p [2013 bp, 670 aa]
          Length = 670

 Score = 34.7 bits (78), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 17/58 (29%)

Query: 48  SRKCILCLTEMK-DPSCAPCGHIFCWNCIINWC----------------KERSECPLC 88
            + C +CL+E    P    CGHIFC +C++N+                 K+  ECPLC
Sbjct: 192 GQNCSICLSEEPVAPRMVTCGHIFCLSCLLNFFSIEETVKNKETGYSKKKKYKECPLC 249

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
          for normal resistance to NaCl and for normal mating
          efficiency of MATa cells, contains a C3HC4-type zinc
          finger [1221 bp, 406 aa]
          Length = 406

 Score = 34.7 bits (78), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 4/43 (9%)

Query: 51 CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSE----CPLCR 89
          C +C   M  P   PCGH +C+ C+  W    ++    CP CR
Sbjct: 30 CSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCR 72

>Scas_719.51
          Length = 647

 Score = 34.7 bits (78), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 17/58 (29%)

Query: 48  SRKCILCLTEMK-DPSCAPCGHIFCWNCIINWC----------------KERSECPLC 88
            + C +CL+E    P    CGHIFC +C+IN+                 K+  ECPLC
Sbjct: 174 GQNCPICLSEEPIAPRMITCGHIFCMSCLINFFSIEETIKNPETGYVKKKKYKECPLC 231

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 34.7 bits (78), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 58  MKDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           + D    PC H+F   C+ NW   + +CP+CR
Sbjct: 716 IHDYMVTPCSHLFHTGCLENWMSYKLQCPVCR 747

>Kwal_26.8247
          Length = 386

 Score = 34.7 bits (78), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 38  PAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWC-KERSECPLCRQKCL 93
           P  +P        C +C   +++P+    G++FC+ CI+ +  +    CP+   K L
Sbjct: 309 PPPLPHEKNEDGTCRICKGPIQNPAAIGTGYVFCYPCILEYLPQHEGRCPVTGAKLL 365

>Kwal_47.17099
          Length = 605

 Score = 34.3 bits (77), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 18/68 (26%)

Query: 51  CILCLT-EMKDPSCAPCGHIFCWNCI----------------INWCKERS-ECPLCRQKC 92
           C +CL+ E+  P    CGH+FC  C+                IN+ K+R  ECPLC    
Sbjct: 166 CPICLSQEIIAPRMVSCGHLFCQTCLLSFFAAGAQEQDKGAGINYKKKRYMECPLCSTII 225

Query: 93  LKQSILPL 100
            K+  +P+
Sbjct: 226 RKEKSIPV 233

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 34.3 bits (77), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 63  CAPCGHIFCWNCIINWCKERSECPLCR 89
             PC HIF   C+ NW   + +CP+CR
Sbjct: 725 ITPCSHIFHTECLENWMSYKLQCPVCR 751

>Scas_625.11
          Length = 274

 Score = 33.9 bits (76), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 44  INESSRKCILCLTEMKDP-----SCAP-CGHIFCWNCIINWCKERSECPLCRQKCLK 94
           ++ SS +C +C     D      +C P C H F + CI  W ++ S CPLCR   ++
Sbjct: 203 LSNSSDECPICRIAYSDDFETEITCLPNCSHHFHFECIKLWLQKNSLCPLCRDNVME 259

>YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin
           ligase (E3), may be required for Rad6p function in
           chromatin modification, plays a role in gene silencing
           [2103 bp, 700 aa]
          Length = 700

 Score = 33.9 bits (76), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 9/43 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLC 88
           C LC    K+ +   CGH+FC NC    CKER      +CP C
Sbjct: 648 CSLCSKNWKNMAIKTCGHVFCENC----CKERLAARMRKCPTC 686

>Kwal_47.17638
          Length = 248

 Score = 33.9 bits (76), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLC 88
           KC++C  + K P    C H FC +C +   ++ ++C +C
Sbjct: 187 KCLICKGDYKKPVVTKCQHYFCSSCFLAKARKTTKCVVC 225

>AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH]
           complement(339295..341043) [1749 bp, 582 aa]
          Length = 582

 Score = 33.9 bits (76), Expect = 0.013,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 61  PSCAPCGHIFCWNCIINWCKERSECPLC 88
           P+  PCGH+F  +CI  W +E +    C
Sbjct: 221 PTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
           DNA-dependent ATPase of the Snf2p family of DNA
           helicases, member of the RAD6 epistasis group, involved
           in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 33.5 bits (75), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 12/84 (14%)

Query: 18  NNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSCA---PCGHIFCWNC 74
           +N  S   LD+ I+ + +  P    F    S +C +C TE  D   A    CGH FC  C
Sbjct: 884 DNSFSKEELDAMIQRLKVKYPDNKSF---QSLECSICTTEPMDLDKALFTECGHSFCEKC 940

Query: 75  IINWCKERS------ECPLCRQKC 92
           +  + + ++      +CP CR + 
Sbjct: 941 LFEYIEFQNSKNLGLKCPNCRNQI 964

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
          Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 32.7 bits (73), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 66 CGHIFCWNCIINWCKERSECPLCRQKCLKQSILP 99
          CGH F + C+  W  + + CP+CR     +  LP
Sbjct: 64 CGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELP 97

>Scas_665.1
          Length = 392

 Score = 33.5 bits (75), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 4/43 (9%)

Query: 51 CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSE----CPLCR 89
          C +C   M  P    CGH +C+ C+ +W    S+    CP CR
Sbjct: 30 CTICSEYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCR 72

>Sklu_2411.2 YMR026C, Contig c2411 3617-4798
          Length = 393

 Score = 33.1 bits (74), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 46  ESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWC-KERSECPLCRQKCL 93
           ++S KC +C   + +P     G++FC+ C++N+      +CP+  ++ L
Sbjct: 324 QTSTKCEICHQIITNPCAIETGYVFCYPCVLNYLPANEGKCPVTGKRLL 372

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 33.1 bits (74), Expect = 0.018,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 61 PSCAPCGHIFCWNCIINWCKERS----ECPLCR 89
          P    CGH +C++CI NW    +     CP CR
Sbjct: 4  PVMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>ABR067C [658] [Homologous to ScYMR026C (PEX12) - SH]
           (514945..516006) [1062 bp, 353 aa]
          Length = 353

 Score = 33.1 bits (74), Expect = 0.019,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 42  PFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCL 93
           P+I   S +C +C + + +P     G+I C+ C + + ++  +CP+ +   L
Sbjct: 294 PYI---SVRCPVCRSAVSNPGVLQTGYIACYPCAVRYVEKHGKCPVMQTPLL 342

>Scas_672.2
          Length = 263

 Score = 32.7 bits (73), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCIINWC------KERSECPLCRQKC 92
           +C +C+   +    APCGH+FC +C+          ++   C LCR++ 
Sbjct: 196 RCPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEV 244

>Kwal_47.17771
          Length = 972

 Score = 33.1 bits (74), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 21  ISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSC----APCGHIFCWNCII 76
           ++G   +S+I  +    P +    N    +C +C +E  DP        CGH FC  CI+
Sbjct: 692 LNGFDFESTISQIHEKYPHEDRLRN---LECSICTSEPIDPVTQVIFTECGHAFCELCIL 748

Query: 77  NWCKERSE------CPLCRQKCLKQSILPLR 101
            + + ++E      CP CR +   + +L ++
Sbjct: 749 EYIRFQTERQQDIKCPNCRHEINPKRLLTIK 779

>Scas_705.41
          Length = 428

 Score = 32.3 bits (72), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 46 ESSRKCILCLTEMKDPSC-----APCGHIFCWNCIINW--CKERSECPLCR 89
          E    C +C  ++ D         PC H + ++CI  W    + S+CPLCR
Sbjct: 7  EGDNICPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement
          Length = 647

 Score = 32.3 bits (72), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLC 88
           C LC    K+ +   CGH+FC  C    CKER      +CP C
Sbjct: 595 CSLCSKNWKNTAIKSCGHVFCEEC----CKERLAARMRKCPTC 633

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 32.3 bits (72), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 17/58 (29%)

Query: 48  SRKCILCLTEMK-DPSCAPCGHIFCWNCIINWC----------------KERSECPLC 88
            + C +CL E+   P    CGHIFC +C+ N+                 K+  ECPLC
Sbjct: 149 GQNCPICLNEIPVAPRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLC 206

>KLLA0D02552g complement(215290..217149) similar to sgd|S0004419
           Saccharomyces cerevisiae YLR427w, start by similarity
          Length = 619

 Score = 32.0 bits (71), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 20/70 (28%)

Query: 51  CILCLTE-MKDPSCAPCGHIFCWNCIINWC-------------------KERSECPLCRQ 90
           C +CL+E +  P    CGH+FC  C++                      K+  ECPLC  
Sbjct: 176 CPICLSEDLISPRMVVCGHVFCQTCLLQLFTNDPMVGKNDESTYARMKRKDLRECPLCSS 235

Query: 91  KCLKQSILPL 100
              K S+ P+
Sbjct: 236 IIKKTSVKPV 245

>Kwal_27.10419
          Length = 300

 Score = 31.6 bits (70), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%)

Query: 61 PSCAPCGHIFCWNCIINWCKERSE----CPLCRQKCLKQ 95
          P    CGH +C++CI NW    +     CP CR    +Q
Sbjct: 4  PVMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPLKEQ 42

>CAGL0D00638g complement(80947..83028) similar to tr|Q07457
           Saccharomyces cerevisiae YDL074c BRE1, hypothetical
           start
          Length = 693

 Score = 31.6 bits (70), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 9/43 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLC 88
           C LC    K+ +   CGH+FC +C    CKER      +CP C
Sbjct: 641 CSLCSKNWKNMAIRTCGHVFCEDC----CKERLAARMRKCPTC 679

>Kwal_27.10723
          Length = 229

 Score = 31.6 bits (70), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCI---INWCKERS---ECPLCRQ 90
           KC +C    +     PCGH+FC  C+   +N  + +S    C LCR+
Sbjct: 163 KCPICFEPPEAALVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCRR 209

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 31.6 bits (70), Expect = 0.079,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 12/57 (21%)

Query: 10  DDGTVTTSNNEISGVPLDSSI------------RHVDLSDPAQMPFINESSRKCILC 54
           DD  V+TSN+E SG   D S+            R +D+S P   P I ++S K   C
Sbjct: 418 DDEVVSTSNDEDSGEDSDGSLEPVIRKRTTAKTRIIDISKPKNQPNILDTSHKMSCC 474

>Scas_551.3
          Length = 712

 Score = 31.2 bits (69), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLC 88
           C LC    K+ +   CGH+FC  C    CKER      +CP C
Sbjct: 660 CSLCSKNWKNMAIKTCGHVFCEEC----CKERLAARMRKCPTC 698

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 31.2 bits (69), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 63  CAPCGHIFCWNCIINWCKERSECPLCR 89
             PC H+F  +C+ +W   + +CP+CR
Sbjct: 725 ITPCDHMFHTSCLESWMSYKLQCPVCR 751

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 30.8 bits (68), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 66  CGHIFCWNCIINWCKERSECPLCRQKCL 93
           CGH F   C+  W    + CP+CR   L
Sbjct: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVL 138

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
          Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 30.8 bits (68), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 5/44 (11%)

Query: 51 CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSE-----CPLCR 89
          C +C   M  P    CGH +C+ C+  W    +      CP CR
Sbjct: 30 CSICHDYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>Scas_674.12d
          Length = 1323

 Score = 30.8 bits (68), Expect = 0.14,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 48   SRKCILCLTEMKDPSCA---PCGHIFCWNCIINWCKERSECPLCR 89
            S  C+ CL +++  S +    CGH+ C  CI  +  E+S  P  +
Sbjct: 1031 SATCVWCLEQLEPESTSILTSCGHLLCDACIDPFYSEQSTLPTAK 1075

>KLLA0B02981g complement(267798..269789) similar to sgd|S0002232
           Saccharomyces cerevisiae YDL074c BRE1, start by
           similarity
          Length = 663

 Score = 30.4 bits (67), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKER-----SECPLC 88
           C LC    K+ +   CGH+FC  C    CKER      +CP C
Sbjct: 611 CSLCSKNWKNTALKTCGHVFCDVC----CKERLAARMRKCPTC 649

>YLR148W (PEP3) [3557] chr12 (434642..437398) Vacuolar peripheral
           membrane protein involved in vacuolar protein sorting
           and required for vacuole biogenesis [2757 bp, 918 aa]
          Length = 918

 Score = 30.0 bits (66), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 57  EMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKC 92
           ++K     PCGH F WNCII      ++  L RQK 
Sbjct: 834 QIKKFIVFPCGHCFHWNCIIRVILNSNDYNL-RQKT 868

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 29.6 bits (65), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 6/50 (12%)

Query: 51  CILCLTEMKDPSCA----PCGHIFCWNCIINWCKERSECPLCRQKCLKQS 96
           C +CL  M   +      PC H F   C+  W  + S CP+CR   L+ S
Sbjct: 240 CPVCLERMDSETTGLVTIPCQHTFHCQCLNKW--KNSRCPVCRHSSLRLS 287

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 29.6 bits (65), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCIINWC------KERSECPLCRQ 90
           KC +C    +     PCGHI+C  C+          +   +C LCR+
Sbjct: 172 KCPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRK 218

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 29.6 bits (65), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 6/55 (10%)

Query: 51  CILCLTEMKDPSCA----PCGHIFCWNCIINWCKERSECPLCRQKCLKQSILPLR 101
           C +CL  M   +      PC H F   C+  W  + S+CP+CR    + S   LR
Sbjct: 247 CPVCLERMDSETTGLITIPCQHTFHCQCLDKW--KNSKCPVCRLSSFRLSRDTLR 299

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 29.6 bits (65), Expect = 0.35,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 51   CILCLTEMKDPSCA---PCGHIFCWNCIINWCKERSECPLCRQ--KCLKQSILP 99
            C  C+ +M+  S +   PCGH+ C  C+  + ++  E    R+  K  + + +P
Sbjct: 1285 CPFCMEQMEIESLSVLTPCGHLLCDACVEPYLEDARESEYARKGPKGTRSTFVP 1338

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 29.6 bits (65), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 10/49 (20%)

Query: 51  CILCLTEM----------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89
           CI+C+ +           K     PC H    +C+ NW      CP+CR
Sbjct: 353 CIVCMEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPTCPICR 401

>CAGL0K08052g complement(800162..801079) weakly similar to
          tr|Q06834 Saccharomyces cerevisiae YPR093c,
          hypothetical start
          Length = 305

 Score = 29.3 bits (64), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 48 SRKCILCLTEMKDPSCA----PCGHIFCWNCIINW--CKERSECPLCR 89
          S+ C +CL ++   S      PCGH +  +CI  W    E  +CP+CR
Sbjct: 3  SKVCAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCR 50

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 28.9 bits (63), Expect = 0.66,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKE---RS---ECPLC 88
           C LC+ E +D   + C H FC  CI  +      RS    CP+C
Sbjct: 493 CQLCVDEAEDAIESKCRHKFCRLCIREYIDSFVGRSADLTCPVC 536

>Scas_721.100
          Length = 1137

 Score = 28.9 bits (63), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 7   KPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTE---MKDPSC 63
           K L +     SNN  S   +D++I  +      Q+ F    + +C +C T+   +     
Sbjct: 843 KILKNTDTDVSNNAFSKEDIDNAIDRIMKKYNPQIDF---PALECSICTTDPIPLDKIVF 899

Query: 64  APCGHIFCWNCIINWCKERS------ECPLCRQKC 92
             CGH FC +CI  + + ++      +CP CR++ 
Sbjct: 900 TECGHPFCESCIEEYFEFQAGKNLELKCPNCREQI 934

>Scas_709.44
          Length = 400

 Score = 28.5 bits (62), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 47  SSRKCILCLTEMKDPSCAPCGHIFCWNCIINWC-KERSECPLCRQKCL 93
           SS  C +C   +++P     G++ C+ C I +  K    CP+  +K L
Sbjct: 331 SSETCPVCQLTVQNPCVLETGYVTCYPCAIKYITKHEGRCPVTNKKLL 378

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
          containing a C3HC4 type (RING) zinc finger, which may
          mediate protein-protein interactions, has moderate
          similarity to uncharacterized C. albicans Orf6.8878p
          [348 bp, 115 aa]
          Length = 115

 Score = 28.1 bits (61), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 10/70 (14%)

Query: 39 AQMPFINESSRK----CILCLTEMKDPS------CAPCGHIFCWNCIINWCKERSECPLC 88
          A +P IN+   K    C +C T   +           C H F   C+  W    + CPLC
Sbjct: 28 ASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLC 87

Query: 89 RQKCLKQSIL 98
          R   +   I+
Sbjct: 88 RDNVMGHRII 97

>YER116C (SLX8) [1547] chr5 complement(395344..396168) Subunit of
           Hex3p-Slx8p complex, required for cell growth in the
           absence of SGS1 or TOP3 [825 bp, 274 aa]
          Length = 274

 Score = 28.5 bits (62), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 6/38 (15%)

Query: 66  CGHIFCWNCIINW------CKERSECPLCRQKCLKQSI 97
           CGH+FC  C+         C++   C LCR K   + +
Sbjct: 221 CGHVFCCPCLFQMVNSSRTCRQFGHCALCRSKVYLKDV 258

>Scas_718.76
          Length = 613

 Score = 28.5 bits (62), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 64  APCGHIFCWNCI--INWCKERSECPLCRQKCLKQSILP 99
           A CGH FC  C   I+  K +S+ P    K LK S  P
Sbjct: 548 ASCGHTFCGRCYARIDNAKSKSKLPKKTLKQLKGSSHP 585

>CAGL0K10384g complement(1010551..1016865) similar to sp|P34756
           Saccharomyces cerevisiae YFR019w FAB1
           phosphatidylinositol 3-phosphate 5-kinase, hypothetical
           start
          Length = 2104

 Score = 28.1 bits (61), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (9%)

Query: 45  NESSRKCILCL----TEMKDPSCAPCGHIFCWNCIINWCKER 82
           +ES+R+C  C     T  +   C  CG IFC NC +    ER
Sbjct: 281 DESARECFTCGKRFNTFRRKHHCRICGQIFCKNCTLIINGER 322

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
          containing a C3HC4 type (RING) zinc finger, which may
          mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 28.1 bits (61), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 66 CGHIFCWNCIINWCKE--RSECPLCR 89
          CGH F  NCI  W K     +CP+CR
Sbjct: 23 CGHKFHLNCIREWHKYSINLKCPICR 48

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
          cerevisiae YDL008w APC11 subunit of the anaphase
          promoting complex, start by similarity
          Length = 149

 Score = 27.7 bits (60), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%)

Query: 66 CGHIFCWNCIINWCK---ERSECPLCRQK 91
          CGH F  +CI  W      +  CP+CRQK
Sbjct: 65 CGHNFHVHCISRWVDTPTSKGLCPMCRQK 93

>ABR104W [696] [Homologous to ScYPR093C - SH]
          complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 27.7 bits (60), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 9/49 (18%)

Query: 50 KCILCLTEMKDPS----CAPCGHIFCWNCIINWCKERS---ECPLCRQK 91
          +C +C   M  PS      PCGH +   CI  W    S    CP+CR +
Sbjct: 17 ECSICWESM--PSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCRTE 63

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 27.3 bits (59), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 3/30 (10%)

Query: 64 APCGHIFCWNCIINW---CKERSECPLCRQ 90
            C H F  +CI+ W      R  CP+CRQ
Sbjct: 62 GECNHNFHVHCIVQWLDTATSRGLCPMCRQ 91

>Kwal_23.3660
          Length = 768

 Score = 27.7 bits (60), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCK------ERSECPLC 88
           C LC  E ++P  + C H FC  CI  + +      E+  CP+C
Sbjct: 515 CQLCDDEAEEPIESKCHHRFCRLCIKEYTESFLENLEKLTCPVC 558

>Sklu_2353.4 YER068W, Contig c2353 8340-10190
          Length = 616

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%)

Query: 43 FINESSRK-CILCLTEM----KDPSCAPCGHI---FCWNCIINWCKERSECPLCRQKCLK 94
          F++E     C LC+  M    K+    PCG+    FC+N I    +    CP CR+K   
Sbjct: 20 FLSEDEEDFCPLCIEPMDITDKNFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDD 79

Query: 95 QSI 97
          +S+
Sbjct: 80 ESV 82

>YOR025W (HST3) [4838] chr15 (378218..379561) Member of the Sir2p
           family of putative NAD-dependent histone deacetylases
           involved in transcriptional silencing of chromatin [1344
           bp, 447 aa]
          Length = 447

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 57  EMKDPSCAPCGHIFCWNCIINWCKERSECPLC 88
           ++K  SC  C   F W+   + C  R E PLC
Sbjct: 189 DLKTLSCTKCFQTFPWSRYWSRCLRRGELPLC 220

>Kwal_23.5859
          Length = 619

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 65 PCGHI---FCWNCIINWCKERSECPLCRQKCLKQSI 97
          PCG+    FC+N I    +    CP CR+K   +S+
Sbjct: 51 PCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESV 86

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 27.3 bits (59), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 50  KCILCLTEMKDPSCAPCGHIFCWNCIINWC------KERSECPLCRQKC-LKQ-SILPLR 101
           KC +C          PCGH+FC  C+          ++   C LCR+   +KQ  +L LR
Sbjct: 145 KCPICFEPPDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQIKMLVLR 204

>Scas_718.77
          Length = 128

 Score = 26.9 bits (58), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 66  CGHIFCWNCIINW---CKERSECPLCRQ 90
           C H F  +C++ W      R  CP+CRQ
Sbjct: 74  CQHAFHVHCVVPWLATAAARGACPMCRQ 101

>Scas_560.6*
          Length = 118

 Score = 26.9 bits (58), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 15/32 (46%)

Query: 66  CGHIFCWNCIINWCKERSECPLCRQKCLKQSI 97
           C H F   CI  W  +   CPLCR   L+  +
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKL 101

>ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH]
          complement(567690..569630) [1941 bp, 646 aa]
          Length = 646

 Score = 27.3 bits (59), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 51 CILCLTEM----KDPSCAPCGHI---FCWNCIINWCKERSECPLCRQKCLKQSI 97
          C LC+  +    K+    PCG+    FC+N I    +    CP CR+K   +S+
Sbjct: 33 CPLCMEPLDITDKNFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESV 86

>CAGL0J03102g 294126..295988 similar to sp|P34909 Saccharomyces
          cerevisiae YER068w MOT2 transcriptional repressor,
          start by similarity
          Length = 620

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 65 PCGHI---FCWNCIINWCKERSECPLCRQKCLKQSI 97
          PCG+    FC+N I    +    CP CR+K   +S+
Sbjct: 51 PCGYQICQFCYNNIRQNPELNGRCPACRRKFDDESV 86

>Kwal_27.10546
          Length = 104

 Score = 26.6 bits (57), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 13/30 (43%)

Query: 66 CGHIFCWNCIINWCKERSECPLCRQKCLKQ 95
          C H F   C+  W  +   CPLCR   L  
Sbjct: 56 CNHRFDLECVAVWLSKSRTCPLCRDDVLSH 85

>Kwal_26.8030
          Length = 660

 Score = 27.3 bits (59), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 64  APCGHIFCWNCIINWCKERSECPLCRQKCL 93
           +PCGH    +C   + K   +CP C+   L
Sbjct: 404 SPCGHAIHQHCFDEYTKHSYKCPSCQVSVL 433

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
           cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 26.9 bits (58), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 50  KCILCLTEMKDPSCA---PCGHIFCWNCII---NWCKERS---ECPLCRQ 90
           +C +C  E  + S A    C H+FC  C+    N+ KE+S   +CP CR+
Sbjct: 896 ECSICTAEPIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRR 945

>KLLA0E07007g 641391..642230 some similarities with sp|P40072
           Saccharomyces cerevisiae YER116c subunit of HEX3P-SLX8P
           complex, required for cell growth in the absence of SGS1
           or TOP3 singleton, hypothetical start
          Length = 279

 Score = 26.9 bits (58), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 10/50 (20%)

Query: 58  MKDPSCA---PCGHIFCWNCI---INWCKERSE----CPLCRQKCLKQSI 97
           M+ P  A    CGH+FC  C+   +N  K        C LCR+    Q +
Sbjct: 216 MEPPEAALVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQDL 265

>KLLA0C08041g complement(705516..707240)
          gi|24741192|emb|CAD56154.1 Kluyveromyces lactis
          CCr4/NOT complex/transcription factor subunit, start by
          similarity
          Length = 574

 Score = 26.9 bits (58), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 65 PCGHI---FCWNCIINWCKERSECPLCRQKCLKQSI 97
          PCG+    FC+N I    +    CP CR+K   +S+
Sbjct: 56 PCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESV 91

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 26.6 bits (57), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 13/25 (52%)

Query: 66  CGHIFCWNCIINWCKERSECPLCRQ 90
           C H F  +CI  W K R  CPL  Q
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQ 112

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 26.9 bits (58), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSE------CPLC 88
           C LC  E ++P  + C H FC  CI  + +   E      CP+C
Sbjct: 537 CQLCNDEAEEPIESKCHHKFCRLCIKEYVESFMENNNKLTCPVC 580

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
          cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 26.2 bits (56), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 13/24 (54%)

Query: 64 APCGHIFCWNCIINWCKERSECPL 87
            C H F  +CI  W K R+ CPL
Sbjct: 75 GECNHAFHLHCITQWIKSRNVCPL 98

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
           Saccharomyces cerevisiae YLR032w RAD5 DNA helicase,
           start by similarity
          Length = 1114

 Score = 26.9 bits (58), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 48  SRKCILCLTEMKDP----SCAPCGHIFCWNCIINWCKERS------ECPLCRQKCLKQSI 97
           S +C +C TE  +P    S   C H FC  C+  + + +        CP CR    + ++
Sbjct: 855 SFECAICTTECIEPLSAVSITECLHTFCEPCLAEYIEFQQNKKLSINCPYCRMPISEANV 914

Query: 98  LPLR 101
           L L+
Sbjct: 915 LKLK 918

>Scas_585.5*
          Length = 109

 Score = 26.2 bits (56), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 13/27 (48%)

Query: 64  APCGHIFCWNCIINWCKERSECPLCRQ 90
             C H F  +CI  W K R  CPL  Q
Sbjct: 74  GTCNHAFHLHCINKWIKTRDACPLDNQ 100

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 26.9 bits (58), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWCKERSE-------CPLC 88
           C LC  E ++P  + C H FC  CI  + +   E       CP+C
Sbjct: 576 CQLCNDEAEEPIESKCHHKFCRLCIREYVESYIESSGSNLTCPVC 620

>AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH]
           (986526..993050) [6525 bp, 2174 aa]
          Length = 2174

 Score = 26.9 bits (58), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 45  NESSRKCILCL----TEMKDPSCAPCGHIFCWNCII 76
           +ES+++C  C     T  +   C  CG IFC NC  
Sbjct: 186 DESAKECFACTKTFNTFRRKHHCRICGQIFCSNCTF 221

>Scas_719.67
          Length = 790

 Score = 26.6 bits (57), Expect = 3.7,   Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 11/14 (78%)

Query: 5   YTKPLDDGTVTTSN 18
           YT P DDG VTT+N
Sbjct: 276 YTDPYDDGEVTTAN 289

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 26.2 bits (56), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 12/24 (50%)

Query: 66  CGHIFCWNCIINWCKERSECPLCR 89
           C H F   C+  W +    CP+CR
Sbjct: 92  CNHKFDLECLSIWLQNNHTCPMCR 115

>Scas_699.30
          Length = 471

 Score = 26.6 bits (57), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 3/43 (6%)

Query: 62  SCAPCGHIFCWNCIINWCKERSE---CPLCRQKCLKQSILPLR 101
           +C  C H F WN        R E   CP C +K LK+  L  R
Sbjct: 210 ACTRCFHTFPWNRFWARSLRRGELPTCPECERKDLKRLQLGKR 252

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 26.2 bits (56), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 15/68 (22%)

Query: 40  QMPFINESSRK---------CILCL----TEMKDPSCAPCGHIFCWNCIINWCKERSECP 86
           + PF   SS +         C +CL    +E+      PC H F   C+  W  +   CP
Sbjct: 195 KYPFTQSSSEQSDGLIELPMCPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW--KNGNCP 252

Query: 87  LCRQKCLK 94
           +CR   LK
Sbjct: 253 VCRYSQLK 260

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 26.6 bits (57), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 13/91 (14%)

Query: 21  ISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMKDPSC----APCGHIFCWNCII 76
            S   L  +I +V+   P +  F      +C +C +E  +P        C H FC +C++
Sbjct: 847 FSAEQLAQAITNVNEKYPDRDSF---KGLECSICTSEPIEPITQVIFTECAHAFCEHCLL 903

Query: 77  NWCKERSE------CPLCRQKCLKQSILPLR 101
            +   +++      CP CR+    + +L L+
Sbjct: 904 EYIDFQTQKKLELKCPNCRESIDPKRLLTLK 934

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
          Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 26.2 bits (56), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 13/25 (52%)

Query: 51 CILCLTEMKDPSCAPCGHIFCWNCI 75
          C +C   M  P    CGH +C+ C+
Sbjct: 30 CTICHDYMFVPVMTSCGHNYCYECL 54

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 26.2 bits (56), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 66  CGHIFCWNCIINWC----KERSE--CPLCRQKCLKQSILPL 100
           CGH FC +C++ +     K+ SE  CP CR     + +L L
Sbjct: 851 CGHPFCESCLLEYIQFQNKKGSETICPNCRAAVESRYLLKL 891

>Kwal_55.21206
          Length = 275

 Score = 26.2 bits (56), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%)

Query: 66  CGHIFCWNCIINW-CKERSECPLCRQ 90
           C H+F   CI  W C+  + CPLC++
Sbjct: 138 CNHVFHTYCIDQWICRNSACCPLCKR 163

>CAGL0M06919g complement(703702..706572) similar to sp|P53971
           Saccharomyces cerevisiae YNL023c FAP1, start by
           similarity
          Length = 956

 Score = 26.2 bits (56), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 27/68 (39%), Gaps = 12/68 (17%)

Query: 23  GVPLDSSIRHVDLSDPAQMPFINES--------SRKCILCLTEM----KDPSCAPCGHIF 70
           G  L   +  +D  D   M +  ++        S  C++C  E+    K  +C  C  ++
Sbjct: 41  GAELSEELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVY 100

Query: 71  CWNCIINW 78
            + CI  W
Sbjct: 101 DYECIREW 108

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score = 26.2 bits (56), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 45  NESSRKCILCLTEMKDPSCAPCGHIFCWNCIINW--CKERSECPLCRQKC 92
           ++SS  C++C  ++   + +PC H  C  C +      E+ +C  CR + 
Sbjct: 83  DDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEV 132

>Kwal_55.22054
          Length = 111

 Score = 25.4 bits (54), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 66  CGHIFCWNCIINWCKERSECPLCRQ 90
           C H F  +CI  W + R+ CPL  Q
Sbjct: 78  CNHAFHLHCINKWLQTRNACPLDNQ 102

>Scas_701.4
          Length = 612

 Score = 25.8 bits (55), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 65 PCGHI---FCWNCIINWCKERSECPLCRQKCLKQSI 97
          PCG+    FC+N I    +    CP CR+K   +++
Sbjct: 52 PCGYQICQFCYNNIRQNPELNGRCPACRRKYDDENV 87

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 25.8 bits (55), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 51  CILCLTEMKDPSCAPCGHIFCWNCIINWC------KERSECPLC 88
           C LC  E ++P  + C H FC  CI  +       +++  CP+C
Sbjct: 547 CQLCDDEAEEPIESKCHHRFCRLCINEYIDSFMADEKKLTCPVC 590

>YMR026C (PEX12) [3990] chr13 complement(324235..325434) Peroxisomal
           protein (peroxin) required for peroxisomal matrix
           protein import [1200 bp, 399 aa]
          Length = 399

 Score = 25.8 bits (55), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 48  SRKCILCLTEMKDPSCAPCGHIFCWNCIINW-CKERSECPLCRQKCL 93
           S  C +C   +++P     G++ C+ C I++       CP+  +K L
Sbjct: 331 SEACPVCEKTVQNPCVLETGYVACYPCAISYLVNNEGHCPVTNKKLL 377

>YER068W (MOT2) [1499] chr5 (293048..294811) Zinc finger
          transcriptional repressor, involved in G protein
          mediated pheromone signal transduction and member of
          the CCR4-Not complex [1764 bp, 587 aa]
          Length = 587

 Score = 25.8 bits (55), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 65 PCGHI---FCWNCIINWCKERSECPLCRQKCLKQSI 97
          PCG+    FC+N I    +    CP CR+K   +++
Sbjct: 51 PCGYQICQFCYNNIRQNPELNGRCPACRRKYDDENV 86

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 25.8 bits (55), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 4/40 (10%)

Query: 51   CILCLTEMKDPSCA--PCGHIFCWNCIINWC--KERSECP 86
            C+LC   +K  +    PCGH   + CI  W   +   ECP
Sbjct: 1293 CVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECP 1332

>AFR104W [3296] [Homologous to ScYKR017C - SH]
           complement(623416..625047) [1632 bp, 543 aa]
          Length = 543

 Score = 25.4 bits (54), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 9/16 (56%)

Query: 63  CAPCGHIFCWNCIINW 78
           C  C H FCW C  +W
Sbjct: 350 CGTCHHEFCWICEADW 365

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,478,874
Number of extensions: 125214
Number of successful extensions: 539
Number of sequences better than 10.0: 179
Number of HSP's gapped: 527
Number of HSP's successfully gapped: 179
Length of query: 101
Length of database: 16,596,109
Length adjustment: 72
Effective length of query: 29
Effective length of database: 14,103,613
Effective search space: 409004777
Effective search space used: 409004777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)