Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1484.339939919460.0
Kwal_23.346740039913880.0
KLLA0E14850g39638613410.0
ADL284C42237512791e-176
Scas_618.1340736012691e-174
YGL143C (MRF1)41338912491e-171
CAGL0E04928g40539111601e-158
AGR281C176381123e-06
Sklu_2044.5123461057e-06
YLR281C155391051e-05
Kwal_56.23313158391052e-05
KLLA0C04642g168421052e-05
Scas_590.1116421004e-05
CAGL0F05027g18740938e-04
KLLA0C07513g43943682.3
CAGL0K12892g737128663.8
YER183C (FAU1)21150635.6
Scas_720.74223158639.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1484.3
         (399 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1484.3 YGL143C, Contig c1484 4090-5289                           754   0.0  
Kwal_23.3467                                                          539   0.0  
KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...   521   0.0  
ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH] (203883..20...   497   e-176
Scas_618.13                                                           493   e-174
YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondr...   485   e-171
CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces c...   451   e-158
AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)...    48   3e-06
Sklu_2044.5 YLR281C, Contig c2044 6176-6547                            45   7e-06
YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protei...    45   1e-05
Kwal_56.23313                                                          45   2e-05
KLLA0C04642g complement(427221..427727) some similarities with s...    45   2e-05
Scas_590.1                                                             43   4e-05
CAGL0F05027g complement(512367..512930) similar to tr|Q05863 Sac...    40   8e-04
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    31   2.3  
CAGL0K12892g complement(1274085..1276298) similar to sp|P43556 S...    30   3.8  
YER183C (FAU1) [1611] chr5 complement(553329..553964) 5,10-Methe...    29   5.6  
Scas_720.74                                                            29   9.0  

>Sklu_1484.3 YGL143C, Contig c1484 4090-5289
          Length = 399

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/399 (91%), Positives = 367/399 (91%)

Query: 1   MFSRPLKLLKTRSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFD 60
           MFSRPLKLLKTRSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFD
Sbjct: 1   MFSRPLKLLKTRSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFD 60

Query: 61  VERQKKFAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIXXXX 120
           VERQKKFAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALI    
Sbjct: 61  VERQKKFAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIKSSS 120

Query: 121 XXXXXXXPPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSEN 180
                  PPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSEN
Sbjct: 121 SLLNKLLPPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSEN 180

Query: 181 ESGSGILDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEES 240
           ESGSGILDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEES
Sbjct: 181 ESGSGILDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEES 240

Query: 241 EKEADAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKN 300
           EKEADAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKN
Sbjct: 241 EKEADAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKN 300

Query: 301 KAKAFAILXXXXXXXXXXXXXXXXXXXXXGQVTTTDRSDKIRTYNFPQNRITDHRCGFNL 360
           KAKAFAIL                     GQVTTTDRSDKIRTYNFPQNRITDHRCGFNL
Sbjct: 301 KAKAFAILRAKLAERERKEKEESARAARKGQVTTTDRSDKIRTYNFPQNRITDHRCGFNL 360

Query: 361 HNIDGVMAGERLDDVIEAMERYEGATKSKELLEEIESAH 399
           HNIDGVMAGERLDDVIEAMERYEGATKSKELLEEIESAH
Sbjct: 361 HNIDGVMAGERLDDVIEAMERYEGATKSKELLEEIESAH 399

>Kwal_23.3467
          Length = 400

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/399 (67%), Positives = 315/399 (78%), Gaps = 1/399 (0%)

Query: 1   MFSRPLKLLKTRSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGS-SF 59
           M  R  K  + R    SLR  +    EFKELHPLL+KRAEK+V+EL KLE  ++KG  SF
Sbjct: 1   MLPRIAKSGRFRLPKLSLRCYSNTDTEFKELHPLLLKRAEKYVEELQKLEEWMAKGGGSF 60

Query: 60  DVERQKKFAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIXXX 119
           DVERQKKF++LS++VD+F+ Y   +  +K+L+DM++ DPSL  EA +EL +I P L    
Sbjct: 61  DVERQKKFSKLSAVVDSFRIYSREVSTFKELQDMVKDDPSLRDEAELELVQIKPQLEKTA 120

Query: 120 XXXXXXXXPPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSE 179
                   PPHPFAD+PCILE+RPGVGG EAMIFAQDLL+MYIN+AH KRWKYH+ S SE
Sbjct: 121 SSLLTQLLPPHPFADRPCILEIRPGVGGIEAMIFAQDLLNMYINFAHIKRWKYHLISSSE 180

Query: 180 NESGSGILDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEE 239
           NESGSGI+DAILSIDEPGSY  LRFE+GVHRVQRIPATETKGRTHTSTAAV+VLPQM E+
Sbjct: 181 NESGSGIVDAILSIDEPGSYEMLRFESGVHRVQRIPATETKGRTHTSTAAVVVLPQMAED 240

Query: 240 SEKEADAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHK 299
           SEKEAD+YERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTH+PSGIVI+MQNERSQHK
Sbjct: 241 SEKEADSYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHYPSGIVINMQNERSQHK 300

Query: 300 NKAKAFAILXXXXXXXXXXXXXXXXXXXXXGQVTTTDRSDKIRTYNFPQNRITDHRCGFN 359
           NKAKAFAIL                     GQVTTTDRSDKIRTYNFPQNR+TDHRCGFN
Sbjct: 301 NKAKAFAILRARLAEAERKEKEEKARALRKGQVTTTDRSDKIRTYNFPQNRVTDHRCGFN 360

Query: 360 LHNIDGVMAGERLDDVIEAMERYEGATKSKELLEEIESA 398
           LH+++G+MAGERL+DVI AM  Y+  +++KELL   E +
Sbjct: 361 LHDMEGIMAGERLEDVISAMSVYDSDSRAKELLASAEES 399

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 310/386 (80%), Gaps = 2/386 (0%)

Query: 12  RSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELS 71
           R++   +RF ++EA+EF+ LH  LI RAE +V+EL +LE LLS+G SFD+E+QK FA+LS
Sbjct: 13  RNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLS 72

Query: 72  SIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIXXXXXXXXXXXPPHP 131
           +IVD++  Y++ ++ YK+L+++++ DPSL +EA  ++  ++P L            PPHP
Sbjct: 73  TIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHP 132

Query: 132 FADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAIL 191
           FADKP ILELRPGVGG+EAMIF QDLL+MYINYA+  +WK+++ SK+EN SGSG+L+AIL
Sbjct: 133 FADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAIL 192

Query: 192 SIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTF 251
           +IDEPGSY+KL+FEAGVHRVQR+PATE+KGRTHTSTAAVIVLP+MGEES  E+DAYERTF
Sbjct: 193 NIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEES--ESDAYERTF 250

Query: 252 KPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILXXX 311
           KPDEIRIDVMRA GKGGQHVNTTDSAVRLTH+PSGIVISMQ ERSQH+NKAKAFAIL   
Sbjct: 251 KPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAILRAR 310

Query: 312 XXXXXXXXXXXXXXXXXXGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGER 371
                              QV+TTDRSDKIRTYN+PQNRITDHRCGF L++I+GVM GER
Sbjct: 311 LAEKERLEKEEKERNARKDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGER 370

Query: 372 LDDVIEAMERYEGATKSKELLEEIES 397
           LDDVI+AM+ +    K+K+LL+++ +
Sbjct: 371 LDDVIDAMDAFSSEQKAKQLLQDMSA 396

>ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH]
           (203883..205151) [1269 bp, 422 aa]
          Length = 422

 Score =  497 bits (1279), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/375 (62%), Positives = 289/375 (77%), Gaps = 2/375 (0%)

Query: 23  TEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELSSIVDTFQNYKD 82
           ++A  F+ELHP LIKRA  +  EL  LE LLSKG SFDVE+QKK+++LSSIVDTF+ Y+D
Sbjct: 48  SQAEGFRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQD 107

Query: 83  GLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIXXXXXXXXXXXPPHPFADKPCILELR 142
            +  Y++L+DMI QD SL  EA+ EL+E+ P L            PPHPFA+KPCI+ELR
Sbjct: 108 NVHMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELR 167

Query: 143 PGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAILSIDEPGSYNKL 202
           PGVGG EAMIF QDLL+MYI YA   RWK+ +TS +EN +G+G+ +AILSIDEPGSY+++
Sbjct: 168 PGVGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRV 227

Query: 203 RFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTFKPDEIRIDVMR 262
           +FE+GVHRVQRIPATE+KGRTHTSTAAV+VLP+M EE+  E+DAYERTFKP EIRIDVMR
Sbjct: 228 KFESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAEEA--ESDAYERTFKPGEIRIDVMR 285

Query: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILXXXXXXXXXXXXXX 322
           A GKGGQHVNTTDSAVR+THFPSGI I MQ ERSQH+NKAKAF IL              
Sbjct: 286 ASGKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREA 345

Query: 323 XXXXXXXGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGERLDDVIEAMERY 382
                   QV++TDRSDKIRTYNFPQNR+TDHRC  +LH +  V+ GERLD++I++M RY
Sbjct: 346 RERSARKDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARY 405

Query: 383 EGATKSKELLEEIES 397
           +   K+K LL+E+ES
Sbjct: 406 DSEQKAKLLLKEMES 420

>Scas_618.13
          Length = 407

 Score =  493 bits (1269), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 229/360 (63%), Positives = 281/360 (78%)

Query: 30  ELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELSSIVDTFQNYKDGLDNYKD 89
           EL P LI +A +++ EL +L   LS+G +FDV +QK+FA L+SI D FQ Y+  L NYK 
Sbjct: 45  ELQPALISKATEYMKELAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNYKS 104

Query: 90  LKDMIQQDPSLEKEARIELEEIMPALIXXXXXXXXXXXPPHPFADKPCILELRPGVGGTE 149
           L+++ Q DPSL++EA++EL E++P L            PPHPFADK CILELRPGVGGTE
Sbjct: 105 LQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGGTE 164

Query: 150 AMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAILSIDEPGSYNKLRFEAGVH 209
           AMIF QDLL+MYI YAH+ +WKY I ++ ENESG G++DAIL+IDEPGSY+KLRFE+GVH
Sbjct: 165 AMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESGVH 224

Query: 210 RVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTFKPDEIRIDVMRARGKGGQ 269
           RVQRIPATETKGRTHTSTAAV+VLPQMG++S++  +AYERTFKPDEIRIDVMRARGKGGQ
Sbjct: 225 RVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKGGQ 284

Query: 270 HVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILXXXXXXXXXXXXXXXXXXXXX 329
           HVNTTDSAVRLTHFP+GIV+SMQ+ERSQ KNKAKAF IL                     
Sbjct: 285 HVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRARLAEREQKLKEEKERDARK 344

Query: 330 GQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGERLDDVIEAMERYEGATKSK 389
            QVTTTDRSDKIRTYN+PQNR+TDHRCG  L+ +D +M GERL +VI+AM +++   +++
Sbjct: 345 EQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRERAR 404

>YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondrial
           peptide chain release factor, directs termination of
           translation in response to termination codons UAA and
           UAG [1242 bp, 413 aa]
          Length = 413

 Score =  485 bits (1249), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 238/389 (61%), Positives = 290/389 (74%), Gaps = 1/389 (0%)

Query: 5   PLKLLKTRSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQ 64
           PL L++  S  T+ +   +   ++ EL PLL+K+AEK+  EL  L+  LS G  FDV +Q
Sbjct: 24  PL-LVRLTSTTTNSKSNGSIPTQYTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQ 82

Query: 65  KKFAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIXXXXXXXX 124
           K +A+LS++ DTF  YK+ L+  K L++MI  DPSL  EA  E  E++P           
Sbjct: 83  KHYAKLSALTDTFIEYKEKLNELKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVN 142

Query: 125 XXXPPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGS 184
              PPHPFADKP +LELRPGVGG EAMIF Q+LL MYI YA+ ++WKY I SK+ENESGS
Sbjct: 143 KLLPPHPFADKPSLLELRPGVGGIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGS 202

Query: 185 GILDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEA 244
           GI+DAILSI+E GSY++LRFEAGVHRVQRIP+TETKGRTHTSTAAV+VLPQ+G+ES K  
Sbjct: 203 GIIDAILSIEEAGSYDRLRFEAGVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSI 262

Query: 245 DAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKA 304
           DAYERTFKP EIR+D+MRA GKGGQHVNTTDSAVRLTH PSGIV+SMQ+ERSQHKNKAKA
Sbjct: 263 DAYERTFKPGEIRVDIMRASGKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKA 322

Query: 305 FAILXXXXXXXXXXXXXXXXXXXXXGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNID 364
           F IL                      QV++T+RSDKIRTYNFPQNRITDHRCGF L ++ 
Sbjct: 323 FTILRARLAEKERLEKEEKERKARKSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLP 382

Query: 365 GVMAGERLDDVIEAMERYEGATKSKELLE 393
           GV++GERLD+VIEAM +Y+   ++KELLE
Sbjct: 383 GVLSGERLDEVIEAMSKYDSTERAKELLE 411

>CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces
           cerevisiae YGL143c MRF1 peptide chain release factor,
           hypothetical start
          Length = 405

 Score =  451 bits (1160), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 225/391 (57%), Positives = 290/391 (74%), Gaps = 10/391 (2%)

Query: 14  LWTSLRFQTT-------EAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKK 66
           +W + RF +T       EA+EF+EL+PLL+KR      EL +LE  +S G  +D + Q+K
Sbjct: 18  VWRAYRFASTAASEADEEALEFQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRK 75

Query: 67  FAELSSIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIXXXXXXXXXX 126
           +  L S+ D +  YK+ L NY++LK+MI  D SL +EA  EL E++P L           
Sbjct: 76  YNSLMSLQDVYDRYKEQLGNYRELKEMIDVDKSLAEEAAAELHELVPNLKKTTQDLLHRL 135

Query: 127 XPPHPFADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGI 186
            PPHPFA+K C+LELRPGVGG+EAMIFA+DLL+MYI YAH K+WK+HI S  ENE+GSGI
Sbjct: 136 IPPHPFAEKACMLELRPGVGGSEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGI 195

Query: 187 LDAILSIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADA 246
           +DA+L+IDEPG+YN L++EAGVHRVQRIPATE+KGRTHTSTAAV+VLPQ+G+E  K+ DA
Sbjct: 196 MDAVLAIDEPGTYNILKYEAGVHRVQRIPATESKGRTHTSTAAVVVLPQLGDEG-KDLDA 254

Query: 247 YERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFA 306
           +ER+FKP+EIRIDV RA GKGGQHVNTT+SAVRLTH P+GI+I MQ+ERSQH+NKAKAF+
Sbjct: 255 FERSFKPEEIRIDVKRASGKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFS 314

Query: 307 ILXXXXXXXXXXXXXXXXXXXXXGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGV 366
           IL                      QVTT DRSDKIRTYNF QNRITDHRCG NL++++GV
Sbjct: 315 ILRSKLAELEQQQKAEKERQVRKEQVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGV 374

Query: 367 MAGERLDDVIEAMERYEGATKSKELLEEIES 397
           ++GERLDDVI A+  ++   +++ ++E  +S
Sbjct: 375 ISGERLDDVINAVRSFDDNIQAESIIETNQS 405

>AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)
           [531 bp, 176 aa]
          Length = 176

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 26/38 (68%)

Query: 264 RGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNK 301
           RG GGQ +N  +S V+L H PSGIVI  Q  RS+ +N+
Sbjct: 62  RGPGGQKINKCNSKVQLRHVPSGIVIECQATRSREQNR 99

>Sklu_2044.5 YLR281C, Contig c2044 6176-6547
          Length = 123

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAIL 308
            RG GGQ +N  +S V+L H P+GIV+  Q  RS+ +N+  A   L
Sbjct: 13  GRGPGGQKINKCNSKVQLKHLPTGIVVECQETRSRDQNRTIARQKL 58

>YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protein
           containing a peptidyl-tRNA hydrolase domain, which
           contain peptidyl-tRNA hydrolase activity [468 bp, 155
           aa]
          Length = 155

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNK 301
            RG GGQ +N  +S V+L H P+GIV+  Q  RS+ +N+
Sbjct: 45  GRGPGGQKINKCNSKVQLRHEPTGIVVECQETRSREQNR 83

>Kwal_56.23313
          Length = 158

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNK 301
            RG GGQ +N  +S V+L H P+GIV+  Q  RS+ +N+
Sbjct: 47  GRGPGGQKINKCNSKVQLRHLPTGIVVECQETRSRDQNR 85

>KLLA0C04642g complement(427221..427727) some similarities with
           sgd|S0004271 Saccharomyces cerevisiae YLR281c,
           hypothetical start
          Length = 168

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKA 304
            RG GGQ +N  +S V+L H P+GIV+  Q  RS+ +N+  A
Sbjct: 56  GRGPGGQKINKCNSKVQLRHVPTGIVVDCQATRSRDQNRKIA 97

>Scas_590.1
          Length = 116

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 28/42 (66%)

Query: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKA 304
            RG GGQ +N  +S V+L H P+GI++S Q  RS+ +N+  A
Sbjct: 1   GRGAGGQKINKCNSKVQLKHVPTGIIVSCQETRSRDQNRKLA 42

>CAGL0F05027g complement(512367..512930) similar to tr|Q05863
           Saccharomyces cerevisiae YLR281c, hypothetical start
          Length = 187

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 265 GKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKA 304
           G GGQ +N  +S V++ H PS IV++ Q  RS+ +N+  A
Sbjct: 61  GPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNRKIA 100

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 249 RTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISM 291
           ++F+P    I  +   G+      + DSA+RLTH+PSG  +SM
Sbjct: 239 KSFQPHTQWIRSLHVHGEFVL-TGSNDSAIRLTHWPSGNGLSM 280

>CAGL0K12892g complement(1274085..1276298) similar to sp|P43556
           Saccharomyces cerevisiae YFL047w, start by similarity
          Length = 737

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 53/128 (41%), Gaps = 16/128 (12%)

Query: 149 EAMIFAQDLLHM----YIN-----YAHTKR----WK---YHITSKSENESGSGILDAILS 192
           EA  F Q+LL++    Y N     + ++K+    WK   Y     S ++  + +L + L+
Sbjct: 276 EAEAFGQELLNLGFIKYCNGVGTTFVNSKKFQYQWKPYAYKYARLSYSDGSNNVLSSSLT 335

Query: 193 IDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTFK 252
            D   + +    +      QR  + ET G  + +    I    + E  + +   Y+  FK
Sbjct: 336 KDFENNVSTYLQDMTTKISQRAVSNETNGSPNVNEKERIFFKLLKEMEDADNKYYKEAFK 395

Query: 253 PDEIRIDV 260
            D +R  V
Sbjct: 396 MDSLRCSV 403

>YER183C (FAU1) [1611] chr5 complement(553329..553964)
           5,10-Methenyltetrahydrofolate synthetase [636 bp, 211
           aa]
          Length = 211

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 33  PLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELSSIVDT-FQNYK 81
           P  +K  E H++E + L+ +L  G +FD++   +    +   D  FQ YK
Sbjct: 116 PYQLKEPEPHIEESDILDVVLVPGVAFDIKTGARMGHGAGYYDDFFQRYK 165

>Scas_720.74
          Length = 2231

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 49  LEGLLSKGSSFDVERQKKFAELSSIVDTFQNYKDGLDNYKDLKDMIQQ------DPSL 100
            EGLL    S  VE  K   +  S++ T QN   G DN   +   +QQ      DP L
Sbjct: 781 FEGLLPDFGSPVVEGTKPAYKFKSLISTLQNILQGYDNQIIMNASVQQLIEVLRDPKL 838

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,656,861
Number of extensions: 464129
Number of successful extensions: 1550
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1561
Number of HSP's successfully gapped: 33
Length of query: 399
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 295
Effective length of database: 12,995,837
Effective search space: 3833771915
Effective search space used: 3833771915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)