Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1676.265065029930.0
Kwal_55.2000061761415540.0
AER391C63260914080.0
YDR266C63964712551e-165
CAGL0M08668g65748212211e-160
Scas_615.1267458411241e-145
KLLA0E16698g65660011201e-145
Scas_699.3861247710861e-140
ACR267C46760870.022
YJR119C72891800.15
Kwal_47.1790447076770.31
Sklu_2148.347560760.38
YHR115C41676750.49
YNL116W52276750.54
Kwal_47.1771963588740.78
Scas_672.226347730.85
Scas_631.7433113702.3
CAGL0B05049g147063702.5
Scas_719.68135057684.0
AFR050W60654684.3
CAGL0L03960g60376684.5
CAGL0G10021g394148674.8
AFR212W62662674.8
AGR233W28494656.8
YLR368W (MDM30)59858667.8
KLLA0B03454g47295658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1676.2
         (650 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1676.2 YDR266C, Contig c1676 743-2695                           1157   0.0  
Kwal_55.20000                                                         603   0.0  
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   546   0.0  
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   488   e-165
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   474   e-160
Scas_615.12                                                           437   e-145
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   436   e-145
Scas_699.38                                                           422   e-140
ACR267C [1314] [Homologous to ScYNL116W - SH; ScYHR115C - SH] (8...    38   0.022
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...    35   0.15 
Kwal_47.17904                                                          34   0.31 
Sklu_2148.3 YNL116W, Contig c2148 7107-8534                            34   0.38 
YHR115C (YHR115C) [2403] chr8 complement(340111..341361) Protein...    33   0.49 
YNL116W (YNL116W) [4478] chr14 (408341..409909) Protein containi...    33   0.54 
Kwal_47.17719                                                          33   0.78 
Scas_672.2                                                             33   0.85 
Scas_631.7                                                             32   2.3  
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    32   2.5  
Scas_719.68                                                            31   4.0  
AFR050W [3242] [Homologous to NOHBY] complement(520834..522654) ...    31   4.3  
CAGL0L03960g complement(461754..463565) similar to sp|P53924 Sac...    31   4.5  
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    30   4.8  
AFR212W [3404] [Homologous to ScYMR119W (ASI1) - SH; ScYNL008C (...    30   4.8  
AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH] complement(...    30   6.8  
YLR368W (MDM30) [3749] chr12 (857539..859335) Protein essential ...    30   7.8  
KLLA0B03454g complement(314015..315433) some similarities with s...    30   8.7  

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/650 (86%), Positives = 563/650 (86%)

Query: 1   MSTKLQQKQQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLE 60
           MSTKLQQKQQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLE
Sbjct: 1   MSTKLQQKQQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLE 60

Query: 61  EDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFD 120
           EDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFD
Sbjct: 61  EDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFD 120

Query: 121 HQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLK 180
           HQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLK
Sbjct: 121 HQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLK 180

Query: 181 TSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDD 240
           TSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDD
Sbjct: 181 TSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDD 240

Query: 241 ELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDD 300
           ELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDD
Sbjct: 241 ELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDD 300

Query: 301 IDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFDTPALXXXXX 360
           IDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFDTPAL     
Sbjct: 301 IDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFDTPALRSSSA 360

Query: 361 XXXXXXXXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQ 420
                       PEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQ
Sbjct: 361 ARSANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQ 420

Query: 421 KLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFXXXXXXXXXXXX 480
           KLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINF            
Sbjct: 421 KLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFPSLAPPSSVAAA 480

Query: 481 NVIXXXXXXXXXXXXXXXXXXXXRYNFPALSKPVNSQPLFTPKKASFKSLNTNVRTAPVV 540
           NVI                    RYNFPALSKPVNSQPLFTPKKASFKSLNTNVRTAPVV
Sbjct: 481 NVIGGSWGRSSSPSSASSSKSSGRYNFPALSKPVNSQPLFTPKKASFKSLNTNVRTAPVV 540

Query: 541 KKASANNGTNYTPTYLQNKXXXXXXXXXXXXXXXEEKFPPLPKAQKKKFRAPLVNEPNIP 600
           KKASANNGTNYTPTYLQNK               EEKFPPLPKAQKKKFRAPLVNEPNIP
Sbjct: 541 KKASANNGTNYTPTYLQNKSTSSGSLSSSSASISEEKFPPLPKAQKKKFRAPLVNEPNIP 600

Query: 601 NPQQWGVSSSSLRQEQQQIGXXXXXXXXXXXXXXXXXXXXXXXLLFHIGI 650
           NPQQWGVSSSSLRQEQQQIG                       LLFHIGI
Sbjct: 601 NPQQWGVSSSSLRQEQQQIGSSNASTDSLSTSGKKRGKQKQKQLLFHIGI 650

>Kwal_55.20000
          Length = 617

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/614 (51%), Positives = 398/614 (64%), Gaps = 39/614 (6%)

Query: 1   MSTKLQQKQQRNFRRTQDSQA-PRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNL 59
           MS K +QK  R+FRRTQ +Q+ PRK    ++ S+   WKR F        NQ +   + L
Sbjct: 1   MSAKPEQK--RSFRRTQGTQSRPRKESGKNTESS---WKRTF--------NQGTEGENEL 47

Query: 60  EEDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKF 119
           +EDD  ICIICA    Y+ LS C+H TC++CTFRQRALY KK CL+CRTE++ +IF+   
Sbjct: 48  DEDD--ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADR 105

Query: 120 DHQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHL 179
           +  F DF  ++  +T+ + G++FTS+ V + TL LL Y+CPFGD    + E+FKKYN HL
Sbjct: 106 NAVFDDFDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHL 165

Query: 180 KTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSD 239
           K  HNKT+CMICA++KKAFPSEL+I+TP+QLR HQS+GDS GFKGHPMCGFC+GQRFYSD
Sbjct: 166 KNEHNKTLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSD 225

Query: 240 DELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRD 299
           DEL VHMRDRHE+CHICDQ +  +PQYFK+YDQLFEHF+  HYVC VQ+CL+SKFVVFRD
Sbjct: 226 DELNVHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRD 285

Query: 300 DIDLQAHILKEHRTILANDKGNIPV-AGRRFQSELSTFSATPARAVHERDTFDTPALXXX 358
           D+DLQAHILKEH  IL N   N+ +  GR++QS+LSTFS  P+R+   +D  D  A    
Sbjct: 286 DLDLQAHILKEHGGILRNGNNNLSMKGGRKYQSQLSTFSRPPSRSSSTQDVRDNTA---- 341

Query: 359 XXXXXXXXXXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTA 418
                          EVKR+RMEERARHYL YS  +FE FLAIN  Y+   ++A+DV +A
Sbjct: 342 ------KNNSSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSA 395

Query: 419 YQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFXXXXXXXXXX 478
           Y+ LF SP A V LL+YDFS +FPQ+S  H+DL  IY+  QKK N   NF          
Sbjct: 396 YEGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNF----PSLSAL 451

Query: 479 XXNVIXXXXXXXXXXXXXXXXXXXXRYNFPALSKPVNSQPLFTPKKASFKSLNT---NVR 535
              ++                    +YNFP+L KP + QP    KK S   +N      +
Sbjct: 452 NPTLLPGSVASGSWGRSTGSNKAARQYNFPSLKKPASPQPPIITKKPSSTKVNNVQPKAK 511

Query: 536 TAPVVKKASANNGTNYTPTYLQNKXXXXXXXXXXXXXXXEEKFPPLPKAQKKKFRAPLVN 595
             PV +K S+N  +++ PTYL  K                EKFPPLPK+Q +KFRAPLVN
Sbjct: 512 AVPVTRKPSSNE-SSFKPTYLDGK----QKSASSSPALDREKFPPLPKSQARKFRAPLVN 566

Query: 596 EPNIPNPQQWGVSS 609
           E +IPNP QWG SS
Sbjct: 567 EASIPNPSQWGKSS 580

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/609 (47%), Positives = 379/609 (62%), Gaps = 34/609 (5%)

Query: 11  RNFRRTQDSQAPRKSDT--NSSRSNG-GKWKRAFADENLSSLNQTS--SPGDNLEEDDGE 65
           RNFRRTQ  + P+ + T  +S+  NG G+W+++    +    +     SP  + EED+GE
Sbjct: 6   RNFRRTQ-GRKPQTAQTQADSADWNGSGRWRKSSGYASGGGSSAGPPHSPCGDTEEDNGE 64

Query: 66  I-CIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFA 124
           + C+ICA+  +Y+ALS C+HTTCHKC FRQRALY KK CL+CRTE+E LIFTD+   + A
Sbjct: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEHA 124

Query: 125 DFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLKTSHN 184
            F PRD     + YGI FTS    + TL LLKYNCP+GDV + D +SFK YNEHLK  H 
Sbjct: 125 RFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLKNEHK 184

Query: 185 KTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDDELYV 244
           ++IC ICA ++K FP+E+K  TPNQL+ H + GDS GF GHP+CGFC+G+RFYSDDELY+
Sbjct: 185 RSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDDELYI 244

Query: 245 HMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDDIDLQ 304
           HMR+RHE+CHICDQ+DST PQYFK+YDQLFEHF++SHY+C V++CL+SKFVVF DD+DLQ
Sbjct: 245 HMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDLDLQ 304

Query: 305 AHILKEHRTILANDKGNIPVAGRRFQSELST-FSATPARAVHERDTFDTPALXXXXXXXX 363
           AH+LKEH  I+ N       AGRR++SELS+ F+   +RAVHE  + +  AL        
Sbjct: 305 AHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALAL-----GPS 359

Query: 364 XXXXXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQKLF 423
                    PE+KR R+EERARHYLNYSQ E + F  IN DY  N +SA  V   Y +LF
Sbjct: 360 VSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLF 419

Query: 424 NSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFXXXXXXXXXXXXNVI 483
            +P AD  LL+ +F+  FP+ S K+K+L AIY+AEQ+K   Q  F             V 
Sbjct: 420 RNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPVVG 479

Query: 484 XXXXXXXXXXXXXXXXXXXXRYNFPALSKPV-NSQPLFTP---KKASFKSLNTNVRTAPV 539
                                 NFP+LS  + +S    TP   K   ++  +    ++  
Sbjct: 480 AAWGKNGGKSSSSR--------NFPSLSSALTDSYQNVTPQPKKPVPYRPTSPVASSSTQ 531

Query: 540 VKKASANNGTNYTPTYLQNKXXXXXXXXXXXXXXXEEKFPPLPKAQKKKFRAPLVNEPNI 599
           V+    N  +NYTPTYL++K                  FPPL     KKFRAP VNE  +
Sbjct: 532 VQNTKRN--SNYTPTYLKSKTKGESRAQSNAAL-----FPPLSSPDTKKFRAPPVNE--L 582

Query: 600 PNPQQWGVS 608
           P+P+QWG S
Sbjct: 583 PDPKQWGKS 591

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  488 bits (1255), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/647 (42%), Positives = 376/647 (58%), Gaps = 27/647 (4%)

Query: 11  RNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSL-NQTSSPGDNLEEDDGEICII 69
           RNFRRTQ  Q   K   ++ R N   ++R     NLS+  N T+S  D+ +E++ E+C+I
Sbjct: 13  RNFRRTQGPQNNTKP--HNDRKN---FRRKQKKNNLSAEPNLTTSSADDTDEEN-ELCVI 66

Query: 70  CANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFADFTPR 129
           CA    Y++L+ C H TCH C FRQRALY KK CLICRTENE+++FTD+ D   +D    
Sbjct: 67  CARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDISD--KY 124

Query: 130 DFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFG-DVADKDFESFKKYNEHLKTSHNKTIC 188
           +F + +E+YGI FTSE V T TL LLK+ CP   D    DF SFKKYNEHLK+ HN+ IC
Sbjct: 125 NFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHNRMIC 184

Query: 189 MICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDDELYVHMRD 248
           +ICA +K AFP EL+IFT NQLRNHQ++G+S GFKGHPMC FC+G+RFYSDDELY+HMR+
Sbjct: 185 LICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYIHMRN 244

Query: 249 RHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDDIDLQAHIL 308
           +HE+CHICD+++  +PQYFK+Y+QLF+HF++SHYVCTVQTCL++KFVVF+D+++LQAHIL
Sbjct: 245 QHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQAHIL 304

Query: 309 KEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFD--TPALXXXXXXXXXXX 366
           +EH  IL   KG      + FQSELSTF + P+R + ERD +D  + +            
Sbjct: 305 QEHGNIL---KG----KPKFFQSELSTFISAPSRVIRERDDYDLPSISSLPGSSSGSRTD 357

Query: 367 XXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQKLFNSP 426
                 PE  R+R+ ERA++YL  S+ +F  F + NEDY K  LSAE +  +Y+ LF  P
Sbjct: 358 VRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKP 417

Query: 427 SADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFXXXXXXXXXXXXNVIXXX 486
           +ADV LLI++ +  FP+NS+K+ +L AIYE  ++    Q +                   
Sbjct: 418 NADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHW 477

Query: 487 XXXXXXXXXXXXXXXXXRYNFPALSKPVNSQPLF--TPKKASFKSLNTNVRTAP-VVKKA 543
                              N P L  P  S   F  T KK + + +    RT P  V   
Sbjct: 478 GGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYR 537

Query: 544 SANNGTNYTPTYLQNKXXXXXXXXXXXXXXXEEKFPPLPKAQKKKFRAPLVNEPNIPNPQ 603
           ++ N   ++PTYL++K               +    P     K K + P +N P I +P+
Sbjct: 538 TSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIADPK 597

Query: 604 QWGVSSSSLRQEQQQIGXXXXXXXXXXXXXXXXXXXXXXXLLFHIGI 650
           QWG  SS+     Q                          LLFHIG+
Sbjct: 598 QWGKKSST-----QDTNVHDNLRELNTTSGGNKKKGKQKQLLFHIGV 639

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  474 bits (1221), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 314/482 (65%), Gaps = 39/482 (8%)

Query: 1   MSTKLQQK----QQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPG 56
           MS++ QQ     + RNFRRTQ         +N    NG K K+   + +       S   
Sbjct: 1   MSSEQQQNGSKPKNRNFRRTQTG-----GRSNGESGNGRKAKKITGNPDFLQKEIKSGKK 55

Query: 57  DNLE-----------EDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLI 105
            N+E           +DD E+CIICA    Y +LS C+HTTCH C+FRQRALY KK CLI
Sbjct: 56  SNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLI 115

Query: 106 CRTENEQLIFTDKFDHQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPF-GDV 164
           CRTEN++L FTD  D Q+++ T  DF+ + +++GI FTS+ V  ATL LLKY CP   D 
Sbjct: 116 CRTENDRLTFTDNIDAQYSEIT--DFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDN 173

Query: 165 ADKDFESFKKYNEHLKTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKG 224
                 ++KKYNEHLK++HN+ IC+ICA NK +FP E+KI+T NQL+NH SRGDS GFKG
Sbjct: 174 EQHVSTTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKG 233

Query: 225 HPMCGFCTGQRFYSDDELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVC 284
           HPMC FCTG+RFYSDDELY+HMR+ HE+CHICD+ID T PQYFK+Y+QLFEHFR SHYVC
Sbjct: 234 HPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVC 293

Query: 285 TVQTCLESKFVVFRDDIDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAV 344
           TVQ+CL+ KFVVF+DD++LQAHILKEH  IL           + FQSELSTF + P++ +
Sbjct: 294 TVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKP-------KFFQSELSTFISAPSQVI 346

Query: 345 HERDTFDTPALXXXXXXXXXXXXXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINED 404
            ERD+++                     PEV R+RM ERA+HYLN S   F+ F  +NE+
Sbjct: 347 RERDSYN-----YDMGSVGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNEN 401

Query: 405 YRKNTLSAEDVFTAYQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIY----EAEQK 460
           Y  + L+A  +   Y+KLF    AD+ LL+++ S ++P+NS K KDL  IY    + E++
Sbjct: 402 YDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKR 461

Query: 461 KN 462
           KN
Sbjct: 462 KN 463

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 578 FPPLPKAQKKKFRAPLVNEPNIPNPQQWGVSSSSLRQ--EQQQI 619
            P LP A K K   P V+EP IP+P++WG       Q  E+QQ+
Sbjct: 588 LPTLP-APKPKVYIPPVHEPVIPDPKKWGQKGEPAPQLTEEQQL 630

>Scas_615.12
          Length = 674

 Score =  437 bits (1124), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 234/584 (40%), Positives = 330/584 (56%), Gaps = 70/584 (11%)

Query: 66  ICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFAD 125
           +C+ICA+   Y +LS C+HTTCHKC+F+QR+LY KK CLICRTEN++LIFT+  +  + D
Sbjct: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130

Query: 126 FTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPF-----GDVADKDFESFKKYNEHLK 180
                + + +E+YGI FTSE V TATL LLKY C         +  +DF S+KKYNEHL+
Sbjct: 131 SNLGHY-QFNEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHLR 189

Query: 181 TSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDD 240
           + HNK +C ICA N   FPSEL ++T NQLRNHQS+G+S GFKGHP+C FC+GQRFY DD
Sbjct: 190 SKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYGDD 249

Query: 241 ELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDD 300
           ELYVHMR++HE+CHICD+ID  +PQYFK+YDQLF+HF+N HY+CTVQTCL++KF+VF+D+
Sbjct: 250 ELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFKDE 309

Query: 301 IDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFD--------- 351
           ++LQAHILKEH  ++           + FQSELSTF + P+R V +RD  +         
Sbjct: 310 LELQAHILKEHGDLIRGKP-------KLFQSELSTFMSGPSRVVRDRDAMNYDMDSRPSL 362

Query: 352 ----TPALXXXXXXXXXXXXXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRK 407
                 +                  PE++++R+EERA++YL  SQ  ++ F+  N++Y K
Sbjct: 363 FSSSPSSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCNDEYDK 422

Query: 408 NTLSAEDVFTAYQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQIN 467
             L+   +  +Y+++F +P ++V LLI + + ++P+NS K K+L AIYEA+++K   Q  
Sbjct: 423 GYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQNG 482

Query: 468 FXXXXXXXXXXXXNVIXXXXXXXXXXXXXXXXXXXXRYNFPALSKPVNSQPLFTPKKASF 527
                                                    A+++ +   P    K  SF
Sbjct: 483 LPSLSGSSASISSATRSWNNSGSV-----------------AMNRNIRDLPTLEAKSKSF 525

Query: 528 KSLNTNVRTAP--------VVKKASANNGTNYTP-----------------TYLQNKXXX 562
               T V+  P        VVKK S  +   YTP                 T + N    
Sbjct: 526 DPFATTVKKTPALRTMKKTVVKKVSP-SPIAYTPLGGSSLSSLSTVPRLPTTNVSNTVRM 584

Query: 563 XXXXXXXXXXXXEEKFPPLPKAQKKKFRAPLVNEPNIPNPQQWG 606
                       +   P LP  + K +  PL  +  IP+P+QWG
Sbjct: 585 GSSTNGKNKKLADLNLPQLPTPKPKVYIPPL-RKTTIPDPKQWG 627

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  436 bits (1120), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 249/600 (41%), Positives = 337/600 (56%), Gaps = 53/600 (8%)

Query: 26  DTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLEEDDGE-ICIICANPRKYIALSACSH 84
           D N    +  KW     +E      ++   G+  ++DD   +C+ICA     IALS C+H
Sbjct: 53  DWNPVTGSSNKWAGINGNE------KSMGTGNGTDDDDSSNVCLICAEKLHIIALSPCNH 106

Query: 85  TTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFADFTPR-DFAKTSEEYGIAFT 143
            TCHKC  RQRALY KK CL CR+E E +IFTDK    +     +      +E+ GI FT
Sbjct: 107 PTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEHLDKKAKLEFKNEKLGIRFT 166

Query: 144 SEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLKTSHNKTICMICANNKKAFPSELK 203
           S+ V    + LLKY  PFGD A+KDF SFKK NE L+  HNKTICMICA +KKAFP ELK
Sbjct: 167 SKNVMNDAMNLLKYVSPFGD-ANKDFGSFKKLNEFLRQEHNKTICMICAGHKKAFPGELK 225

Query: 204 IFTPNQLRNHQSRGD-SHGFKGHPMCGFCTGQRFYSDDELYVHMRDRHERCHICDQIDST 262
           + T  QL+ H+SRGD   GFKGHPMCGFC+G+RFYSDDELY HM+  HERCHICDQ+D +
Sbjct: 226 VMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPS 285

Query: 263 NPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDDIDLQAHILKEHRTILANDKGNI 322
            PQYFKNY+ LFEHF+++HYVCTV +CL++KFVVF D++DL+AHI+KEH  +  + +  +
Sbjct: 286 QPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAM 345

Query: 323 PV---AGRRFQSELSTFSATPARAVHERDTFDTPALXXXXXXXXXXXXXXXXXPEVKRMR 379
            +     ++F+S+++TFS  P R +  ++     A                   +VKR R
Sbjct: 346 TLIDNTSKKFRSQITTFS-NPTRIIDAQNEESNSA----------------NSRDVKRRR 388

Query: 380 MEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQKLFNSPSADVPLLIYDFSG 439
           ME+RARHYL  S+P+F++FL IN+ + KN +SA+++ + Y+ LF   + D+ LLIYD S 
Sbjct: 389 MEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQELQSKYEDLFKQHADDIQLLIYDLSE 448

Query: 440 MFPQNSAKHKDLFAIYEAEQKKNNHQINFXXXXXXXXXXXXNVIXXXXXXXXXXXXXXXX 499
           ++   S KHK L AIYE   KK  +   F            NV+                
Sbjct: 449 LYHSTSDKHKRLRAIYEGIMKKKENAGKF-KPLVADSSSSVNVVYGKWGKKSSSGVGGS- 506

Query: 500 XXXXRYNFPALSKPVNSQPLFTPKKASFKSLNTNVR---TAPVVKKASANNGT------- 549
                 N    S P  S+P+F+  KAS+ +L  N     ++PV++    +N +       
Sbjct: 507 ------NVKFTSLPAVSEPIFS-SKASYTNLRKNGSSSPSSPVIRSGLTSNSSSSTSLNY 559

Query: 550 ---NYTPTYLQNKXXXXXXXXXXXXXXXEEKFPPLPKAQKKKFRAPLVNEPNIPNPQQWG 606
              N +P                        FP L +A KKKF AP V +  IPNP  WG
Sbjct: 560 AKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKL-QATKKKFVAPPVKQTTIPNPSTWG 618

>Scas_699.38
          Length = 612

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/477 (46%), Positives = 306/477 (64%), Gaps = 55/477 (11%)

Query: 8   KQQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLEEDDGEIC 67
           K +RNFRRTQ         +N++ ++  K              Q S   + + +DD  +C
Sbjct: 5   KPRRNFRRTQGG-------SNTTTTDNKK-------------KQHSHRHEEINDDDENVC 44

Query: 68  IICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTE--NEQLIFTDKFDHQ-FA 124
           +ICANP K+ A S C+H TCHKC+FRQ AL+ KK CLICRT+  N  +IFT+K + Q + 
Sbjct: 45  VICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYE 104

Query: 125 DFTPRDFAK--TSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADK-------DFESFKKY 175
           DF    +     + +YGI FTS+ V   TL L K+ C    + DK       D++SFKK 
Sbjct: 105 DFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKL 164

Query: 176 NEHLKTSHN-KTICMICANNKKAFPSELKIFTPNQLRNHQSRG-DSHGFKGHPMCGFCTG 233
           NEHLK  HN KTICMICA++  +FPSELKI+T NQL+NH ++G ++ GFKGHPMC FC+ 
Sbjct: 165 NEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSN 224

Query: 234 QRFYSDDELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESK 293
           +RFYS DEL  HMR++HERCHICD+ID  NPQ+FKNYDQLF HF+NSHY+CT QTCL+ K
Sbjct: 225 KRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDK 284

Query: 294 FVVFRDDIDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTFDT- 352
           F+VF+DD++LQAHIL+EH  +       I    + FQSELSTF +TP+R + + + F + 
Sbjct: 285 FIVFKDDMELQAHILQEHGDL-------IRGKPKFFQSELSTFISTPSRVITDDNAFTSQ 337

Query: 353 --------PALXXXXXXXXXXXXXXXXXPEVKRMRMEERARHYLNYSQPEFEAFLAINED 404
                   P+L                  EVK++R++ERA+HYL+ S  +F+ F+ +N+ 
Sbjct: 338 HSFSDSSLPSLNSVNSTNANNSSQ-----EVKQLRLDERAKHYLDNSHEDFQTFINLNKQ 392

Query: 405 YRKNTLSAEDVFTAYQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKK 461
           Y  N L+A  +  +Y+ LF +P +DV LLI++ S ++P NS K+K+L +IY A++KK
Sbjct: 393 YAANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEKK 449

>ACR267C [1314] [Homologous to ScYNL116W - SH; ScYHR115C - SH]
           (841323..842726) [1404 bp, 467 aa]
          Length = 467

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 37  WKR---AFADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFR 93
           WKR   AF  E L+ L         LEE+D  IC+    P + I +S CSH+  ++C  R
Sbjct: 338 WKRRANAFNKEALARLRNLQKLTAGLEEEDCSICLCKIKPCQAIFISPCSHSWHYQCIRR 397

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 8/91 (8%)

Query: 43  DENLSSLNQTSSPGDNLEEDDGEICIICA---NPRKYIALSACS---HTTCHKCTFRQRA 96
           DE+   L   S+ G + EEDD + CI+C    +P++ I   +C    H  C      +R 
Sbjct: 214 DEDDFDLGPDSNSGSDFEEDDDDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPPL-ERV 272

Query: 97  LYGKKGCLICRTENEQLIFT-DKFDHQFADF 126
             G   C  C   N    FT D  D+   +F
Sbjct: 273 PSGDWICNTCIVGNGYYGFTQDTHDYSLPEF 303

>Kwal_47.17904
          Length = 470

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 37  WKRA---FADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFR 93
           WKR    F  E L  L         LEE+D  IC+    P + I +S CSH+  ++C  R
Sbjct: 359 WKRRAMRFNREALQRLRNLQKMTTGLEEEDCSICLSKIKPCQAIFISPCSHSWHYQCVRR 418

Query: 94  -QRALYGKKGCLICRT 108
                Y +  C  CR+
Sbjct: 419 LVMTTYPQFVCPNCRS 434

>Sklu_2148.3 YNL116W, Contig c2148 7107-8534
          Length = 475

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 37  WKR---AFADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFR 93
           WKR   AF  E L  L          EE+D  IC+    P + I +S CSH+  ++C  R
Sbjct: 359 WKRRANAFNKEALQRLKNLQKLTTGSEEEDCSICLSKIKPCQAIFISPCSHSWHYQCVRR 418

>YHR115C (YHR115C) [2403] chr8 complement(340111..341361) Protein
           containing a forkhead associated (FHA) domain, which
           bind phosphopeptides, and a C3HC4 type (RING) zinc
           finger, which may mediate protein-protein interactions,
           has a region of moderate similarity to S. pombe Dma1p
           [1251 bp, 416 aa]
          Length = 416

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 37  WK---RAFADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFR 93
           WK    AF  E LS +         LE++D  IC+    P + I +S C+H+    C  R
Sbjct: 297 WKLKANAFNKEALSRIKNLQKLTTGLEQEDCSICLNKIKPCQAIFISPCAHSWHFHCVRR 356

Query: 94  QRAL-YGKKGCLICRT 108
              + Y +  C  CRT
Sbjct: 357 LVIMNYPQFMCPNCRT 372

>YNL116W (YNL116W) [4478] chr14 (408341..409909) Protein containing
           a forkhead associated (FHA) domain, which bind
           phosphopeptides, and a C3HC4 type (RING) zinc finger,
           which may mediate protein-protein interactions, has a
           region of moderate similarity to S. pombe Dma1p, which
           acts in spindle checkpoint [1569 bp, 522 aa]
          Length = 522

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 37  WK---RAFADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFR 93
           WK    +F  E L  L         +EE+D  IC+    P + I +S C+H+   +C  R
Sbjct: 403 WKLKANSFNKEALQRLQNLQKLTTGIEEEDCSICLCKIKPCQAIFISPCAHSWHFRCVRR 462

Query: 94  QRAL-YGKKGCLICRT 108
              L Y +  C  CR+
Sbjct: 463 LVMLSYPQFVCPNCRS 478

>Kwal_47.17719
          Length = 635

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 4/88 (4%)

Query: 23  RKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSAC 82
           R + +  S+ N     R    E LS    +S+  D  + D    C++C +  + I L  C
Sbjct: 541 RLTRSQYSKINESGILREIMIERLSDSKTSSNATDKSDRDLA--CVVCKSNIRNIVLWPC 598

Query: 83  -SHTTCHKCTFRQRALYGKKGCLICRTE 109
                C  C     AL G K C+ CR+E
Sbjct: 599 KCFAVCEDCRV-SLALRGFKTCICCRSE 625

>Scas_672.2
          Length = 263

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%)

Query: 67  CIICANPRKYIALSACSHTTCHKCTFRQ---RALYGKKG-CLICRTE 109
           C IC +P +   ++ C H  C  C F+       Y K G C +CR E
Sbjct: 197 CPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKE 243

>Scas_631.7
          Length = 433

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 43/113 (38%), Gaps = 16/113 (14%)

Query: 157 YNCPFGDVADKDFESFKKYNEHLKTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSR 216
           Y C F +   + F ++  Y  H+K  H K  C IC         +      N L+ H S 
Sbjct: 202 YQCTFANCH-RSFRTWTLYQSHVKMDHPKLKCSIC---------DKLCVGENGLKMHMSV 251

Query: 217 GDSHGFKGHPMCGFC-----TGQRFYSDDELYVHMRDRHERCHI-CDQIDSTN 263
            D      +  C  C     T   F    EL  H RD+H    I  D ++STN
Sbjct: 252 HDEDLVIKNWKCTICAEDADTFVSFPKKSELLNHYRDKHHEKDIPIDLLNSTN 304

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 8/63 (12%)

Query: 45   NLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCL 104
            NLS+L   +     +E      C IC  P    A+  C H  C  C F    L  +K C 
Sbjct: 1148 NLSTLTYEAQKNTTME------CSICLQPITNGAMVNCGHLFCTSCIFSW--LKNRKTCP 1199

Query: 105  ICR 107
            +C+
Sbjct: 1200 LCK 1202

>Scas_719.68
          Length = 1350

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 26/57 (45%)

Query: 384 ARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQKLFNSPSADVPLLIYDFSGM 440
           A H + +S P+      +++      L A+DV    Q   N P+ D PLL   FS +
Sbjct: 266 APHQVGFSTPQLTTKQLMDKAMEVGLLDADDVILPAQSSVNFPTLDDPLLQKQFSSL 322

>AFR050W [3242] [Homologous to NOHBY] complement(520834..522654)
          [1821 bp, 606 aa]
          Length = 606

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 5/54 (9%)

Query: 42 ADENLSSLNQTSSPGD-----NLEEDDGEICIICANPRKYIALSACSHTTCHKC 90
           +E++ S  + S+P D     N EE+DG +C+ C +    +    C    C  C
Sbjct: 19 VEEDIGSGGEDSAPSDSEQAPNDEEEDGSMCVECQDMPVEVLCRDCEEQFCTVC 72

>CAGL0L03960g complement(461754..463565) similar to sp|P53924
           Saccharomyces cerevisiae YNL116w, start by similarity
          Length = 603

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 37  WK---RAFADENLSSLNQTSSPGDNLEEDDGEICIICANPRKYIALSACSHTTCHKCTFR 93
           WK    AF  E L  + +        +E+D  IC+    P + I +S C+HT   +C  R
Sbjct: 485 WKLKANAFNKEALQKMRKLQKMTTGSDEEDCSICLSKIKPCQAIFISPCAHTWHFRCVRR 544

Query: 94  QRAL-YGKKGCLICRT 108
              L Y +  C  CR+
Sbjct: 545 LVMLAYPQFVCPNCRS 560

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 50/148 (33%), Gaps = 55/148 (37%)

Query: 157 YNCPFGDVADKDFESFKKYNEHLKTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSR 216
           Y C F  V  K F+++     H+K  H K  C IC+                        
Sbjct: 181 YQCTFS-VCSKSFKTWSALRLHVKNDHPKLKCPICSKP---------------------- 217

Query: 217 GDSHGFKGHPMCGFCTGQRFYSDDELYVHMR-------DRHERCHICDQIDSTNPQYFKN 269
                         C G     +D L +HM+        R+ +CHIC      N Q F  
Sbjct: 218 --------------CVG-----EDGLNMHMKIHDENLVSRNWKCHIC------NDQSFAK 252

Query: 270 YDQLFEHFRNSHYVCTVQTCLESKFVVF 297
             +L +H+ NSH        LE K V +
Sbjct: 253 KLELLDHYSNSHSEEIPAYLLEQKVVPY 280

>AFR212W [3404] [Homologous to ScYMR119W (ASI1) - SH; ScYNL008C
           (ASI3) - NSH] complement(814346..816226) [1881 bp, 626
           aa]
          Length = 626

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 2/62 (3%)

Query: 49  LNQTSSPGDNLEEDDGEICIICANPRKYIALSAC-SHTTCHKCTFRQRALYGKKGCLICR 107
           +   +SP    +ED    C++C    + I L  C     C +C      L G K C+ CR
Sbjct: 556 METCTSPSKLQDEDADMSCVVCKTNLRNIVLWPCRCFALCEECRV-SLGLRGFKACVCCR 614

Query: 108 TE 109
            +
Sbjct: 615 AD 616

>AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH]
           complement(1185515..1186369) [855 bp, 284 aa]
          Length = 284

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 4/94 (4%)

Query: 164 VADKDFESFKKYNEHLKTSHNKTICMICANN--KKAFPSELKIFTPNQLRNHQSRGDSHG 221
           VA     + K   +HL    N  +C    +   K   P ++ ++   +L +H+       
Sbjct: 182 VAHVQISTAKAPEDHL--IQNVALCAGSGSGVFKGVSPGDVDLYYTGELSHHEILRYREA 239

Query: 222 FKGHPMCGFCTGQRFYSDDELYVHMRDRHERCHI 255
            K   +C     +R Y  D +Y H+++    CH+
Sbjct: 240 GKAVIVCNHSNTERGYLRDVMYKHIQELGVECHV 273

>YLR368W (MDM30) [3749] chr12 (857539..859335) Protein essential for
           maintaining wild-type mitochondrial morphology, contains
           an F-box domain which serves as a link between a target
           protein and a ubiquitin-conjugating enzyme [1797 bp, 598
           aa]
          Length = 598

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 384 ARHYLNYSQPEF---EAFLAINEDYRKNTLSAEDVFTAYQKLF----NSPSADVPLLI 434
           AR +L  S+P+F    AF+ +NED++      ED+ + +   F    N  S  +P L+
Sbjct: 315 ARDHLVVSEPDFPDGRAFVTVNEDFQPYIFDKEDLLSVWSNNFHNAENFESTVLPALL 372

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 32/95 (33%), Gaps = 10/95 (10%)

Query: 157 YNCPFGDVADKDFESFKKYNEHLKTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSR 216
           Y C F    D  F ++    +H+K  H K  C IC                + LRNH   
Sbjct: 251 YQCDFLSCTDV-FSTWSSLQQHIKQCHPKLPCPICGK---------PCVAESGLRNHMMI 300

Query: 217 GDSHGFKGHPMCGFCTGQRFYSDDELYVHMRDRHE 251
            D      +  C  C    F    +L  H  + H+
Sbjct: 301 HDESLVTKNWKCSSCPDTSFAKKTQLVQHYEESHK 335

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.132    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,339,037
Number of extensions: 872514
Number of successful extensions: 2653
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2658
Number of HSP's successfully gapped: 42
Length of query: 650
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 542
Effective length of database: 12,857,365
Effective search space: 6968691830
Effective search space used: 6968691830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)