Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1568.270702462e-29
Kwal_56.23403111702092e-23
KLLA0C11957g70701793e-19
AGR157C70701793e-19
Scas_636.9*72681698e-18
YDR086C (SSS1)80681664e-17
ADL235W58233600.64
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1568.2
         (70 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement         99   2e-29
Kwal_56.23403                                                          85   2e-23
KLLA0C11957g complement(1027449..1027661) similar to sp|P35179 S...    74   3e-19
AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH] (1043498..1...    74   3e-19
Scas_636.9*                                                            70   8e-18
YDR086C (SSS1) [938] chr4 complement(616922..617164) Component o...    69   4e-17
ADL235W [1506] [Homologous to ScYNL048W (ALG11) - SH] complement...    28   0.64 

>Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement
          Length = 70

 Score = 99.4 bits (246), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 51/70 (72%)

Query: 1  MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKXXXXXXXXXXXXXXXXXXXKL 60
          MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLK                   KL
Sbjct: 1  MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKIVRAVGIGFVAVGVIGYAIKL 60

Query: 61 VHIPIRYLIV 70
          VHIPIRYLIV
Sbjct: 61 VHIPIRYLIV 70

>Kwal_56.23403
          Length = 111

 Score = 85.1 bits (209), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%)

Query: 1   MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKXXXXXXXXXXXXXXXXXXXKL 60
           M+K NNQIE+LAEAP+EFVK+GSAFIQKCKKP NK++L+                   KL
Sbjct: 42  MSKSNNQIEKLAEAPVEFVKEGSAFIQKCKKPTNKDFLQIVRAVGIGFVAVGIIGYAIKL 101

Query: 61  VHIPIRYLIV 70
           VHIPIRYLIV
Sbjct: 102 VHIPIRYLIV 111

>KLLA0C11957g complement(1027449..1027661) similar to sp|P35179
          Saccharomyces cerevisiae YDR086c SSS1 ER
          protein-translocase complex subunit singleton, start by
          similarity
          Length = 70

 Score = 73.6 bits (179), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 44/70 (62%)

Query: 1  MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKXXXXXXXXXXXXXXXXXXXKL 60
          MAK N Q ++L E PLEFVK+G+ F+QKCKKP+ KEYLK                   KL
Sbjct: 1  MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKIIQAVGIGFVAVGVIGYIIKL 60

Query: 61 VHIPIRYLIV 70
          +HIPIRYLIV
Sbjct: 61 IHIPIRYLIV 70

>AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH]
          (1043498..1043710) [213 bp, 70 aa]
          Length = 70

 Score = 73.6 bits (179), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 1  MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKXXXXXXXXXXXXXXXXXXXKL 60
          MAK NN +E+L++APLEF KDG+AF+ KC KPN +E+L+                   KL
Sbjct: 1  MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60

Query: 61 VHIPIRYLIV 70
          +HIPIR+LIV
Sbjct: 61 IHIPIRHLIV 70

>Scas_636.9*
          Length = 72

 Score = 69.7 bits (169), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%)

Query: 3  KGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKXXXXXXXXXXXXXXXXXXXKLVH 62
          K +NQIE+L +APLEFVKDG+ F+ KCKKP+ KEY +                   KL+H
Sbjct: 5  KSDNQIEKLMDAPLEFVKDGNQFLNKCKKPDLKEYTRIVRAVGIGFVAVGIIGYAIKLIH 64

Query: 63 IPIRYLIV 70
          IPIRY+IV
Sbjct: 65 IPIRYVIV 72

>YDR086C (SSS1) [938] chr4 complement(616922..617164) Component of
          the Sec61p-Sss1p-Sbh1p complex and the
          Ssh1p-Sss1p-Sbh2p complex, involved in protein
          translocation into the endoplasmic reticulum [243 bp,
          80 aa]
          Length = 80

 Score = 68.6 bits (166), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%)

Query: 3  KGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKXXXXXXXXXXXXXXXXXXXKLVH 62
          + NNQ+E+L EAP+EFV++G+ F+ KCKKP+ KEY K                   KL+H
Sbjct: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIH 72

Query: 63 IPIRYLIV 70
          IPIRY+IV
Sbjct: 73 IPIRYVIV 80

>ADL235W [1506] [Homologous to ScYNL048W (ALG11) - SH]
           complement(291105..292853) [1749 bp, 582 aa]
          Length = 582

 Score = 27.7 bits (60), Expect = 0.64,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 7   QIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLK 39
           ++EQLA + L   K+   FI  CK    K+YL+
Sbjct: 408 KLEQLAYSELAIPKESLEFITDCKYEKMKKYLQ 440

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,755,583
Number of extensions: 41107
Number of successful extensions: 69
Number of sequences better than 10.0: 7
Number of HSP's gapped: 63
Number of HSP's successfully gapped: 7
Length of query: 70
Length of database: 16,596,109
Length adjustment: 43
Effective length of query: 27
Effective length of database: 15,107,535
Effective search space: 407903445
Effective search space used: 407903445
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)