Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1568.32202209971e-139
Kwal_56.234052802116674e-88
AGR158C2672206403e-84
YDR087C (RRP1)2782265721e-73
Scas_636.102882095686e-73
CAGL0M11110g2702005232e-66
KLLA0C11979g2612205127e-65
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1568.3
         (220 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement        388   e-139
Kwal_56.23405                                                         261   4e-88
AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH] (1043874..1...   251   3e-84
YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein inv...   224   1e-73
Scas_636.10                                                           223   6e-73
CAGL0M11110g complement(1095317..1096129) similar to sp|P35178 S...   206   2e-66
KLLA0C11979g complement(1027919..1028704) similar to sp|P35178 S...   201   7e-65

>Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement
          Length = 220

 Score =  388 bits (997), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 197/220 (89%), Positives = 197/220 (89%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQEITLVDKAFIKFTNGFWKVICLEWYSID 60
           MWFSDRPRPQHRLGNELGELHLLFFAAVENKQEITLVDKAFIKFTNGFWKVICLEWYSID
Sbjct: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQEITLVDKAFIKFTNGFWKVICLEWYSID 60

Query: 61  HHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHII 120
           HHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHII
Sbjct: 61  HHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHII 120

Query: 121 DIFVDEWEKLVIRXXXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQDLSSNIENIKVLR 180
           DIFVDEWEKLVIR                CKQLIAATPLSLFVEIFQDLSSNIENIKVLR
Sbjct: 121 DIFVDEWEKLVIRDGEDEGEDGEEKDSEECKQLIAATPLSLFVEIFQDLSSNIENIKVLR 180

Query: 181 EKIKEDILGDQRLHLWGILTQGDDKVENGXXXXXXXWKGF 220
           EKIKEDILGDQRLHLWGILTQGDDKVENG       WKGF
Sbjct: 181 EKIKEDILGDQRLHLWGILTQGDDKVENGEEEEEEEWKGF 220

>Kwal_56.23405
          Length = 280

 Score =  261 bits (667), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 130/211 (61%), Positives = 157/211 (74%), Gaps = 13/211 (6%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQ---EITLVDKAFIKFTNGFWKVICLEWY 57
           MWFSDRPRPQ RL N LGELH+L+F   +N++   E+TL D+AF+KF+  FW+VICLEWY
Sbjct: 53  MWFSDRPRPQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWY 112

Query: 58  SIDHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPF 117
            IDHHRLDKY+LLVRRVL +QL+YL+LR W+EE+V  YI +VL+KLPLSGDKKVYNGIPF
Sbjct: 113 GIDHHRLDKYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPF 172

Query: 118 HIIDIFVDEWEKLVIRX---------XXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQD 168
           HIIDIFVDEWEKL++                          C + IA TPL+ FVEIF+D
Sbjct: 173 HIIDIFVDEWEKLILHNGEDEDEEDDEKTNQEDEEAKLQEECAR-IAETPLAQFVEIFED 231

Query: 169 LSSNIENIKVLREKIKEDILGDQRLHLWGIL 199
           L+SNI NIK LR+KIKEDI  D+RL  WG+L
Sbjct: 232 LASNINNIKSLRDKIKEDIFKDERLKKWGVL 262

>AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH]
           (1043874..1044677) [804 bp, 267 aa]
          Length = 267

 Score =  251 bits (640), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 154/220 (70%), Gaps = 8/220 (3%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQEITLVDKAFIKFTNGFWKVICLEWYSID 60
           MWFSDRPRPQ RL  +LGEL LLF        +  L D+AF++F+  FWKV+CLEWY+ID
Sbjct: 56  MWFSDRPRPQQRLAAQLGELSLLFLDG-----DTALGDRAFVRFSKAFWKVMCLEWYNID 110

Query: 61  HHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHII 120
           HHRLDKY+LLVRRVL+NQL++L+ R W+  LV +Y+  VL+ LPLSG  KVYNGIPFHII
Sbjct: 111 HHRLDKYLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHII 170

Query: 121 DIFVDEWEKLVIRXXXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQDLSSNIENIKVLR 180
           DIFVDEWE+LV+R                 + LIAATPL  FV +FQ L++NI NIK+LR
Sbjct: 171 DIFVDEWERLVLRDGRDAEDADMPELPEQ-RDLIAATPLPRFVAVFQGLAANIANIKILR 229

Query: 181 EKIKEDILGDQRLHLWGILTQGDDKVENGXXXXXXXWKGF 220
           EKIK+D+L DQRL+ WG+L +  D  E+        W GF
Sbjct: 230 EKIKQDLLADQRLYDWGVLAR--DSPESDDDDDVEEWHGF 267

>YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein
           involved in maturation of 25S rRNA [837 bp, 278 aa]
          Length = 278

 Score =  224 bits (572), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 147/226 (65%), Gaps = 6/226 (2%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQ--EITLVDKAFIKFTNGFWKVICLEWYS 58
           MWFSDRPRPQ RL NELGELH L+F   +N    E+T  DKAFIKF+ GFWKV+C EW++
Sbjct: 53  MWFSDRPRPQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFN 112

Query: 59  IDHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFH 118
           ID +RLDKY+LL+RRVLF+QLKYL+ RNW+++LV +YI  VL+ LPLSG  KVY GIP H
Sbjct: 113 IDRYRLDKYLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIH 172

Query: 119 IIDIFVDEWEKLV-IRXXXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQDLSSNIENIK 177
           I+DI +DEWE+L+                     +    TPL+  + IFQD+ ++  N K
Sbjct: 173 IVDILLDEWERLLKDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSK 232

Query: 178 VLREKIKEDILGDQRLHLWGIL---TQGDDKVENGXXXXXXXWKGF 220
           VLREKIKED+  D RL  W IL   TQ +D            WKGF
Sbjct: 233 VLREKIKEDLFSDTRLVSWDILEGETQHNDSSNESEEEEEEEWKGF 278

>Scas_636.10
          Length = 288

 Score =  223 bits (568), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 112/209 (53%), Positives = 140/209 (66%), Gaps = 5/209 (2%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAA-----VENKQEITLVDKAFIKFTNGFWKVICLE 55
           MWFSDRPRPQ RL N+LG+L+ L+F        EN+  ++  DKAFIKF+  FWK++CLE
Sbjct: 53  MWFSDRPRPQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLE 112

Query: 56  WYSIDHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGI 115
           WYSID  R+DKY+LL RRV FNQLKYL+ RNWN +LV +Y   VL  LPLSGD KVY+GI
Sbjct: 113 WYSIDRFRMDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGI 172

Query: 116 PFHIIDIFVDEWEKLVIRXXXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQDLSSNIEN 175
           PFHIIDI +DEWE+L+                      +  TPL+ F++IF  L SN+ N
Sbjct: 173 PFHIIDILLDEWERLLTDKDDEHDDEEKETDEVDIVIAVKETPLNNFIKIFYGLVSNVNN 232

Query: 176 IKVLREKIKEDILGDQRLHLWGILTQGDD 204
            K+LR KIKED+L D RL  WGI+   D+
Sbjct: 233 SKILRTKIKEDLLADPRLIEWGIIENTDE 261

>CAGL0M11110g complement(1095317..1096129) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs, start
           by similarity
          Length = 270

 Score =  206 bits (523), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 138/200 (69%), Gaps = 3/200 (1%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVEN-KQEITLVDKAFIKFTNGFWKVICLEWYSI 59
           MWF DRPRPQ RL + LG LH+ FF   ++  +E+T+ DKAF++F+  FW+++CLEW  I
Sbjct: 53  MWFCDRPRPQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGI 112

Query: 60  DHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHI 119
           D  RLDKY+LL+RR LFNQ KYL++R W+  LV KY++ VL  +PLSGD KVYNGIP H+
Sbjct: 113 DRFRLDKYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHV 172

Query: 120 IDIFVDEWEKLVIRXXXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQDLSSNIENIKVL 179
           +DI +DEWE+L +                  K+ ++ +PL   ++I ++L  N +N K+L
Sbjct: 173 MDIMLDEWERLAL--EDEEEELEEDKKLEIMKEFVSGSPLDQVLDILRNLLKNYDNSKIL 230

Query: 180 REKIKEDILGDQRLHLWGIL 199
           R+KIK+++L D+RL  WGI+
Sbjct: 231 RDKIKKEVLTDKRLAQWGIV 250

>KLLA0C11979g complement(1027919..1028704) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs
           singleton, start by similarity
          Length = 261

 Score =  201 bits (512), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 139/220 (63%), Gaps = 10/220 (4%)

Query: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQEITLVDKAFIKFTNGFWKVICLEWYSID 60
           MW  D+P PQ  L   LGELHLL+    +N+Q       AFI+F+  FWKVIC+EWY ID
Sbjct: 52  MWHCDKPIPQQSLAYSLGELHLLYLKG-KNQQ-------AFIRFSKAFWKVICIEWYRID 103

Query: 61  HHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHII 120
           HHRLDK++LL+RR L  Q+KYL    W + LV  YI+ VLKK+PLSGD+KVYNGIPFHII
Sbjct: 104 HHRLDKFLLLIRRCLHFQIKYLHECEWEQALVDDYINKVLKKIPLSGDRKVYNGIPFHII 163

Query: 121 DIFVDEWEKLVIRXXXXXXXXXXXXXXXXCKQLIAATPLSLFVEIFQDLSSNIENIKVLR 180
           DI +DEW K V                   K+ ++ TPLS F+ IFQ+LSS+  NIK+LR
Sbjct: 164 DILLDEWVK-VCYGEEEDEEDNEDDKEEEIKEAVSKTPLSDFISIFQELSSDTNNIKILR 222

Query: 181 EKIKEDILGDQRLHLWGILTQGDDKVENGXXXXXXXWKGF 220
           +KIKED+L DQRL  W +L Q  +  +         W GF
Sbjct: 223 DKIKEDLLKDQRLRAWDVL-QSPEDEQEAEEEEAEEWHGF 261

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.144    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,894,204
Number of extensions: 280906
Number of successful extensions: 1025
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1012
Number of HSP's successfully gapped: 12
Length of query: 220
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 122
Effective length of database: 13,203,545
Effective search space: 1610832490
Effective search space used: 1610832490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)