Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1537.21311316764e-93
Kwal_14.21881371332791e-32
YPR017C (DSS4)1431392504e-28
Scas_602.61461422034e-21
CAGL0K02475g1501421582e-14
Scas_654.3143144585.1
ACR009W68094586.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1537.2
         (131 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement        265   4e-93
Kwal_14.2188                                                          112   1e-32
YPR017C (DSS4) [5451] chr16 complement(593481..593912) Guanine-n...   100   4e-28
Scas_602.6                                                             83   4e-21
CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces c...    65   2e-14
Scas_654.31                                                            27   5.1  
ACR009W [1057] [Homologous to ScYEL062W (NPR2) - SH] complement(...    27   6.2  

>Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement
          Length = 131

 Score =  265 bits (676), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTKEHCPQGKFLIVNDVWDFDN 60
           MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTKEHCPQGKFLIVNDVWDFDN
Sbjct: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTKEHCPQGKFLIVNDVWDFDN 60

Query: 61  IGVSRNIPDLKGFEMSVSCEEETVFTINRVIKYLICADCDKGPLGIVCEARSKDGLDTKV 120
           IGVSRNIPDLKGFEMSVSCEEETVFTINRVIKYLICADCDKGPLGIVCEARSKDGLDTKV
Sbjct: 61  IGVSRNIPDLKGFEMSVSCEEETVFTINRVIKYLICADCDKGPLGIVCEARSKDGLDTKV 120

Query: 121 INLLSLESVKI 131
           INLLSLESVKI
Sbjct: 121 INLLSLESVKI 131

>Kwal_14.2188
          Length = 137

 Score =  112 bits (279), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 7/133 (5%)

Query: 3   KLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTKEHCPQGKFLIVNDVWDFDNIG 62
           KL CP+ +C  CI+  +   +  LPL+VY+   + +P       G+FL+  D+WDFDNIG
Sbjct: 4   KLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEANGEFLVFEDIWDFDNIG 63

Query: 63  VSRNIPD--LKGFE---MSVSCEEETVFTINRVIKYLICADCDKGPLGIVCEARSKDGLD 117
           +SR IP+  + G E   +S S E+   + + ++++Y+ICA+CDKGPLGIVCE  + +G +
Sbjct: 64  MSRPIPEELISGQEEPPISFSWEQHE-YKLRKLLRYIICAECDKGPLGIVCEVENDEG-N 121

Query: 118 TKVINLLSLESVK 130
           +  +NLLSL SV+
Sbjct: 122 SMNVNLLSLASVR 134

>YPR017C (DSS4) [5451] chr16 complement(593481..593912)
           Guanine-nucleotide exchange factor for Sec4p [432 bp,
           143 aa]
          Length = 143

 Score =  100 bits (250), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 82/139 (58%), Gaps = 8/139 (5%)

Query: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNIL--LPTKEHCP-QGKFLIVNDVWD 57
           MSK  C F+ C   +I +     + LP QV+ +  +L     ++  P +  FL+V DVWD
Sbjct: 1   MSKATCSFEGCHSAVITINDDNIINLPEQVHSEFKLLENRTMRDATPSESNFLVVPDVWD 60

Query: 58  FDNIGVSRNIP-----DLKGFEMSVSCEEETVFTINRVIKYLICADCDKGPLGIVCEARS 112
           FDN+GVSR IP     DL      V     + + I + +KYLICADCDKGP+GI+C+ + 
Sbjct: 61  FDNVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIGIICKVQD 120

Query: 113 KDGLDTKVINLLSLESVKI 131
           +   + +V++LLSL S++I
Sbjct: 121 QTKNEERVLHLLSLRSLQI 139

>Scas_602.6
          Length = 146

 Score = 82.8 bits (203), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 14/142 (9%)

Query: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTK----EHCPQGKFLIVNDVW 56
           MSK IC F  C C II L     + LP  +++ L+++   +    +      FLI  DVW
Sbjct: 1   MSKAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVW 60

Query: 57  DFDNIGVSRNIPDLKGFEMSVSCEEET---------VFTINRVIKYLICADCDKGPLGIV 107
           DFDNIGVS+++      E++      T         ++ I +  KYLIC DCD+GP+G+V
Sbjct: 61  DFDNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMV 120

Query: 108 CEARSKDGLDTKVINLLSLESV 129
           C    +D  + +   LLSL S+
Sbjct: 121 CMISQQDDQERRAY-LLSLGSL 141

>CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces
           cerevisiae YPR017c exchange factor for SEC4P,
           hypothetical start
          Length = 150

 Score = 65.5 bits (158), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 1   MSKLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNIL-----LPTKEHCPQGK---FLIV 52
           + K  C F +C   +I +      T    +Y    I+     + T+E     K   FL+V
Sbjct: 7   VRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKEYEFLVV 66

Query: 53  NDVWDFDNIGVSRNI----PDLKGFEMSVSCEEETVFTINRVIKYLICADCDKGPLGIVC 108
            + WDFDNIGVSR++     D    E     +  T + +    +YL CA+CD+GP+G++C
Sbjct: 67  PEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHT-WELIHCQRYLACAECDRGPIGLLC 125

Query: 109 EAR-SKDGLDTKVINLLSLESV 129
           E + + D   T+ I LLS+ SV
Sbjct: 126 EVQDANDHSSTRKICLLSIASV 147

>Scas_654.31
          Length = 431

 Score = 26.9 bits (58), Expect = 5.1,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 8/44 (18%)

Query: 36 ILLPTKEHCPQGKFLIVNDVWD----FDNI----GVSRNIPDLK 71
          + L  KEH   GK     D+WD    + N+     +  NIPD K
Sbjct: 46 VTLLQKEHVKVGKLFTAQDIWDRLSRYYNLKELDAMENNIPDEK 89

>ACR009W [1057] [Homologous to ScYEL062W (NPR2) - SH]
           complement(371964..374006) [2043 bp, 680 aa]
          Length = 680

 Score = 26.9 bits (58), Expect = 6.2,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 13/94 (13%)

Query: 14  CIIPLEKGTQVTLPLQVYKDLNILLPTK-----EHCPQGKFLIVNDV---WDFDNIGVSR 65
           C+IP++ G  + + L       +L P       E  P  K  ++N V   WD   + +  
Sbjct: 215 CLIPMDSGNAIDIKL-----FPLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVP 269

Query: 66  NIPDLKGFEMSVSCEEETVFTINRVIKYLICADC 99
            I  +        C +  V  +   IK+L+  DC
Sbjct: 270 FINGINSIAKISKCSDSAVELVMECIKHLVYYDC 303

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.143    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,283,454
Number of extensions: 176387
Number of successful extensions: 290
Number of sequences better than 10.0: 10
Number of HSP's gapped: 284
Number of HSP's successfully gapped: 10
Length of query: 131
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 41
Effective length of database: 13,480,489
Effective search space: 552700049
Effective search space used: 552700049
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)