Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1575.21911919201e-128
Scas_647.81971897093e-96
ACL112C1991836973e-94
YJR014W1981846931e-93
CAGL0B03927g1961926791e-91
Kwal_33.154611961806671e-89
KLLA0F21934g2001806496e-87
CAGL0J07678g10862770.016
YNL244C (SUI1)10862760.018
Scas_706.1510862760.022
CAGL0B01837g56975800.022
KLLA0C03091g10875730.052
AER457W10862710.10
ADL395C10862710.10
Sklu_2432.820262690.36
AFR642C10862650.59
Sklu_2408.726771632.1
Sklu_2251.313671603.3
YNL031C (HHT2)13671603.3
YBR010W (HHT1)13671603.3
Scas_716.5913671603.3
Scas_671.913671603.3
Scas_695.513671603.3
Kwal_27.1147813671603.3
Kwal_27.1096713671603.3
KLLA0E17677g13671603.3
CAGL0M06655g13671603.3
CAGL0H09856g13671603.3
CAGL0C04114g13671603.3
AER013W13671603.3
ADL202C13671603.3
KLLA0E08591g17671613.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1575.2
         (191 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement        358   e-128
Scas_647.8                                                            277   3e-96
ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [6...   273   3e-94
YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with sim...   271   1e-93
CAGL0B03927g 386875..387465 highly similar to sp|P47089 Saccharo...   266   1e-91
Kwal_33.15461                                                         261   1e-89
KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces...   254   6e-87
CAGL0J07678g 750008..750334 highly similar to sp|P32911 Saccharo...    34   0.016
YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (...    34   0.018
Scas_706.15                                                            34   0.022
CAGL0B01837g complement(166953..168662) similar to tr|Q04600 Sac...    35   0.022
KLLA0C03091g complement(276491..276817) highly similar to sp|P32...    33   0.052
AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH] complement(...    32   0.10 
ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..180...    32   0.10 
Sklu_2432.8 YNL244C, Contig c2432 18118-18726                          31   0.36 
AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH] (1607516..1...    30   0.59 
Sklu_2408.7 , Contig c2408 11587-12390                                 29   2.1  
Sklu_2251.3 YBR010W, Contig c2251 1534-1944                            28   3.3  
YNL031C (HHT2) [4556] chr14 complement(575638..576048) Histone H...    28   3.3  
YBR010W (HHT1) [203] chr2 (256291..256701) Histone H3, identical...    28   3.3  
Scas_716.59                                                            28   3.3  
Scas_671.9                                                             28   3.3  
Scas_695.5                                                             28   3.3  
Kwal_27.11478                                                          28   3.3  
Kwal_27.10967                                                          28   3.3  
KLLA0E17677g 1567814..1568224 gi|122091|sp|P02303|H3_YEAST Kluyv...    28   3.3  
CAGL0M06655g complement(684606..685016) highly similar to sp|P02...    28   3.3  
CAGL0H09856g 962788..963198 highly similar to sp|P02303 Saccharo...    28   3.3  
CAGL0C04114g complement(404740..405150) highly similar to sp|P02...    28   3.3  
AER013W [2518] [Homologous to ScYBR010W (HHT1) - SH] complement(...    28   3.3  
ADL202C [1539] [Homologous to ScYNL031C (HHT2) - SH] (344750..34...    28   3.3  
KLLA0E08591g complement(770773..771303) some similarities with s...    28   3.3  

>Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement
          Length = 191

 Score =  358 bits (920), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 179/191 (93%), Positives = 179/191 (93%)

Query: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSS 60
           MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSS
Sbjct: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSS 60

Query: 61  IGGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEI 120
           IGGA            QAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEI
Sbjct: 61  IGGAREEKLEKDLLRLQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEI 120

Query: 121 DMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHI 180
           DMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHI
Sbjct: 121 DMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHI 180

Query: 181 DTQKKKKKPAA 191
           DTQKKKKKPAA
Sbjct: 181 DTQKKKKKPAA 191

>Scas_647.8
          Length = 197

 Score =  277 bits (709), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 145/189 (76%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 2   LKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPAD-CEVDDVATKLGNSS 60
           L+ VVYCGVCS PPEYCEFTGKLKRCKVWLKENH DLF +LY  D  +V  VA KL  SS
Sbjct: 3   LQEVVYCGVCSYPPEYCEFTGKLKRCKVWLKENHPDLFTKLYGDDNGDVAAVAGKLAESS 62

Query: 61  IGGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEI 120
           IG              Q KQE+REQRELAKKLSSKV+IKREARTKRK +IAISGLEVFEI
Sbjct: 63  IGEEREEKLEKDLLKLQTKQENREQRELAKKLSSKVIIKREARTKRKFIIAISGLEVFEI 122

Query: 121 DMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHI 180
           DMKKLAKTFASKFATGCSVSKNAEKKEEIV+QGDV + VEAYIHSLL+EKGLK VKVE I
Sbjct: 123 DMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVLEAVEAYIHSLLKEKGLKDVKVETI 182

Query: 181 DTQKKKKKP 189
           DT+ KKKKP
Sbjct: 183 DTKMKKKKP 191

>ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [600
           bp, 199 aa]
          Length = 199

 Score =  273 bits (697), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 152/183 (83%), Gaps = 1/183 (0%)

Query: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCE-VDDVATKLGNS 59
           MLK VVYCGVCSLPPEYCEFTGK++RCKVWL E+  +LF QLY  D E VD VA +LG S
Sbjct: 1   MLKKVVYCGVCSLPPEYCEFTGKIRRCKVWLHEHDQELFAQLYGDDKEDVDGVAARLGQS 60

Query: 60  SIGGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFE 119
           SIG              QA++ES+EQRELA+KLSS+VVI+REARTKRKCM+ ++GLEVFE
Sbjct: 61  SIGEEREEQLEKKLQKLQAREESKEQRELARKLSSRVVIRREARTKRKCMVVVAGLEVFE 120

Query: 120 IDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEH 179
           IDMKKLAKTFASKFATGCSVSKN EKKEE+VVQGD+ADEVEAYIH+LLEEKG+K VKVE 
Sbjct: 121 IDMKKLAKTFASKFATGCSVSKNVEKKEEVVVQGDIADEVEAYIHALLEEKGMKGVKVEQ 180

Query: 180 IDT 182
           ID 
Sbjct: 181 IDA 183

>YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with
           similarity to human DENR/DRP density-regulated protein
           [597 bp, 198 aa]
          Length = 198

 Score =  271 bits (693), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 150/184 (81%), Gaps = 3/184 (1%)

Query: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPAD---CEVDDVATKLG 57
           ML+ V+YCG+CS PPEYCEF+GKLKRCKVWL ENHADL+ +LY  D    EV+ V  KL 
Sbjct: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60

Query: 58  NSSIGGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEV 117
            SSIG A            Q KQE+REQRELAKKLSSKV+IKREARTKRK ++AISGLEV
Sbjct: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120

Query: 118 FEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKV 177
           F+IDMKKLAKTFAS+FATGCSVSKNAEKKEE+V+QGDV DEVE YIHSLLEEKGLK VKV
Sbjct: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV 180

Query: 178 EHID 181
           E ID
Sbjct: 181 ETID 184

>CAGL0B03927g 386875..387465 highly similar to sp|P47089
           Saccharomyces cerevisiae YJR014w, start by similarity
          Length = 196

 Score =  266 bits (679), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 157/192 (81%), Gaps = 2/192 (1%)

Query: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPAD-CEVDDVATKLGNS 59
           MLK VVYCGVC+ P +YCEF+GKLKRCKVWLKENHADL+++LY  D      ++ KL  S
Sbjct: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYSEDDAAAASLSAKLAES 60

Query: 60  SIGGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFE 119
           SIG A            Q KQE++EQRELAKKLSSKV++KREARTKRK ++AISGLEVFE
Sbjct: 61  SIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFE 120

Query: 120 IDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEH 179
           IDMKKLAKTFASKFATGCSVSKNAEKKEE+VVQGDV DEV AYIHSLLEEKG+K VKVE 
Sbjct: 121 IDMKKLAKTFASKFATGCSVSKNAEKKEEVVVQGDVLDEVVAYIHSLLEEKGMKDVKVET 180

Query: 180 IDTQKKKKKPAA 191
           IDT KKKKKP A
Sbjct: 181 IDT-KKKKKPEA 191

>Kwal_33.15461
          Length = 196

 Score =  261 bits (667), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 145/180 (80%), Gaps = 1/180 (0%)

Query: 2   LKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSSI 61
           L+ V+YCGVCS PP++CEFTGKLKRCKVWL ENH++ +  LY  D EV++ A  L  SSI
Sbjct: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALY-GDQEVEEAAANLAGSSI 61

Query: 62  GGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEID 121
           G              Q+KQE+REQRELAKKLSSKV+IKREARTKRK M+AISGLEVFEID
Sbjct: 62  GEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEID 121

Query: 122 MKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHID 181
           MKKLAKTFASKFATGCSVSKN EKKEEI++QGDVADE EAYI  LLEEKGLK +KVE +D
Sbjct: 122 MKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVEQMD 181

>KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces
           cerevisiae YJR014w singleton, start by similarity
          Length = 200

 Score =  254 bits (649), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 2/180 (1%)

Query: 2   LKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSSI 61
           L  V+YCGVC  P EYCEF+GK KRCK WL+ENH +L+ + Y  D   +DV+ +L  SSI
Sbjct: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWY-GDV-TEDVSKQLAESSI 60

Query: 62  GGAXXXXXXXXXXXXQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEID 121
           G              + KQ++RE+RELAKKLSSKVVI+REARTKRKCMIAISGLEVFEID
Sbjct: 61  GDEREEKLEKALEKLERKQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEID 120

Query: 122 MKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKVEHID 181
           MKKL+KTFASKFATGCS+SKNAEKKEE++VQGD+ADEVEAYIHSLLEEKG+K+VKVE ID
Sbjct: 121 MKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLLEEKGMKEVKVEVID 180

>CAGL0J07678g 750008..750334 highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3, start by similarity
          Length = 108

 Score = 34.3 bits (77), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           S+ + I+ + R  RK +  + G+   E D K++ K     FA   ++ K++E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPA-EYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (16
           kDa) of translation initiation factor eIF3, involved in
           initiation and in monitoring translational accuracy
           during elongation [327 bp, 108 aa]
          Length = 108

 Score = 33.9 bits (76), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           S+ + I+ + R  RK +  + G+   E D+K++ K     FA   ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>Scas_706.15
          Length = 108

 Score = 33.9 bits (76), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           ++ + I+ + R  RK +  + G+   E D+K++ K     FA   ++ K+ E  E I +Q
Sbjct: 23  ANYIHIRIQQRNGRKTLTTVQGVPA-EYDLKRILKVLKKDFACNGNIVKDVEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>CAGL0B01837g complement(166953..168662) similar to tr|Q04600
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 569

 Score = 35.4 bits (80), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 95  KVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSV---SKNAEKKEEIVV 151
           K+ I  E +  RK +  +S  EVF+ID ++ A     K +   ++   + +A+K  E+ V
Sbjct: 475 KINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQV 534

Query: 152 QGDVADEVEAYIHSL 166
           QG     + +Y++ L
Sbjct: 535 QGPHGQLIMSYLNDL 549

>KLLA0C03091g complement(276491..276817) highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3 (eIF3) singleton, start by
           similarity
          Length = 108

 Score = 32.7 bits (73), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           ++ + I+ + R  RK +  + G+   E D+K++ K     FA   ++ K+ E  E I +Q
Sbjct: 23  ANYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGEVIQLQ 81

Query: 153 GDVADEVEAYIHSLL 167
           GD   +V  ++ + L
Sbjct: 82  GDQRAKVSEFMITQL 96

>AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH]
           complement(1512587..1512913) [327 bp, 108 aa]
          Length = 108

 Score = 32.0 bits (71), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           S+ + I+ + R  RK +  + G+   E D+K++ K     F    ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..18002)
           [327 bp, 108 aa]
          Length = 108

 Score = 32.0 bits (71), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           S+ + I+ + R  RK +  + G+   E D+K++ K     F    ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>Sklu_2432.8 YNL244C, Contig c2432 18118-18726
          Length = 202

 Score = 31.2 bits (69), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           ++ + I+ + R  RK +  + G+   E D+K++ K     FA   ++ K+ E  + I +Q
Sbjct: 117 TNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGQIIQMQ 175

Query: 153 GD 154
           GD
Sbjct: 176 GD 177

>AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH]
           (1607516..1607842) [327 bp, 108 aa]
          Length = 108

 Score = 29.6 bits (65), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 93  SSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQ 152
           S+ + I+ + R  RK +  + G+   + D+K++ K     F    ++ K+ E  E I +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGITK-KYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 153 GD 154
           GD
Sbjct: 82  GD 83

>Sklu_2408.7 , Contig c2408 11587-12390
          Length = 267

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 192 LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 243

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 244 IHAKRVTIQKK 254

>Sklu_2251.3 YBR010W, Contig c2251 1534-1944
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>YNL031C (HHT2) [4556] chr14 complement(575638..576048) Histone H3,
           core component of the nucleosome, identical to Hht1p
           [411 bp, 136 aa]
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>YBR010W (HHT1) [203] chr2 (256291..256701) Histone H3, identical to
           Hht2p [411 bp, 136 aa]
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>Scas_716.59
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>Scas_671.9
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>Scas_695.5
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>Kwal_27.11478
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>Kwal_27.10967
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>KLLA0E17677g 1567814..1568224 gi|122091|sp|P02303|H3_YEAST
           Kluyveromyces lactis Histone H3, start by similarity
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>CAGL0M06655g complement(684606..685016) highly similar to sp|P02303
           Saccharomyces cerevisiae YNL031c HHT2 or sp|P02303
           Saccharomyces cerevisiae YBR010w HHT1, start by
           similarity
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>CAGL0H09856g 962788..963198 highly similar to sp|P02303
           Saccharomyces cerevisiae YNL031c HHT2 or sp|P02303
           Saccharomyces cerevisiae YBR010w HHT1, start by
           similarity
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>CAGL0C04114g complement(404740..405150) highly similar to sp|P02303
           Saccharomyces cerevisiae YNL031c HHT2 or sp|P02303
           Saccharomyces cerevisiae YBR010w HHT1, start by
           similarity
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>AER013W [2518] [Homologous to ScYBR010W (HHT1) - SH]
           complement(657106..657516) [411 bp, 136 aa]
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>ADL202C [1539] [Homologous to ScYNL031C (HHT2) - SH]
           (344750..345160) [411 bp, 136 aa]
          Length = 136

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 112

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 113 IHAKRVTIQKK 123

>KLLA0E08591g complement(770773..771303) some similarities with
           sp|P02303 Saccharomyces cerevisiae YNL031c HHT2 histone
           H3, hypothetical start
          Length = 176

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 115 LEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQ 174
           L + ++  ++L +  A  F T      +A         G + + VEAY+ SL E+  L  
Sbjct: 101 LLIRKLPFQRLVREIAQDFKTDLRFQSSAI--------GALQESVEAYLVSLFEDTNLAA 152

Query: 175 VKVEHIDTQKK 185
           +  + +  QKK
Sbjct: 153 IHAKRVTIQKK 163

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,428,067
Number of extensions: 199887
Number of successful extensions: 819
Number of sequences better than 10.0: 43
Number of HSP's gapped: 813
Number of HSP's successfully gapped: 43
Length of query: 191
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 95
Effective length of database: 13,272,781
Effective search space: 1260914195
Effective search space used: 1260914195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)